CLUSTAL format seed alignment for MF_00605

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRMD_BACHD      -----------------MKIDFLTLFPEMFQGVLHSSILKQAQER-GAVSFRVVNFREYS
TRMD_BACSU      -----------------MKIDFLTLFPEMFEGVLGSSILQKAQEK-DAVQFQVVNFREYS
TRMD_LISIN      -----------------MKIDILSIFPDMFSGVTGSSIIKKAIEN-ERVAVEVTDFREYA
TRMD_LISMO      -----------------MKIDILSIFPDMFSGVTGNSIIKKAIEN-ERVAVEVTDFREYA
TRMD_STAAM      -----------------MKIDYLTLFPEMFDGVLNHSIMKRAQEN-NKLQINTVNFRDYA
TRMD_STAAW      -----------------MKIDYLTLFPEMFDGVLNHSIMKRAQEN-NKLQINTVNFRDYA
TRMD_STRP3      -----------------MKIDILTLFPEMF-APLEHSIVGKAKEK-GLLDIHYHNFRDYA
TRMD_STRP8      -----------------MKIDILTLFPEMF-APLEHSIVGKAKEK-GLLDIHYHNFRDYA
TRMD_STRP1      -----------------MKIDILTLFPEMF-APLEHSIVGKAKEK-GLLDIHYHNFRDYA
TRMD_STRPN      -----------------MKIDILTLFPEMF-SPLEHSIVGKAREK-GLLDIQYHNFRENA
TRMD_LACLA      -----------------MRIDILSIFPEMF-GPLNQSIVGKAQDK-GILELHTHDFRENA
TRMD_LACAC      -----------------MKINILTLFPDMF-TPLQVSMLGRGLED-GKWDLNLVNFRDFT
TRMD_CLOAB      -------------MARKLKIDILTLFPEMFD-LFNLSMIGRAKKN-GIIEINTYNIRDYT
TRMD_CLOPE      -----------------MKINILTLFPEMFD-IFKHSIIGRAREN-GFLHIETINIRDYT
TRMD_CALS4      -----------------MIFDVLTLFPEMFECVLSHSILKRAVEK-SKLKVNLINIRDFS
TRMD_NOSS1      -----------------MRFDIVTLFPDCFTSVLSSGLLGKALAK-QIAQVNLVNPRDFT
TRMD_SYNY3      -----------------MQFDVLTLFPDFFTSPLQSGLLGKALEK-AIASVNLINPRDFT
TRMD_DEIRA      ----------------MLTFSFLTLFPELLTPFAQEAIVGKARER-GLIDVRLVNLRDYA
TRMD_CAMHC      -----------------MNFIFITLFENLIRPYFDDSILGRALKN-EKIKIYFFNPRDFT
TRMD_CAMJE      -----------------MKFSFVSLFPNLMEFYFQDSILARAKEK-KLFKLNFYNPRDFS
TRMD_HELPY      -----------------MKFSVLTLFPQLVWPYFEDSILKRALEK-NLFELEVLNLRDFS
TRMD_HELPJ      -----------------MKFSVLTLFPQLILPYFEDSILKRALEK-NLFELEVLNLRDFS
TRMD_HELHP      -----------------MQFSFLTLFPTLIESYFTDSILKRALQN-GLISVEALNIRDYA
TRMD_LEPBL      -----------------MKFNFITLFPEKIQSYFSEGLQQKAIES-GIFSINTIQLRDFS
TRMD_LEPIN      -----------------MKFNFITLFPDKIQSYFSEGLQQKAIES-GVFSVNIIQLRNFS
TRMD_BORBU      -----------------MKFTVLSLFPAIIKPFFENSIMKKAINK-GIVSFELVDVRDFS
TRMD_TREPA      -----------------MNIDVLTLFPAIPRVYFSTSIMARAVSD-GIIHYNIVNIRDFA
TRMD_MYCGE      -----------------MKITVLTLFENTIWPYLNSSIMLQAQKA-NLVQFEVVNWRNFC
TRMD_MYCPN      -----------------MKITVLTLFEQVVWPYLNASIMAQAQKA-KLVEFEVINWRQYC
TRMD_MYCGA      -----------------MKIVVLTLFDDFVRSYYDFSIIKNALDK-KAVELEVINFRQYA
TRMD_UREPA      -----------------MKISILSLFPELYETWIKHSIISNAIKN-NQVIIEVIDFRLYT
TRMD_AQUAE      ------------MSSNPLRFFVLTIFPHIISCYSEYGIVKQAIKK-GKVEVYPIDLREFA
TRMD_THEMA      -----------------MRITIVTIFPEMVEVIKKYGVIARAVER-GIVEINVENLRDYT
TRMD_BUCAI      --------MKKKYNETIICFNIITIFPEMFYAITNYGIIGQAIKK-KIININFFNPRNFS
TRMD_BUCAP      MELNKHDQTKTKYDNTLIWFCIITIFPEMFYAITNYGVTGKAIRK-NIINIKFFNPRDFT
TRMD_MYCPU      ----------------MLKINFLTIFPKYFDCFLKESIIGKAIER-KKISINVIDFREFS
TRMD_FUSNN      -----------------MKINILTLFPKMFDGFLSESIIARAIKF-GAVEVNIIDIRDYC
TRMD_AGRFC      ---------MT------FKATVLTLYPEMFPGHLQYSLAGKALER-GQWSLDPIQIREFA
TRMD_RHIME      ---------MP------FRATVLTLYPEMFPGHLGVSLAGKALER-GDWSMEAVQIRDFA
TRMD_RHILO      ---------MT------FKASVLTLYPEMFPGALGLSLAGRALEA-GTWSLEAIQIRDFA
TRMD_BRUME      ---------MPEKEGGRFHASVLTLYPEMFPGPLGISLAGKALAE-GKWQLDTVQIRDFA
TRMD_CAUVC      ---------MP------FTATVLTMFPEAFPGPLGVSMIGTAWKEQDLWRLETLDIRAFS
TRMD_RICCN      ---------MS-----ILHATILTVFPEMFPGTLGHSLAGQALNK-NIWSYDVINIRDFG
TRMD_RICPR      ---------MS-----ILHVTILTVFPEMFPGTLGYSLAGQALHN-NIWSYNIINIRDFG
TRMD_MYCLE      -----------------MKIDIVTIFPAYLD-PLRQSLPGKAIES-GLVDVQVHDLRRWT
TRMD_MYCTU      -----------------MRIDIVTIFPACLD-PLRQSLPGKAIES-GLVDLNVHDLRRWT
TRMD_STRCO      -----------------MRLDVVTIFPEYLE-PLNVSLVGKARAR-GQLGVHVHDLRDWT
TRMD_BIFLO      -----------------MKIDIVSVFPEYFE-VMNLSLMGKAQAK-GLLEIKAHNLRDWT
TRMD_CHLMU      -----------------MEIDILSLFPDYFTSPLQATILGRAIKQ-GALSIRSRDIREFG
TRMD_CHLTR      -----------------MEIDILSLFPDYFASPLQATILGRAIKQ-GALSVRSRDIREFG
TRMD_CHLPN      -----------------MKIDILSLFPGYFDGPLQTSILGRAIKQ-RLLDVQLTNLRDFG
TRMD_CHLTE      -----------------MRIEIISVIPDFFASPLEKGLLGIARRK-GLAEIHVHNLHDYG
TRMD_SALTI      -----------------MFIGIVSLFPEMFRAITDYGVTGRAVKK-GLLNIQSWSPRDFA
TRMD_SALTY      -----------------MFIGIVSLFPEMFRAITDYGVTGRAVKK-GLLNIQSWSPRDFA
TRMD_ECOLI      -----------------MWIGIISLFPEMFRAITDYGVTGRAVKN-GLLSIQSWSPRDFT
TRMD_YERPE      -----------------MWIGVISLFPEMFRAITDYGVTGRAVKN-GLLSVQCWSPRDFT
TRMD_HAEIN      -----------------MWIGVISLFPEMFKAITEFGVTGRAVKH-NLLKVECWNPRDFT
TRMD_PASMU      -----------------MLVGIISLFPEMFKAITEFGVTGRAVKQ-NLLQVRCWNPRDFT
TRMD_VIBCH      -----------------MWVGIVSLFPEMFRSVTDFGVTGQAVKK-GLLSVEAWNPRDFA
TRMD_PSEAE      -------------MDKRLWVGVVSIFPEMFRAISDYGITSRAVKQ-GLLTLTCWNPRDYT
TRMD_NEIMA      -----------------MLIQAVTIFPEMFDSITRYGVTGRANRQ-GIWQFEAVNPRKFA
TRMD_NEIMB      -----------------MLIQAVTIFPEMFDSITRYGVTGRANRQ-GIWQFEAVNPRKFA
TRMD_XANAC      -----------------MRIDVISLFPEFIAQCAAFGVVGRAQER-GLLELQGWNPREHA
TRMD_XANCP      -----------------MRIDVISLFPEFIAQCAAFGVVGRAQER-GLLELKGWNPRDHA
TRMD_XYLFA      -----------------MRIDVISLFPEFITQCVGFGVIGRAQER-GLLDLHNWNPRDYA
TRMD_RALSO      -----------------MQFDVISLFPEMFRALTDWGITSRAAKQ-QVYTLRTWNPRDFT
                                 :    :::            :   .            . :   

TRMD_BACHD      ENKHKKVDDYPYGGGAGMVLSPQPLFDAVEDLTKK-SS-------STPRVILMCPQGETF
TRMD_BACSU      DNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTSK-AA-------AAPRIILVCPQGERF
TRMD_LISIN      EGKHQVVDDYPYGGGAGMLLKAQPIFDAVQAVKDKQPE-------TKPRVILMDPAGKRF
TRMD_LISMO      EGKHHIVDDYPYGGGAGMLLKAQPIFDAVQAVKEKQPE-------TKPRVILMDPAGKRF
TRMD_STAAM      INKHNQVDDYPYGGGQGMVLKPEPVFNAMEDLDVT----------EQTRVILMCPQGEPF
TRMD_STAAW      INKHNQVDDYPYGGGQGMVLKPEPVFNAMEDLDVT----------EQTRVILMCPQGEPF
TRMD_STRP3      E-KARHVDDEPYGGGQGMLLRAQPIFDTIEQIEAKK-----------PRIILLDPAGKPF
TRMD_STRP8      E-KARHVDDEPYGGGQGMLLRAQPIFDTIEQIEVKK-----------PRIILLDPAGKPF
TRMD_STRP1      E-KARHVDDEPYGGGQGMLLRAQPIFDTIEQIEAKK-----------PRIILLDPAGKPF
TRMD_STRPN      E-KARHVDDEPYGGGQGMLLRAQPIFDSFDAIEKKN-----------PRVILLDPAGKQF
TRMD_LACLA      TNKQRHVDDMPYGGGQGMLLMPQPIFDTMDKIPQKPE--------KPARVILLDPAGKKF
TRMD_LACAC      TDLHHHVDDTPYGGGAGMVLQIMPIKKALDSLPST------------GKIIITAPQGKTF
TRMD_CLOAB      IDKHKKTDDYPYGGGAGMVMTPQPIVDSIRSVKESN----------KGKVIFLGPRGKKF
TRMD_CLOPE      LNKHKKVDDYPYGGGAGMVMTPQPVVDAIKAVKEKN----------KGKVIFLGPRGKTF
TRMD_CALS4      KDKHKRVDDYPYGGGPGMVMMPQPLFDAIEFVKSQG----------NIPVYYLSPKGKIF
TRMD_NOSS1      TDKHRKVDDEPYGGGVGMLMKPEPIFSAVESLPILERR----------EVILMSPQGQTI
TRMD_SYNY3      TDKHRRVDDEPYGGGVGMVIKPEPIFAAVESLPVLSKR----------EVILMTPQGQPM
TRMD_DEIRA      QNKHLKVDDTPYGGGAGMVIRVDVAARALDAACQAGPR-------P-DEVILFTPAGERF
TRMD_CAMHC      ANKYKKVDSYMIGGGAGLLINTEPLAETIKAVLENFN---------EVRFIFPTPAAKKF
TRMD_CAMJE      KNSYHKVDDYKIGGGAGLLMQAEPMYEVLRSIQEKKE---------NPYFIFLNPSGKTF
TRMD_HELPY      ANKYQKADHTLIGGGAGQILDPEMVENALHSVKNPK------------HTIFLSAVGKPF
TRMD_HELPJ      ANKYQKADHTLIGGGAGQILDPEMIENALHSVKNPK------------HTIFLSAVGKPF
TRMD_HELHP      LDKYQKVDEPPISGGAGQVIRADVLGAALQTLTHS-------------HIIFLSPCGKPF
TRMD_LEPBL      GNKHNRVDDTIYGGGPGMLLRVEPIHKALLSLGEN-----------KGIVILTSPSGIPF
TRMD_LEPIN      GNKHNRVDDTIYGGGPGMLLRVEPIHKAILSLGEE-----------KGIVILTSPSGIPF
TRMD_BORBU      KDKHKRCDDLPYGGGAGMVLKAEPISFALEHVE-----------SAKKTTIFLSPSGIKY
TRMD_TREPA      HDKHKHCDAPPYGGGPGMLMRSEPLGKALDSVD-----------APKKRVVYVTPSGKLF
TRMD_MYCGE      NDKHKTVDDMAYGGGSGMVLKAEPIINCLNFYK-----------APNSHVVLLSPEGEQF
TRMD_MYCPN      KDKHQTVDDMAYGGGGGMVLKAEPILKALKACR-----------TPQSKVVLLSPEGQQF
TRMD_MYCGA      NDKHKTVDDTIYGGSAGMLLKLEPLVNCLRDIKQNQFKD-----PNKIRTYLLSPQGEVY
TRMD_UREPA      NDKHKKVDDYQYGGGAGMVLRIEPIVAAIRAIR-----------SSNSYVILTTPKGQVF
TRMD_AQUAE      PKGQ--VDDVPYGGLPGMVLKPEPIYEAYDYVVENY---------GKPFVLITEPWGEKL
TRMD_THEMA      TDRHRTVDDYQYGGGYGMVMKPEPFFRFYESYVEKY---------GKPYVILTSPQGRIF
TRMD_BUCAI      KNKYKSVDDRPYGGGPGMLMSFEPLYLAIQQAKSTS---------KNVTVIYLSPQGKEL
TRMD_BUCAP      DNKYKSVDDRPYGGGPGMLMSAKPLYLAIKNAKNLL---------KSAIVIYLSPQGKRL
TRMD_MYCPU      ENKHKKVDDSVYGGGQGMLLQVQPIAKALKTLKGL--------------KILVSPQGKLF
TRMD_FUSNN      FDKHKQADDMPFGGGNGMVMKPEPLFLALENVSGK--------------VIYTSPQGKIF
TRMD_AGRFC      TDRHRSVDDTPAGGGAGMVLKPDVLAAAIDHVSK----------GDTRPRLLMSPRGKPL
TRMD_RHIME      GDKHRTVDDTPAGGGAGMVLKPDVLARAIDHVAA----------DDGRPRLLMSPRGRPL
TRMD_RHILO      TDKHRTVDDTPAGGGAGMVMRADVLARAIDHASPP---------GDTRPRLLMSPRGKPL
TRMD_BRUME      EGRHRMVDDTPSGGGAGMVMKADVVARALDSVDD------------GRPMLLMTPRGKPL
TRMD_CAUVC      KDKRGFLDDTPAGGGAGAVLKADVIASALDSLER-----------DGRPLLYMSARGRPL
TRMD_RICCN      LTKHKNIDDEAYGGGNGLIMRPDVLGSSIDHALAL---------NPNAEMYYPSPRGRVF
TRMD_RICPR      LTKHKNVDDKAYGGGDGLIMRPDVLGNAIENALSL---------NHNAKIYYPSPRGCVF
TRMD_MYCLE      HDVHHSVDDVPYGGGPGMVMKAPVWGEALDEICFD-----------ETLLVIPTPAGALF
TRMD_MYCTU      HDVHHSVDDAPYGGGPGMVMKAPVWGEALDEICSS-----------ETLLIVPTPAGVLF
TRMD_STRCO      YDRHNTVDDTPYGGGPGMVMKTEPWGDALDSVLADGYETGC----GEPALVVPTPSGRPF
TRMD_BIFLO      HDVHHSVDDTPVGGGAGMVMKPEVWSECLDELLGFSQPSGSPAPSGAPVLIFPNPSAPLF
TRMD_CHLMU      LGKWKQVDDAPYSGE-GMLLMAEPVVQAIRSVKREKS-----------KVVYLSPQGQLL
TRMD_CHLTR      LGKWKQVDDSPYNGE-GMLLMAEPVVQAIRSIRRKKS-----------KVIYLSPQGQLL
TRMD_CHLPN      LGKWKQVDDTPFSGG-GMLLMAEPVTSAIRSVRKENS-----------KVIYLSPQGALL
TRMD_CHLTE      LGKYQQVDDAPFGGGAGMVIRPEPVFACIEKLQAERSY---------DEVIFMTPDGQAF
TRMD_SALTI      HDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGE--------GAKVIYLSPQGRKL
TRMD_SALTY      HDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGE--------GAKVIYLSPQGRKL
TRMD_ECOLI      HDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGE--------GAKVIYLSPQGRKL
TRMD_YERPE      YDRHRTVDDRPYGGGPGMLMMVQPLREAIHAAKAAAGE--------GAKVIYLSPQGRKL
TRMD_HAEIN      FDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGE--------GAKVIYLSPQGRKL
TRMD_PASMU      HDKHKTVDDRPYGGGPGMLMMVQPLRDAIQAAKAEVGE--------GAKVIYLSPQGRKL
TRMD_VIBCH      HDKRRTVDDKPYGGGPGMLMMVQPLRDAIHAAKQASPG--------KTKVIYLSPQGRKL
TRMD_PSEAE      EDRHQTVDDRPFGGGPGMVMKIKPLEGALADARQAAGGR-------KAKVIYLSPQGRQL
TRMD_NEIMA      DNRLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKAQSSQ--------AAKVIYLSPQGKPL
TRMD_NEIMB      DNRLGYIDDRPFGGGPGMIMMAPPLHAAIEHAKTQSSQ--------AAKVIYLSPQGKPL
TRMD_XANAC      QGNYRRVDDRPFGGGPGMVMLIEPLRACLDAVQAADAR--------PAPVIYLSPQGRPL
TRMD_XANCP      QGNYRRVDDRPFGGGPGMVMLIEPLRACLEVAQAADAR--------PAPVIYLSPQGRPL
TRMD_XYLFA      QGNYRRVDDRPFGGGPGMVMLIEPLRACLEAVRAADPQ--------PAPLIYLSPQGVLL
TRMD_RALSO      TDNYRTVDDRPYGGGPGMVMLAKPLEAALDAIREAQAPA-------PSHVVLLSPQGRPL
                       *    .*  * ::                                  . .   

TRMD_BACHD      TQRKAEEL-AQAEHLILLCGHYEGYDER-IRSY----LVTDELSIGDYVLTGGELGAMVI
TRMD_BACSU      TQKKAEQL-AKEEHLLFICGHYEGYDER-IREH----LVTDEISIGDFVLTGGELPAMMI
TRMD_LISIN      DQKMAEEF-AEEEHLVFICGHYEGYDER-IREH----LVTDEVSIGDYILTGGEIGAMIV
TRMD_LISMO      NQKMAEEF-AEEEHLVFICGHYEGYDER-IREH----LVTDEVSIGDYILTGGEIGAMIV
TRMD_STAAM      SHQKAVEL-SKADHIVFICGHYEGYDER-IRTH----LVTDEISMGDYVLTGGELPAMTM
TRMD_STAAW      SHQKAVEL-SKADHIVFICGHYEGYDER-IRTH----LVTDEISMGDYVLTGGELPAMTM
TRMD_STRP3      TQAYAEEL-ALEEELIFICGHYEGYDER-IKT-----LVTDEISLGDFVLTGGELAAMTM
TRMD_STRP8      TQAYAEEL-ALEEELIFICGHYEGYDER-IKT-----LVTDEISLGDFVLTGGELAAMTI
TRMD_STRP1      TQAYAEEL-ALEEELIFICGHYEGYDER-IKT-----LVTDEISLGDFVLTGGELAAMTM
TRMD_STRPN      DQAYAEDL-AQEEELIFICGHYEGYDER-IKT-----LVTDEISLGDYVLTGGELAAMTM
TRMD_LACLA      DQKMAEEL-SQEEQLIFICGHYEGYDER-IKT-----LVTDEISLGDFVLTGGEVAATVM
TRMD_LACAC      NEKMAQEW-AKEDELTFICGHYEGFDQR-VYD-----LADETVSIGDYVLTGGELPTMSM
TRMD_CLOAB      DQEDAKKL-ADREELIILCGHYEGIDER-VYK-----YIDEEYSLGDFVLTGGEMACIPI
TRMD_CLOPE      NQEMAKEL-SKEEELVFVCGHYEGIDQR-VYK-----YFDLEISLGDFVLTGGEMACIPV
TRMD_CALS4      TQEMAREL-SKMERIALLCGHYEGIDER-VYA-----VIDGEISIGDFILTGGELAAMVV
TRMD_NOSS1      NQPLLRELVSNYEQLVVICGHYEGVDDR-VLH-----LVTREVSLGDFILTGGEIPAMAL
TRMD_SYNY3      DQALFREL-TNYDQLVLICGHYEGVDER-VCQ-----LVTREVSLGDFVLTCGEIPALTL
TRMD_DEIRA      TQQVAEEL-ANKQHLVFLCGRYEGFDAR-VEG-----LVTRELSLGDFVMMGGEAAAACV
TRMD_CAMHC      TQNDAKRLSK-YKNLCFICGRYEGIDER-IVEK----YVNEVFCLGDFILTGGELAAMCF
TRMD_CAMJE      NQKDAKRLSK-KEHIVFVCGRYEGIDER-VLEI----FANEVFSIGDFILTGGELPALVM
TRMD_HELPY      KQTDAMRLAQ-KKHVVLVCGRYEGFDER-SIEL----GADEVFCIGDFILTGGELGALCL
TRMD_HELPJ      KQIDAMRLAQ-KKHVVLVCGRYEGFDER-SIEL----GADEVFCIGDFILTGGELGALCL
TRMD_HELHP      QQYDALRLSH-KKHITFVCGRYEGFDER-LVEQ----YANEVMSVGNFIVTGGELPALML
TRMD_LEPBL      HQGIANKLKETGKPLTFISGYYEGVDHR-VAEH----LVDMEMSLGNYVISAGDLASICI
TRMD_LEPIN      NQSIAMDLKKGGKPLTFISGYYEGVDHR-VTEH----LVDMEMSLGNYVLSAGDLASICI
TRMD_BORBU      SQELAYSLSK-REEIVIICGRYEGIDQR-IIDL----YVDFEISIGDYVLSSGEIAALVL
TRMD_TREPA      EQGYARSLAQ-ERALVLICGRYEGIDQR-IIDE----YVDDEVCIGNYVLSSGEIAALVL
TRMD_MYCGE      SQNCAKKLTK-YEHLILLSGHYEGFDQR-IYK-----YIDQIVSLGDFVLSGGELVALSV
TRMD_MYCPN      SQPMAQALTQ-TEHLILICGHYEGFDYR-LYK-----HVDQIISLGDFVLSGGELVALSV
TRMD_MYCGA      DQNKAVALSQSDHDLILIAGRYEGFDER-IYH-----YVDGALSVGDFVITGGELAALIV
TRMD_UREPA      NQELANNFVSKYDHIIIIAGHYEGFDER-INY-----YIDAQYSIGDFVLTGGELPSMVI
TRMD_AQUAE      NQKLVNELSKKE-RIMIICGRYEGVDER-VK-K----IVDMEISLGDFILSGGEIVALAV
TRMD_THEMA      NYKIAEELSKKD-DIVIFCGRYEGIDER-VM-S----IVDDEISIGDYILTGGELPAMVI
TRMD_BUCAI      KQNHIEELLVKKKKIVFICGRYEGIDQR-IIDN----QVDEEWSIGSYILTGGELAAMVM
TRMD_BUCAP      NQKKILEI-IKNKKIIFVCGRYEGIDQR-IIDC----QVDEEWSIGDYILTGGELAAMVA
TRMD_MYCPU      NQEIAKEIVKNHSEITFVSGRYEGFDER-IL-N----YIDIELSIGDYILTGGELPSMVM
TRMD_FUSNN      NQEIAKELVKEE-ELTIIAGHYEGVDER-VVEN----KVDMELSIGDFVLTGGEIAAMAI
TRMD_AGRFC      SQNRVRELAA-GDGAIIVCGRFEGVDQRVIEAR-----GLEEVSIGDYILSGGEPAALTL
TRMD_RHIME      TQERVRALAA-GPGAVVVCGRFEGVDQRVIDTR-----GLEEVSIGDYILSGGEPAALVL
TRMD_RHILO      TQARVRELAA-GPGAVILCGRFEGVDQRLIEVR-----GLEEVSIGDFILSGGEPAALVL
TRMD_BRUME      TQERVRALAD-GAGAIILCGRFEGVDERVIEGR-----NLEEISIGDYILSGGETAAIVL
TRMD_CAUVC      TQARVREWSK-APGIVVLCGRFEGVDQRVLDAR-----GFEEVSVGDAVLAGGEAAAMVV
TRMD_RICCN      TQSFAKEMLK-NKNLIFLCGRYEGIDERVIEEY-----NVKEISVGDYILSGGEIPTLTI
TRMD_RICPR      TQSFAKEMLK-NKNLIFLCGRYEGIDERVIAEY-----NVTEVSVGDYILSGGEIPTLTI
TRMD_MYCLE      TQATAQCWST-ERHLVFACGRYEGIDQRVVDDA-VRRMRVEEVSIGDYVLPGGESAAVVM
TRMD_MYCTU      TQATAQRWTT-ESHLVFACGRYEGIDQRVVQDA-ARRMRVEEVSIGDYVLPGGESAAVVM
TRMD_STRCO      TQELAVHLSE-RPWLIFTPARYEGIDRRVVDEY-ATRMPVYEVSIGDYVLAGGEAAVLVV
TRMD_BIFLO      TQRDATELSH-ADHLLFGCGRYEGYDARIPDYYRAQGVDVREYSIGDYVLNGGEVAVSVM
TRMD_CHLMU      SAKKSRELSL-CPHLILLCGHYEGIDERALASE-----VDEEISIGDYVLTNGCAAALVL
TRMD_CHLTR      SAKKSRELAS-CSHLVLLCGHYEGIDERALTAE-----VDEEISIGDYVLTNGCAAALVL
TRMD_CHLPN      TAEKSRELAA-ASHLILLCGHYEGIDERAIESE-----VDEEISIGDYVLTNGGIAALVL
TRMD_CHLTE      DQKRANRLSR-KGNLIILCGHYKAIDERIRRTL-----VTMELSVGDVVLSGGEIPALMV
TRMD_SALTI      DQAGVSELAT-NQKLILVCGRYEGVDERVIQAE-----IDEEWSIGDYVLSGGELPAMTL
TRMD_SALTY      DQAGVSELAT-NQKLILVCGRYEGVDERVIQTE-----IDEEWSIGDYVLSGGELPAMTL
TRMD_ECOLI      DQAGVSELAT-NQKLILVCGRYEGIDERVIQTE-----IDEEWSIGDYVLSGGELPAMTL
TRMD_YERPE      DQQGVCELAM-NQKMILVCGRYEGVDERVIKTE-----IDEEWSIGDYVLSGGELPAMTL
TRMD_HAEIN      DQGGVTELAQ-NQKLILVCGRYEGIDERLIQTE-----IDEEWSIGDYVLTGGELPAMTL
TRMD_PASMU      DQAGVKELAQ-HQKLILLCGRYEGIDERLIETE-----VDEEWSVGDYVLTGGELPAMTL
TRMD_VIBCH      DQQGVEELAQ-NQNLILICGRYEGVDERIIESE-----VDEEWSIGDFVMTGGELPAMTL
TRMD_PSEAE      TQAGVRELAE-EEALILIAGRYEGIDERFIEEH-----VDEEWSIGDYVLSGGELPAMVL
TRMD_NEIMA      THPKAAELAE-LPHLILLCGRYEGIDERLLQTS-----VDEEISIGDFVVSGGELPAMML
TRMD_NEIMB      THQKAVELAE-LPHLILLCGRYEGIDERLLQSS-----VDEEISIGDFVVSGGELPAMML
TRMD_XANAC      TQVLARELAQ-LPRMVLVCGRYEGVDERFLAQA-----VDMEISIGDYVLSGGELGAAVV
TRMD_XANCP      TQPLARELAQ-LPRMVLLCGRYEGVDERFLDQA-----VDMEISIGDYVLSGGELGAAVL
TRMD_XYLFA      NQSRARKLAM-LPRMILLCGRYEGIDERFITHE-----VNMELSIGDYVLSGGELGAAVV
TRMD_RALSO      THRRVMELAQ-LPALTLLCGRYEAIDQRLVDRR-----VDEEISLGDFVLSGGEIAAMAI
                                .  . ::. * *               .:*. ::  *       

TRMD_BACHD      ADSVTRLLPAVLGNETSAQTDSF-----STGLLEYPQYTRPADFRGWK----VPDVLLSG
TRMD_BACSU      ADSVVRLLPGVLGKEASHIEDSF-----STGLLEHPHYTRPADYKGLK----VPETLLSG
TRMD_LISIN      MDSVIRLLPGVLGNKDSAVTDSF-----STGLLEHPHYTRPADFRGMK----VPDILLSG
TRMD_LISMO      MDSVIRLLPGVLGNKDSAVTDSF-----STGLLEHPHYTRPADFRGMK----VPDILLSG
TRMD_STAAM      TDAIVRLIPGVLGNEQSHQDDSF-----SDGLLEFPQYTRPREFKGLT----VPDVLLSG
TRMD_STAAW      TDAIVRLIPGVLGNEQSHQDDSF-----SDGLLEFPQYTRPREFKGLT----VPDVLLSG
TRMD_STRP3      VDATVRLIPQVLGKESSHQDDSF-----SSGLLEYPQYTRPYDYRGMT----VPDVLMSG
TRMD_STRP8      VDATVRLIPQVLGKESSHQDDSF-----SSGLLEYPQYTRPYDYRGMT----VPDVLMSG
TRMD_STRP1      VDATVRLIPQVLGKESSHQDDSF-----SSGLLEYPQYTRPYDYRGMT----VPDVLMSG
TRMD_STRPN      IDATVRLIPEVIGKESSHQDDSF-----SSGLLEYPQYTRPYDYRGMV----VPDVLMSG
TRMD_LACLA      VDAVVRLIPGVLGKVASHEDDSF-----SSGLLEYPQYTRPEDFRGMK----VPEVLMSG
TRMD_LACAC      VDATVRLLPGILGNSASSVEESF-----SHGLLEYPQYTRPADFEGKKS---ARSFKPVV
TRMD_CLOAB      VDSICRMIPGVLSKSESYIEESF-----YSGLLEYPQYTRPEEFEGAR----VPDVLISG
TRMD_CLOPE      IDSISRLVPGVLGSEESFQDESY-----YDGTLEYPQYTRPFEFEGEK----VPEVLMSG
TRMD_CALS4      IDAVTRLIDGVLSHPQSALEESF-----SDYLLEYPQYTRPEVFRGMR----VPEVLLSG
TRMD_NOSS1      INGVVRLLPGTVAKTESLTAESF-----EEGLLDYPQYTRPANFRGWK----VPDVLLSG
TRMD_SYNY3      INGVIRLLPGTVGKEASLIAESF-----STDLLDYPHYTRPPVFRGLA----VPPVLLSG
TRMD_DEIRA      LEAVARLRPGVLGDEASHQQDSF-----SSGLLDYPEYTRPPEWEGHS----VPDVLRGG
TRMD_CAMHC      TDAIARNIKGVLGNEKSLDEESF-----ENLLLEAPEFTKPDIFEN----LSINSEFLKG
TRMD_CAMJE      CDAILRNVNGVLGNMESLEEESF-----ENNLLEAPAFSKPFIFEKKNKKFYTPSEFLKG
TRMD_HELPY      IDSIARHIQGVLGNAQSLENESF-----ENHYLEAPNFANAVFKSKEINKIPAPLEYSKG
TRMD_HELPJ      IDSIARHIQGVLGNAQSLENESF-----ENNYLETPNFANAVFKSKEINKIPAPLEYSKG
TRMD_HELHP      CDSIARHIQGVLGNADSLQGESF-----EDYLLEAPNFTK-IFNQK-IKFSATPSEYSKG
TRMD_LEPBL      ADAVSRLLPGFLGAGESLLDESHN----YPDVLEYPQFTKPSEYNG----WKVPEVLLSG
TRMD_LEPIN      ADAVSRLLPGFLGADESLLDESHN----HPDILEYPQFTKPSEYNG----WKVPDVLLSG
TRMD_BORBU      IDSVYRLLDGVIN-PNSLLEESFGV---KNGLLEYPHYTRPYDFKG----IKVPEVLLSG
TRMD_TREPA      IDAVSRCVSGVIR-HESLEEESF-----VNSLVEYPQYTRPRCFHN----RDVPPVLLSG
TRMD_MYCGE      IDATVRLIKGVIN-DQSLICESF-----NDNLLDFPVYTRPYDLKG----DKVPEVLLSG
TRMD_MYCPN      IDATVRLIKGVIN-DQSLIHESF-----NNYLLDFPAYTRPYDLDG----DKVPEILLSG
TRMD_MYCGA      VDSIVRLLPNVIN-KDSLSSESF-----NNYLLDYPMYTKPYDFEG----YKVPDVLLSG
TRMD_UREPA      SDAVIRLLDGVIS-PSSLETESF-----NNYLLDYPVYTRPLVFEG----HKVPDILLSG
TRMD_AQUAE      IDAVSRVLPGVLSEPQSIQEDSF-----QNRWLGYPVYTRPREYRG----MKVPEELLSG
TRMD_THEMA      TDAVVRLVPGVV-ERESVERESF-----HQGLLDHPVYTRPYEYKG----MKVPDVLLSG
TRMD_BUCAI      IDAISRLIPGVIKTKKSIEEDSF-----TNDLLDYPNYTRPKIIKN----MSVPQVLLSG
TRMD_BUCAP      IDSISRFIPGVIKKKQSVQEDSF-----FNGLLDYPHYTRPKIIEK----MKVPEILLSG
TRMD_MYCPU      ADSIIRLWEDVIK-KESYENESF-----ENNLLDYPQYTRPRVFEG----FEVPEILLNG
TRMD_FUSNN      SDTIIRLLPDVIK-KESYENDSF-----YNGLLDYPHYTRPAEYKD----LKVPEVLLSG
TRMD_AGRFC      LDAVVRILPGVMGNDLSGVHESFEG-----GLLEHPHYTRPQLWEGRD----IPAILTSG
TRMD_RHIME      LDAVVRILPGVMGNQLSGVHESFEG-----GLLEHPHYTRPQIFEGHE----IPAVLTSG
TRMD_RHILO      LDAVVRLLPGVMGNAVSGEEESFEN-----GLLEHPHYTRPQEFEGRE----IPQVLTSG
TRMD_BRUME      LDAVVRLLPGVMGNRESGETESFET-----GLLEHPHYTRPQEWEGRA----IPDILTSG
TRMD_CAUVC      IEACVRLAPGVLGNIESTLEESFED-----GLLEHPQYTRPRTFEELD----IPEVLLSG
TRMD_RICCN      LDCLIRLLPGVLMNQNTLSSESFEEDGEFKGGLECSLYTRPEIWRGRA----VPSVLLSG
TRMD_RICPR      LDCLIRLLPGVLINQNTLSSESFEKDGEFQGGLECDLYTRPKIWRGRA----VPSILLSG
TRMD_MYCLE      IEAVLRLVAGVLGNPASHRDDSHSPD--LGRLLEGPSYTRPPTWRGLD----VPPVLLSG
TRMD_MYCTU      VEAVLRLLAGVLGNPASHQDDSHSTG--LDGLLEGPSYTRPASWRGLD----VPEVLLSG
TRMD_STRCO      TEAVARLLPGVLGNAESHRDDSFAPGA-MANLLEGPVHTKPPQWRGRG----IPDVLLSG
TRMD_BIFLO      LEAITRLMPGFMGNPDSIVEESYTGE---GALLEHRQYTKPAVWRGIA----VPDVLLSG
TRMD_CHLMU      VDALARFIPGVLGNQESAECDSLE-----NGLLEGPHYTRPRVFEGVQ----VPEILFCG
TRMD_CHLTR      VDALARFIPGVLGNQESAEYDSLE-----NGLLEGPQYTRPRVFEGES----VPEVLLCG
TRMD_CHLPN      IDAVSRFIPGVLGNQESAERDSLE-----NGLLEGPQYTRPREFEGKE----VPEVLLQG
TRMD_CHLTE      MDAVLRLIPGVLGDGESALTDSFQ-----NELLDCAWYTRPAEFRGMK----VPDVLLSG
TRMD_SALTI      IDSVARFIPGVLGHEASAIEDSFA-----DGLLDCPHYTRPEVLEGME----VPPVLLSG
TRMD_SALTY      IDSVARFIPGVLGHEASAIEDSFA-----DGLLDCPHYTRPEVLEGME----VPPVLLSG
TRMD_ECOLI      IDSVSRFIPGVLGHEASATEDSFA-----EGLLDCPHYTRPEVLEGME----VPPVLLSG
TRMD_YERPE      IDSVSRFIPGVLGHHASAEEDSFV-----DGLLDCPHYTRPEVLEGME----VPPVLLSG
TRMD_HAEIN      IDAVARFIPGVLGKQASAEEDSFA-----DGLLDCPHYTRPEVLEGLT----VPPVLMSG
TRMD_PASMU      IDAVARFIPGVLGKQASADEDSFA-----EGLLDCPHYTRPEVLDGLA----VPPVLMSG
TRMD_VIBCH      IDSVSRFIPGVLGDFASAEEDSFA-----NGLLDCPHYTRPEVLDGKE----VPAVLKSG
TRMD_PSEAE      VDAVTRLLPGALGHADSAEEDSFT-----DGLLDCPHYTRPEVYADKR----VPEVLLSG
TRMD_NEIMA      MDAVLRLVPGVLGDMQSAEQDSFS-----SGILDCPHYTKPLEFQGMA----VPEVLRSG
TRMD_NEIMB      MDAVLRLVPGVLGDMQSAEQDSFS-----SGILDCPHYTKPLEFQGMA----VPEVLRSG
TRMD_XANAC      VDVVARLQDGVLNDAESAAQDSFEGP---QGLLDCPHYSHPATHAWGD----VPDVLRSG
TRMD_XANCP      VDVVTRLQDGVLNDAESAAQDSFEGP---QGLLDCPHYSHPSSHAWGD----VPEVLRSG
TRMD_XYLFA      VDAVIRLQEGVLNDAESAKQDSFEAV---DSLLDYPHYTHPSNHAFGN----VPEVLRSG
TRMD_RALSO      IDAVVRQLPGVLGDAQSAVQDSFV-----NGLLDCPHYTRPEEYEGVR----VPDVLLGG
                 :   *     :    :   :*          :    .:.                    

TRMD_BACHD      HHQNIERWRKEQSLKRTLERRPDLL---------------------------------EG
TRMD_BACSU      NHAKIEEWRNKESIRRTYLRRPDLL---------------------------------KD
TRMD_LISIN      NHAWIEEWRDKESLKRTYERRPDLL---------------------------------KN
TRMD_LISMO      NHAWIEEWRDKESLKRTYERRPDLL---------------------------------KN
TRMD_STAAM      NHANIDAWRHEQKLIRTYNKRPDLI---------------------------------EK
TRMD_STAAW      NHANIDAWRHEQKLIRTYNKRPDLI---------------------------------EK
TRMD_STRP3      HHERIRLWRLEESLRKTYLRRPDLL---------------------------------ER
TRMD_STRP8      HHERIRLWRLEESLRKTYLRRPDLL---------------------------------ER
TRMD_STRP1      HHERIRLWRLEESLKKTYLRRPDLL---------------------------------EH
TRMD_STRPN      HHEKIRQWRLYESLKKTYERRPDLL---------------------------------EH
TRMD_LACLA      HHENIRKWRLKESLRKTLERRPDLL---------------------------------DK
TRMD_LACAC      IIKRLLNGDTIRLLKATYLHRPDML---------------------------------EN
TRMD_CLOAB      HHENIRKWRRKQALKITKDRRKDLF---------------------------------DK
TRMD_CLOPE      HHENIRKWRRKQSLLITKERRPDMF---------------------------------EK
TRMD_CALS4      NHAEIARWRRQKSLEITLLKRPDLL---------------------------------KK
TRMD_NOSS1      NHAAIAQWRYEQQIKRTSDRRPDLL---------------------------------EK
TRMD_SYNY3      NHQAIAQWRLEQQEERTQQRRPDLW---------------------------------QK
TRMD_DEIRA      NHAAVARWRRDQALERTLRRRPDLLPGAGLTPQDSAALLALG----------VTPEQLSI
TRMD_CAMHC      NHNKIQVLKNQMANSKTRFFRPDMF---------------------------------RK
TRMD_CAMJE      NHARIASLKTTLASCKTKFFRPDLF---------------------------------LE
TRMD_HELPY      NHAKIKQLKLDLSKLRTKFYRLDLF---------------------------------KQ
TRMD_HELPJ      NHAKIKQLKLDLSKLRTKFYRLDLF---------------------------------KQ
TRMD_HELHP      NHSKISGLKKRLAICKTKYFRPDLY---------------------------------QA
TRMD_LEPBL      NHASILAWREQNRKKIDP-DQERKL-----------------------------------
TRMD_LEPIN      NHASILAWREQNRKKIERGNYESTF---------------------------------KR
TRMD_BORBU      HHANIKNWRLVKAREKTKKNRYDL------------------------------------
TRMD_TREPA      HHAHIRTWRLARQIEKTRRNRPDLL---------------------------------SA
TRMD_MYCGE      DHQKIESFRKEQQILKTAKYRPDL------------------------------------
TRMD_MYCPN      DHKKIEAYRKEQQLLRTAQYRPDL------------------------------------
TRMD_MYCGA      NHQAIAAFNQQEAINNTKMKRPDL------------------------------------
TRMD_UREPA      HHKNIADFRKQQQETITKKNRPDL------------------------------------
TRMD_AQUAE      HHKLIELWKLWHRIENTVKKRPD-L---------------------------------IP
TRMD_THEMA      DHEKVELWRRKESIKKTLAKRPDLF---------------------------------LA
TRMD_BUCAI      NHNEIRLWRLKQSLGTTWIKRPDLI---------------------------------KK
TRMD_BUCAP      NHDKIRLWRLKKSLEKTWTKRPDLL---------------------------------KN
TRMD_MYCPU      NHKEIEKWRKQKQIEKTKINRPDLY---------------------------------ER
TRMD_FUSNN      NHKKIDEWRLKESLRRTYLRRRELI---------------------------------EN
TRMD_AGRFC      NHAAIDKWRHEQALALTKERRPDLLEKTQAET----------------------------
TRMD_RHIME      NHAAVAQWREATARRLTAERRPDLLERARHPK----------------------------
TRMD_RHILO      NHKKIAAWRREQAEQLTRERRPDLLGAHPLAK----------------------------
TRMD_BRUME      NHGAIDKWRLEQAERITRERRPDLWEAYCKNR----------------------------
TRMD_CAUVC      DHKKIDQWRKRMREETTRERRPDLWEAHLANQ----------------------------
TRMD_RICCN      NHRLINEWKKEQSHMITKLRRPELLKDL--------------------------------
TRMD_RICPR      NHRLINNWRKEQSHMITKLRRPELLKDL--------------------------------
TRMD_MYCLE      DHARIAAWRREASLRRTRKRRPDLSGARFVWG----------------------------
TRMD_MYCTU      DHARIAAWRREVSLQRTRERRPDLSHPD--------------------------------
TRMD_STRCO      HHGKIARWRRDEALRRTTANRPDLIERCDPAA----------------------------
TRMD_BIFLO      DHGKVDRFRRDEALARTAEIRPDLIAALDCKA----------------------------
TRMD_CHLMU      DHQRIANWRKKVSLERTRERRPDLYLQYFYGDRAFWGAQEDP-LKMRETSPQAFSVVLEV
TRMD_CHLTR      DHQKIADWRKQVSLERTRERRPDLYLQYFYGNSACLSTQEDL-PRIEVVSPKTFSVVLEV
TRMD_CHLPN      DHKAISQWRLEQSERRTYERRPDLYLNYLYKRSIDHKFDEETTTNRDHFKCDKISVVLEV
TRMD_CHLTE      HHEKIELWRQENARERTLERRP--------------------------------------
TRMD_SALTI      NHAEIRRWRLKQSLGRTWLRRPELLENLA-------------------------------
TRMD_SALTY      NHAEIRRWRLKQSLGRTWLRRPELLENLA-------------------------------
TRMD_ECOLI      NHAEIRRWRLKQSLGRTWLRRPELLENLA-------------------------------
TRMD_YERPE      NHAEIRRWRLKQSLGRTWLRRPELLESLA-------------------------------
TRMD_HAEIN      HHEEIRKWRLKQSLQRTWLRRPELLEGLA-------------------------------
TRMD_PASMU      NHEEIRKWRLRQSLERTWLRRPELLESLA-------------------------------
TRMD_VIBCH      NHEDIRRWRLKQSLGRTWLRRPELLENLA-------------------------------
TRMD_PSEAE      NHEHIRRWRLQQALGRTWERRADLLDSRS-------------------------------
TRMD_NEIMA      NHGLIAEWRLEQSLRRTLERRPDLLEKRV-------------------------------
TRMD_NEIMB      NHGLIAEWRLEQSLRRTLERRPDLLEKRV-------------------------------
TRMD_XANAC      NHAAIARWRRKQSLGRTWLRRPDLLDEAG-------------------------------
TRMD_XANCP      NHGAIARWRRQQSLGRTWLRRPELLDEAT-------------------------------
TRMD_XYLFA      NHVAITRWRRQQSLLRTWLRRPDLIDEAR-------------------------------
TRMD_RALSO      HHAEIEKWRRQQALLNTMRKRPDLIEAARRQGL---------------------------
                    :                                                       

TRMD_BACHD      RKLTEEEQELLDSIRKQQEK----------------------------------------
TRMD_BACSU      HPLTEQQRKWISEWEKE-------------------------------------------
TRMD_LISIN      YPLTDKQKTWLKEWSDSK------------------------------------------
TRMD_LISMO      YPLTDKQKTWLKEWSDSK------------------------------------------
TRMD_STAAM      YPLTNEDKQILERYKIGLKKG---------------------------------------
TRMD_STAAW      YPLTNADKQILERYKIGLKKG---------------------------------------
TRMD_STRP3      YDFSEEERKLLDKIKEALGQGED-------------------------------------
TRMD_STRP8      YDFSEEERKLLDKIKEALG-----------------------------------------
TRMD_STRP1      YNFSEEERKLLDKIKEALDQGED-------------------------------------
TRMD_STRPN      YQLTVEEEKMLAEIKENKE-----------------------------------------
TRMD_LACLA      YEPNEEELKMLQLLRENVQDVVE-------------------------------------
TRMD_LACAC      RNLSDEEKKMLQEIKNEMNED---------------------------------------
TRMD_CLOAB      LVMTKEDKKLLNDNEL--------------------------------------------
TRMD_CLOPE      IKLSKEDIKLLKSK----------------------------------------------
TRMD_CALS4      ANLTEEDKKFLREKGYEI------------------------------------------
TRMD_NOSS1      WQQEKKQGSREQGAREAGGVGGEITTDD--------------------------------
TRMD_SYNY3      WQD--RQPSP--------------------------------------------------
TRMD_DEIRA      WDAPPPPAPKVRRKKKPSAEDKAPTDTSSE------------------------------
TRMD_CAMHC      VIAKKGKK----------------------------------------------------
TRMD_CAMJE      HERKK-------------------------------------------------------
TRMD_HELPY      HKS---------------------------------------------------------
TRMD_HELPJ      HKS---------------------------------------------------------
TRMD_HELHP      YRVFIEQQQLNNKVVK--------------------------------------------
TRMD_LEPBL      ------------------------------------------------------------
TRMD_LEPIN      SADSGC------------------------------------------------------
TRMD_BORBU      ------YLKYLEIIGEDNGFDKKN------------------------------------
TRMD_TREPA      ARASAAWTQEAESLLKELDYELPPHPTN--------------------------------
TRMD_MYCGE      ------YKKYLENKNEKNK-----------------------------------------
TRMD_MYCPN      ------YKQYLAKKDEKNK-----------------------------------------
TRMD_MYCGA      ------YLKYKSNLK---------------------------------------------
TRMD_UREPA      ------YQKYLNNKK---------------------------------------------
TRMD_AQUAE      KDLTELEKDILNSILSGKSFKEWLKEHKHLL-----------------------------
TRMD_THEMA      KELDEMDKLAIIEL-----FRELMEKC---------------------------------
TRMD_BUCAI      KY----------------------------------------------------------
TRMD_BUCAP      KILKKEEKILLNELKKINKR----------------------------------------
TRMD_MYCPU      -------------FKNEK------------------------------------------
TRMD_FUSNN      RELTKLEKKLLDEIKKEEV-----------------------------------------
TRMD_AGRFC      --K---------------------------------------------------------
TRMD_RHIME      --RDPPQPVKK-------------------------------------------------
TRMD_RHILO      ------------------------------------------------------------
TRMD_BRUME      --RKIGGQ----------------------------------------------------
TRMD_CAUVC      --QAKGDPKPGKPKET--------------------------------------------
TRMD_RICCN      ------------------------------------------------------------
TRMD_RICPR      ------------------------------------------------------------
TRMD_MYCLE      --LGLS------------------------------------------------------
TRMD_MYCTU      ------------------------------------------------------------
TRMD_STRCO      --FDKKDREMLSILGWQPDPDGEPYGRFWRRTPGMEE-----------------------
TRMD_BIFLO      --LDKADRKTLMALGWEVSAAHPRRLAD--------------------------------
TRMD_CHLMU      KDLRKAKKFYSRMFGKEHWDGDK---LLLGEKTSLYLQQTNERRG---ATKVFVELETED
TRMD_CHLTR      QDLRKAKKFYSRMFGKECWDGDK---LFLLGKTSLYLQQTKETRG---PTTVFIELETDH
TRMD_CHLPN      NKLKRAKNFYCKVFGLDAMSCENKFCLPHEGKTIFWLREVQAEKKNIVTLSLSLDCACEE
TRMD_CHLTE      -----------EMLGKESEKE---------------------------------------
TRMD_SALTI      --LTEEQARLLAEFKTEHAQQQHKHDGMA-------------------------------
TRMD_SALTY      --LTEEQARLLAEFKTEHAQQQHKHDGMA-------------------------------
TRMD_ECOLI      --LTEEQARLLAEFKTEHAQQQHKHDGMA-------------------------------
TRMD_YERPE      --LTDEQMVLLAEFQREHKP----------------------------------------
TRMD_HAEIN      --LTDEQRKLLKEAQAEHNS----------------------------------------
TRMD_PASMU      --LTDEQRKLLKQIKAEHS-----------------------------------------
TRMD_VIBCH      --LTDEQEQLLTEYIKETRHQ---------------------------------------
TRMD_PSEAE      --LSGEEQKLLAEYIRQRDDS---------------------------------------
TRMD_NEIMA      --LIPKESRLLETIRQEQREIQS-------------------------------------
TRMD_NEIMB      --LIPKESRLLETIRQEQREIQS-------------------------------------
TRMD_XANAC      --LEKNDRRLLDEFRRELAPGDEK------------------------------------
TRMD_XANCP      --LDKQDRRLLEEFRRELAPGDEK------------------------------------
TRMD_XYLFA      --LSKADRLLLDEIKRTHPMDTDQKASVSWRGV---------------------------
TRMD_RALSO      --LSRSDEVFLAAAATTAKGSGASLSEAPAK-----------------------------
                                                                            

TRMD_BACHD      ----------------------------------------------
TRMD_BACSU      ----------------------------------------------
TRMD_LISIN      ----------------------------------------------
TRMD_LISMO      ----------------------------------------------
TRMD_STAAM      ----------------------------------------------
TRMD_STAAW      ----------------------------------------------
TRMD_STRP3      ----------------------------------------------
TRMD_STRP8      ----------------------------------------------
TRMD_STRP1      ----------------------------------------------
TRMD_STRPN      ----------------------------------------------
TRMD_LACLA      ----------------------------------------------
TRMD_LACAC      ----------------------------------------------
TRMD_CLOAB      ----------------------------------------------
TRMD_CLOPE      ----------------------------------------------
TRMD_CALS4      ----------------------------------------------
TRMD_NOSS1      ----------------------------------------------
TRMD_SYNY3      ----------------------------------------------
TRMD_DEIRA      ----------------------------------------------
TRMD_CAMHC      ----------------------------------------------
TRMD_CAMJE      ----------------------------------------------
TRMD_HELPY      ----------------------------------------------
TRMD_HELPJ      ----------------------------------------------
TRMD_HELHP      ----------------------------------------------
TRMD_LEPBL      ----------------------------------------------
TRMD_LEPIN      ----------------------------------------------
TRMD_BORBU      ----------------------------------------------
TRMD_TREPA      ----------------------------------------------
TRMD_MYCGE      ----------------------------------------------
TRMD_MYCPN      ----------------------------------------------
TRMD_MYCGA      ----------------------------------------------
TRMD_UREPA      ----------------------------------------------
TRMD_AQUAE      ----------------------------------------------
TRMD_THEMA      ----------------------------------------------
TRMD_BUCAI      ----------------------------------------------
TRMD_BUCAP      ----------------------------------------------
TRMD_MYCPU      ----------------------------------------------
TRMD_FUSNN      ----------------------------------------------
TRMD_AGRFC      ----------------------------------------------
TRMD_RHIME      ----------------------------------------------
TRMD_RHILO      ----------------------------------------------
TRMD_BRUME      ----------------------------------------------
TRMD_CAUVC      ----------------------------------------------
TRMD_RICCN      ----------------------------------------------
TRMD_RICPR      ----------------------------------------------
TRMD_MYCLE      ----------------------------------------------
TRMD_MYCTU      ----------------------------------------------
TRMD_STRCO      ----------------------------------------------
TRMD_BIFLO      ----------------------------------------------
TRMD_CHLMU      GFVRFLRRWEMLGGQLGEVGMGNLPLRQVF-DLDGHIWVVSCVQK-
TRMD_CHLTR      DFVRFLKRWEILGGELGEQGTGGFPLRQVF-DLDGHIWVVSCVQK-
TRMD_CHLPN      DFCYLLRRWELFGGKLLEKQADEHAVWALAQDLDGHAWIFSWHRMK
TRMD_CHLTE      ----------------------------------------------
TRMD_SALTI      ----------------------------------------------
TRMD_SALTY      ----------------------------------------------
TRMD_ECOLI      ----------------------------------------------
TRMD_YERPE      ----------------------------------------------
TRMD_HAEIN      ----------------------------------------------
TRMD_PASMU      ----------------------------------------------
TRMD_VIBCH      ----------------------------------------------
TRMD_PSEAE      ----------------------------------------------
TRMD_NEIMA      ----------------------------------------------
TRMD_NEIMB      ----------------------------------------------
TRMD_XANAC      ----------------------------------------------
TRMD_XANCP      ----------------------------------------------
TRMD_XYLFA      ----------------------------------------------
TRMD_RALSO      ----------------------------------------------