CLUSTAL format seed alignment for MF_00606

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UVSE_BACCR      -----------------------MLIRFGYVSHAMALWDCSPAKTMTFTSFKKLSKQERE
UVSE_BACSU      -----------------------MIFRFGFVSNAMSLWDASPAKTLTFARYSKLSKTERK
UVSE_BACHD      -----------------------MRIQFGYVAMSMELANASPSKTMTATQFEKIEDHEAG
UVSE_NOSS1      MVTIDNSMTATQLNDLPQTAQLRKNAQPELGLVCITFDKKVRFRTMTRTRYLKLSLAQRE
UVSE_DEIRA      -------------------MTSACEAVPQLGLVCLTVGPEVRFRTVTLSRYRALSPAERE
UVSE_CLOPE      ----------------------------------MKIGYACTPITTNARTNRRILLKDFS
                                                  : .       * .      :   :  

UVSE_BACCR      -DKLYHVIRQNLEHTIRILHYNIAHEIPLYRLSSSIVPLATHP-EVE-FDYIGVFTPLWR
UVSE_BACSU      -EALLTVTKANLRNTMRTLHYIIGHGIPLYRFSSSIVPLATHP-DVM-WDFVTPFQKEFR
UVSE_BACHD      LRKLERIAKTNLHNCLRLLKHNLAYQISFFRLSSKLVPLVNHP-LTEGWKYELAIAEELQ
UVSE_NOSS1      -SSLREIYLHNLQCLHDALTFCQENNLRLYRISSALFPLSDME-DQIGSNILEEISTDLG
UVSE_DEIRA      -AKLLDLYSSNIKTLRGAADYCAAHDIRLYRLSSSLFPMLDLAGDDTGAAVLTHLAPQLL
UVSE_CLOPE      KDKFLSITKQNLDDLQKILEWNIKNNIYLFRIGSDIIPLGSHE--INNISWQKEFKDKLE
                   :  :   *:              : ::*:.* :.*:               :     

UVSE_BACCR      KIGALIKEHNLRISFHPNQFTLFTSDKPHITTNAITDMTYHYKILDAIGIADSSYINIHV
UVSE_BACSU      EIGELVKTHQLRTSFHPNQFTLFTSPKESVTKNAVTDMAYHYRMLEAMGIADRSVINIHI
UVSE_BACHD      AVGEFASEHQMRIDFHPDHFVVLNSEAKEITRRSLQTLLYHYKLLKGMEIDPRHRCVLHV
UVSE_NOSS1      KIGERSQALNIRMVLHPDQYVVLSSDSPEIVQTSIKILERHARTFDLLGLPRSPWSLMNI
UVSE_DEIRA      EAGHAFTDAGVRLLMHPEQFIVLNSDRPEVRESSVRAMSAHARVMDGLGLARTPWNLLLL
UVSE_CLOPE      TIGTFIKNNKIRVSMHPGQYTVINTPKEDVLYKSIKDIEYHCEFLDSLKVDYKNKIILHI
                  *       :*  :** :: ::.:    :   ::  :  * . :. : :       : :

UVSE_BACCR      GGAYGNKEKAIERFHENIKKLPTHIKKQMTLENDDKTYTTAETLSICQKENIPFVFDYHH
UVSE_BACSU      GGAYGNKDTATAQFHQNIKQLPQEIKERMTLENDDKTYTTEETLQVCEQEDVPFVFDFHH
UVSE_BACHD      GGKKKGVEAGLEQFIENTASIPKSLLSMIMLENDDKSYTIDDVLYLGEKLAIPVVLDIHH
UVSE_NOSS1      HGGKSQR-S--EQLIKVISNLPENIKSRLTLENDEYAYSTEEIFNVCQKAQIPMVFDAHH
UVSE_DEIRA      HGGKGGR-G--AELAALIPDLPDPVRLRLGLENDERAYSPAELLPICEATGTPLVFDAHH
UVSE_CLOPE      GGVYGDKKLAKENFLKGFKKLSDSSKKRLVIENDERNFSLDDVLDISSKLNIPVIFDNLH
                 *          .:     .:.      : :***:  ::  : : : .    *.::*  *

UVSE_BACCR      HMANLC-EEPLEELLPAIFETWS-HTNISPKVHISSPRSEKEFRAHAEYIDLEFIKPFLH
UVSE_BACSU      FYANPDDHADLNVALPRMIKTWE-RIGLQPKVHLSSPKSEQAIRSHADYVDANFLLPLLE
UVSE_BACHD      HDVLHR-SKSLQETWQRIVATWE-DSPLPVKIHLSSPLSGEDDPRHHDYINADRFIAFLH
UVSE_NOSS1      QICHENLDSYDHPSVAAMFYAAR-ETWTNPEWQLVHISNGEQ--AFNDRKHSNLITNMPN
UVSE_DEIRA      HVVHDKLPDQEDPSVREWVLRAR-ATWQPPEWQVVHLSNGIE--GPQDRRHSHLIADFPS
UVSE_CLOPE      NICYGDNSYSLKEIYSLVIKTWNKELDGNMKVHYSEQDIFKKKGSHSPSISINSFLEYYE
                           .      .           : :                   . :     

UVSE_BACCR      IAKKHN-HNFDIMIESKQKDLALFQLIDELSAIRGIKRISGAMLQW--------------
UVSE_BACSU      RFRQWG-TNIDFMIEAKQKDKALLRLMDELSSIRGVKRIGGGALQWKS------------
UVSE_BACHD      EIGADAVDHLHVMIEAKKKDLALFQLMKDLAEYDEITVVSKSAVEFNP------------
UVSE_NOSS1      IYRQAP--WIEVEAKHKEVAIAHLRSWWLMGQ----------------------------
UVSE_DEIRA      AYADVP--WIEVEAKGKEEAIAALRLMAPFKKD---------------------------
UVSE_CLOPE      EIKEFS---PDIMLEVKDKDISAIKCINSLKEINKTLNSKAYREEIENYKLLLLQHDKDF
                          ..  : *.   : ::    :                              

UVSE_BACCR      ------------------------------------------------------------
UVSE_BACSU      ------------------------------------------------------------
UVSE_BACHD      ------------------------------------------------------------
UVSE_NOSS1      ------------------------------------------------------------
UVSE_DEIRA      ------------------------------------------------------------
UVSE_CLOPE      QKKLNSFSKDLIEFYNYLDKLLLSPKDIIGFKYSLELAFNILKDRISNRESLYFKKLINE
                                                                            

UVSE_BACCR      -------------------------------
UVSE_BACSU      -------------------------------
UVSE_BACHD      -------------------------------
UVSE_NOSS1      -------------------------------
UVSE_DEIRA      -------------------------------
UVSE_CLOPE      KEYEKAKVYLTKLVKKIEFPPKELSYYISQS