CLUSTAL format seed alignment for MF_00607

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RSMA_RHIEC      ---------------------------MAALDGLPPLRDVIQRHGLDARKALGQNFLLDL
RSMA_RHIE6      ---------------------------MAALDGLPPLRDVIQRHGLDARKALGQNFLLDL
RSMA_RHILW      ---------------------------MAALDGLPPLRDVIQRHGLDARKALGQNFLLDL
RSMA_RHIL3      ---------------------------MAALDGLPPLRDVIQRHGLDARKALGQNFLLDL
RSMA_AGRVS      ---------------------------MAALDGLPPLRDVIQRHGLDAKKALGQNFLLDL
RSMA_RHIME      ---------------------------MAALDGLPPLRDVIQRHGLDAKKALGQNFLLDL
RSMA_SINMW      ---------------------------MAALDGLPPLRDVIQRHGLDAKKALGQNFLLDL
RSMA_SINFN      ---------------------------MAALDGLPPLRDVIQRHGLDAKKALGQNFLLDL
RSMA_AGRFC      ---------------------------MAAIDGLPPLRDVIQRHGLDAKKSLGQNFLFDL
RSMA_CHESB      ----------------------------MSMDGLPPLRDVIERHGLFARKALGQNFLLDL
RSMA_RHILO      ----------------------------MSIDGLPPLRDVIERHGLQAKKALGQNFLLDL
RSMA_BARHE      ----------------------------MPIDSLPPLREVINTYGLQAHKSLGQNFLFDL
RSMA_BARQU      ----------------------------MPIDNLPPLREVIDIYGLQAHKSLGQNFLFDL
RSMA_BART1      ----------------------------MPIDNLPPLREVIDTYGLQAHKSLGQNFLFDL
RSMA_BARBK      ----------------------------MPIDNLPPLREVINAYGLQANKSLGQNFLFDL
RSMA_BRUA2      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUA1      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUC2      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUMB      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUO2      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUSU      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUME      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUSI      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_BRUAB      ----------------------------MSIDSLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_OCHA4      ----------------------------MSIDGLPPLREVIERHDLMPKKSLGQNFLFDL
RSMA_AZOC5      ---------------------------MSAIDDLPPLREVIRAHGLSAQKSLGQNFLLDL
RSMA_XANP2      ---------------------------MSALDDLPPLRDVIRRHGLSAQKSLGQNFLLDL
RSMA_METRJ      ---------------------------MSAGDGLPPLREVVARHGLEPKKALGQNFLYDL
RSMA_BRASB      ---------------------------MSAIDDLPPLREVIREHQLSARKALGQNFLLDL
RSMA_BRASO      ---------------------------MSAIDDLPPLREVIREHQLSARKALGQNFLLDL
RSMA_BRADU      ---------------------------MSAIDDLPPLREVIRQHALSARKSLGQNFLLDL
RSMA_NITHX      ---------------------------MSTIDDLPPLRDVIKRHALSARKSLGQNFLLDL
RSMA_NITWN      ---------------------------MSMIDDLPPLRDVIKRHALSARKSLGQNFLLDL
RSMA_RHOPA      ---------------------------MSAIDDLPPLREVIRRHDLAARKSLGQNFLLDL
RSMA_RHOPT      ---------------------------MSAIDDLPPLREVIRRHDLAARKSLGQNFLLDL
RSMA_RHOPS      ---------------------------MSAIDGLPPLRDVIRRHDLAARKSLGQNFLLDL
RSMA_RHOP2      ---------------------------MSAIDGLPPLRDVIKRHDLAARKSLGQNFLLDL
RSMA_RHOP5      ---------------------------MSTIDDLPPLREVIQRHDLSARKSLGQNFLLDL
RSMA_RHOPB      ---------------------------MSGIDDLPPLRDVIKRHDLSARKSLGQNFLLDL
RSMA_OLICO      ---------------------------MSQIDDLPPLREVIRKYDLFARKSLGQNFLFDL
RSMA_RUEPO      ---------------------------MSAIDTLPPLREVIASHQLSARKSLGQNFLLDL
RSMA_RUEST      ---------------------------MSAIDNLPPLREVIATHQLSARKSLGQNFLLDL
RSMA_ROSDO      ---------------------------MSTIDHLPPLRSVIRDHDLSARKSMGQNFLLDL
RSMA_PARDP      ---------------------------MSAIDGLPPLREVIARHDLRAKKQLGQNFLLDL
RSMA_DINSH      ---------------------------MAQIDGLPPLREVIAAHKLSAKKSLGQNFLLDL
RSMA_RHOS4      ---------------------------MASIDGLPPLREVIRAHGLSAKKQLGQNFLLDL
RSMA_RHOS1      ---------------------------MASIDGLPPLREVIRAHGLSAKRQLGQNFLLDL
RSMA_RHOSK      ---------------------------MASIDGLPPLREVIRAHGLSAKKQLGQNFLLDL
RSMA_RHOS5      ---------------------------MAAIDGLPPLREVIRAHGLSAKKQLGQNFLLDL
RSMA_JANSC      ---------------------------MVAIDGLPPLRDVIAAHGLSARKALGQNFLLDL
RSMA_ERYLH      ------------------------------MPELPPLRDVIAKHGLSASKALGQNFLFDA
RSMA_NOVAD      ------------------------------MTDLPPLRDVVNRHGLYATKALGQNFLFDE
RSMA_SPHAL      ---------------------------------MPPLRETVRVHGLSASKALGQNFLFDE
RSMA_ZYMMO      ----------------------------MLDQTLEPLRAVIARHGLSADKRLGQNFLLDS
RSMA_MAGSA      ------------------MAD------------LPPLREVIARHGLDARKSLGQHFLFDL
RSMA_RHORT      ------------------MSDPIDVAAETPGDGLPPLREVIATHGLDARRSLGQNFLFDL
RSMA_GLUOX      MSSRPPASFSATFSAARSSKCVPPPRRPSTDVSLPSLRDTIQAHGLDAKKSLGQHFLLDP
RSMA_CAUVC      ----------------------------------------------MARKSFGQHFLLDL
RSMA_PHEZH      ----------------------------MSLETLPTLREALEAHGLWAKKAFGQHFLLDL
RSMA_MARMM      ----------------------------MSLDQLPPLRDVIASHDLGAKKSFGQHFLLDL
RSMA_ANAMF      ----------------------------------------MRTIRHKAYKSLGQNFILDP
RSMA_ANAMM      ----------------------------------------MRTIRHKAYKSLGQNFILDP
RSMA_ANAPZ      ----------------------------------------MKITKYRTKKSLGQCFILDP
RSMA_EHRCJ      ---------------------------------------MYHVNRIYPKKELSQCFISSS
RSMA_EHRCR      ---------------------------------------MNHISKINPKKELSQCFISST
RSMA_EHRRG      ---------------------------------------MNDNYMINPKKELSQCFIHST
RSMA_EHRRW      ---------------------------------------MNDNYMINPKKELSQCFIHST
RSMA_WOLPM      ------------------------MNFRQLIFKILYNENNMKKFLLKPKKSLGQNFILSS
RSMA_WOLWR      ----------------------------------------MKKFLLKPKKSLGQNFILSS
RSMA_WOLTR      ----------------------------------------MKKFLLKPKKSLGQNFILSS
RSMA_WOLPP      ----------------------------------------MRKFLLKPKKSLGQNFILSN
RSMA_NEOSM      --------------------------------------------MQRYNKLLGQHFIYDR
RSMA_RICPU      --------------------------------MLPSIAKHAALHQVNPLKKHGQNFIFDS
RSMA_RICRS      --------------------------------MLPSIAKHAALHQVNPLRKHGQNFIFDS
RSMA_RICAE      --------------------------------MLPSIAKHAALHQVNPLKKHGQNFIFDS
RSMA_RICFE      --------------------------------MLPSIAKHAASHQINPLKKHGQNFIFDS
RSMA_RICAH      --------------------------------MLPSIAKHVASHQINPLKKHGQNFIFDS
RSMA_RICCK      --------------------------------MLPSIAKHAALHHINPLKKHGQNFIFDS
RSMA_RICPR      --------------------------------MLPSIVKHATSHKINPLKKHGQNFIFDS
RSMA_RICTY      --------------------------------MLPSIAKHAASHQINPLKKHGQNFIFDS
RSMA_RICB8      --------------------------------MLPSIAKHAASHQIHPLKKHGQNFIFDG
RSMA_RICBR      --------------------------------MLPSIAKHAASHQIHPLKKHGQNFIFDG
RSMA_PELUB      -------------------------------------------MFVKAKKSLGQNFLIDR
RSMA_PERMH      ------------------------------------------MGNFRPKKRFGQHLLISK
RSMA_SULSY      ------------------------------------------MNKIKPKKRLGQHFLISK
RSMA_AQUAE      --------------------------------------------MVRLKKSFGQHLLVSE
RSMA_HYDS0      --------------------------------------------MLKPKKTFGQNFLKSK
RSMA_DESVH      -------------------------------------------MPPRAKKSLGQNFLKDR
RSMA_DESVV      -------------------------------------------MPPRAKKSLGQNFLKDR
RSMA_DESAG      ----------------------------MIDKEYQRIMTERTASAPRAKKSLGQNFLQDK
RSMA_DESAD      -----------------------------------------MQTRHRAKKSLGQNFLQDA
RSMA_LAWIP      -----------------------------------------MDQTFRPKKSLGQHFLKDT
RSMA_HALMA      --------------------------MTTTETGTRDPDALVRRAGKRADTRQDQHFLVDD
RSMA_NATPD      ---------------------------------MRDPDALLVRAGVRGDPERDQHFLIDD
RSMA_HALWD      -----------MTDATSGSDPDSTTPVDLTGEDFRDPDALRRRAGVSGDPNFDQHFLIDD
RSMA_HALSA      ------------------------------MTAPRDPDALIRRAGRP-NPDFDQHFLIDD
RSMA_HALS3      ------------------------------MTAPRDPDALIRRAGRP-NPDFDQHFLIDD
RSMA_METHJ      -----------------------------------------------MRAYRDQHFLTDP
RSMA_METAC      -----------------------------------MVRSILNKYNIK-GGTFDQHFLIDI
RSMA_METMA      -----------------------------------MVRSILKKYNIK-GGTFDQHFLIDA
RSMA_METBF      -------------------------MYSIYSGGFSLVRSLLKKYNIK-GGTFDQHFLVDA
RSMA_METBU      -----------------------------------MVRKILQKYGIR-GGCHDQHFLIDE
RSMA_ARCFU      ---------------------------------------------MKLRKSLGQHMLVDR
RSMA_METTH      -----------------------------MSGLYTETREVLRKYGVRLRRSLGQNYLIDE
RSMA_METST      ---------------------------------MSNTKEILEKYNIKLDTNKSQNYLIDD
RSMA_PYRAB      --------------------------------MRDRLFFLLSKYGIRPNDRIGQHFLIVK
RSMA_PYRHO      --------------------------------MRDRLFFLLSKYGIRPRDSIGQHFLIIE
RSMA_PYRFU      --------------------------------MRDKLFYFLSKYNFSPRDKIGQNFLIMR
RSMA_THEKO      --------------------------------MRDRLFSIIYKYNLHPNRDLGQNFLIVP
RSMA_THEGJ      --------------------------------MRDRLFSIIYKYNLRPNRTLGQNFLIVP
RSMA_THEON      --------------------------------MRERLFSLISKYGLRANSDLGQNFLIVD
RSMA_THESM      --------------------------------MYSKVFSLISKYNLKPNSDLGQNFLIVG
RSMA_METKA      ------------------------------MRSVEYLAYLRSKYGIRPRRRLGQHFMVDD
RSMA_METM6      ---------------------------------------------MRQSKKLGQCFLKDK
RSMA_METM7      ---------------------------------------------MRQSKKLGQCFLKDK
RSMA_METMP      ---------------------------------------------MRQSKKLGQCFLKDK
RSMA_METM5      ---------------------------------------------MRQSKKLGQCFLKDK
RSMA_METVS      ---------------------------------------------MKQSKKLGQCFLKDK
RSMA_META3      ---------------------------------------------MQQNKKLGQCFLKDK
RSMA_METJA      --------------------------------------------MFKPKKKLGQCFLIDK
RSMA_PYRAE      ----------------------------------------------MKRRRLAQHFLRDP
RSMA_PYRIL      ----------------------------------------------MGKRRWSQHFLRDT
RSMA_RUBXD      ------------------------------------MSPSLSGRTPRPKKRLGQHFLKDA
RSMA_NATTJ      ----------------------------MNLFSPKEVSQLLKRYEIHPKKSLGQNFLVDG
RSMA_RHOBA      ---------------------------------------------MRPVSKYGQNFLIDL
RSMA_PAEAT      ---------------MTEPNSEPAAVAP--LMGATDIRRLAEEIGVRPTKTLGQNFVIDG
RSMA_ARTS2      ---------------MTKPIPAASGTAPAALFGASDVRRLAEEIGVRPTKTLGQNFVIDG
RSMA_STRAW      ----------------------MSSPAPDALLGPADIRELAAALGVRPTKQRGQNFVIDA
RSMA_STRCO      ----------------------MSSPTPDALLGPADVRELAAALGVRPTKQRGQNFVIDA
RSMA_STRGG      ----------------------MSSTEPDALLGPADIRDLAATLGVRPTKQRGQNFVIDA
RSMA_THEFY      --------------------MTESDSADARLLTPADVRRLAAQLGIRPTKTLGQNFVIDP
RSMA_KINRD      -------------------MARVRQEALSSLLSARDVRDLADRLSIRPTKTLGQNFVVDA
RSMA_LEIXX      -------------------------MNELRLLGPAEIRDLAELIGVAPTKRLGQNFVIDA
RSMA_CUTAK      -------------------------MSETGLLNPASIRRIADQIGLRPTKTRGQNFVHDA
RSMA_CORGL      ----------------------MEEPSGAQLLGPVEIRALAEKLDVTPTKKLGQNFVHDP
RSMA_CORGB      ----------------------MEEPSGAQLLGPVEIRALAEKLDVTPTKKLGQNFVHDP
RSMA_COREF      ----------------------MEEPSGAQLLGPVEIRALAEKLDVTPTKKLGQNFVHDP
RSMA_CORDI      ----------------------MEDQASAQLLGPVEIRQLAEKLDVTPTKKLGQNFVHDP
RSMA_CORJK      ----------------------MVNERKIRLLGPNEIRQLAEELDLNPTKKLGQNFVHDP
RSMA_MYCA1      -----------MASVQRK----SWCALTIRLLGRTEIRRLAKELEFRPRKSLGQNFVHDA
RSMA_MYCPA      -----------MASVQRK----SWCALTIRLLGRTEIRRLAKELEFRPRKSLGQNFVHDA
RSMA_MYCLE      --------------MQRK----SGCTLTIRLLERTEIRWLVKELECRPRKSLGQNFVHDA
RSMA_MYCLB      --------------MQRK----SGCTLTIRLLERTEIRWLVKELECRPRKSLGQNFVHDA
RSMA_MYCTU      --------------MCCT----SGCALTIRLLGRTEIRRLAKELDFRPRKSLGQNFVHDA
RSMA_MYCTA      --------------MCCT----SGCALTIRLLGRTEIRRLAKELDFRPRKSLGQNFVHDA
RSMA_MYCBT      --------------MCCT----SGCALTIRLLGRTEIRRLAKELDFRPRKSLGQNFVHDA
RSMA_MYCBO      --------------MCCT----SGCALTIRLLGRTEIRRLAKELDFRPRKSLGQNFVHDA
RSMA_MYCBP      --------------MCCT----SGCALTIRLLGRTEIRRLAKELDFRPRKSLGQNFVHDA
RSMA_MYCGI      --------------------------MTIRLLGRTEIRHLAKSIDFRPRKSFGQNFVHDA
RSMA_MYCVP      --------------------------MTIRLLGRTEIRHLAKSIDFRPRKSFGQNFVHDA
RSMA_MYCSJ      --------------------------MTIRLLGRTEIRRLAKDIDFRPRKSFGQNFVHDA
RSMA_MYCSS      --------------------------MTIRLLGRTEIRRLAKDIDFRPRKSFGQNFVHDA
RSMA_MYCSK      --------------------------MTIRLLGRTEIRRLAKDIDFRPRKSFGQNFVHDA
RSMA_RHOOB      -----------MSDAEVP----PAARGQAALLGPAEVRALAEEFGVRPTKQLGQNFVHDA
RSMA_RHOJR      -----------MSEAEVP----PVARGQAALLGPAEVRALAEEFGVRPTKQLGQNFVHDA
RSMA_RHOE4      -----------MSDAEQSNEPIATPRGQAALLGPVEVRALAEEFGVRPTKQLGQNFVHDA
RSMA_NOCFA      -----------MSEADVT------ARGDAALLGPAEVRALAERFGVRPTKQLGQNFVHDA
RSMA_BIFLD      --------------------MNDTIPATGHLLGAADIRRIAADAGISPTKKFGQNFVIDP
RSMA_BIFLS      --------------------MNDTIPATGHLLGAADIRRIAADAGISPTKKFGQNFVIDP
RSMA_BIFLO      --------------------MNDTIPATGHLLGAADIRRIAADAGISPTKKFGQNFVIDP
RSMA_BIFAA      ------------------MTENVNEHTQGHLLGAADIRRIAADAGISPTKKFGQNFVIDP
RSMA_ACIC1      ------------------MSDAGHVDAVCKPLGAADIRELARSAGVRPRKTFGQHFVVDP
RSMA_OPITP      -----------------------------MPLTPTATRELLAQLGHQPKRFLGQNFLVDG
RSMA_DEIGD      --------------MTQ------SEPPSLPLYSPARVRDLLTRHGLRPTKSLGQNFLIDG
RSMA_DEIRA      ---------MTPNPMTNDLPDPAAAPDSAPLYSPARVRALLAAHGLKPTKSLGQNFLIDG
RSMA_THET2      ---------------------------MSKLASPQSVRALLERHGLFADKRFGQNFLVSE
RSMA_THET8      ---------------------------MSKLASPQSVRALLERHGLFADKRFGQNFLVSE
RSMA_CHLTR      ----------------------------MARSSIEQLTSFLRSVNGRAKKALSQNFLVDG
RSMA_CHLTA      ----------------------------MARSSIEQLTSFLRSVNGRAKKALSQNFLVDG
RSMA_CHLT2      ----------------------------MARSSIEQLTSFLRSVNGRAKKALSQNFLVDG
RSMA_CHLTB      ----------------------------MARSSIEQLTSFLRSVNGRAKKALSQNFLVDG
RSMA_CHLMU      ----------------------------MARSSIEQLTSFLKSVNGRAKKALSQNFLVDG
RSMA_CHLCV      ----------------------------MSRSSPDQLTRFLAQVQGRPKKGLSQNFLIDG
RSMA_CHLFF      ----------------------MALGDLLSRSSPDQLTRFLAQVHGHPKKGLSQNFLIDG
RSMA_CHLAB      ----------------------------MSRSSPEQLSRFLAEVHGRPKKGLSQNFLIDG
RSMA_CHLPN      ----------------------------MTRSSPAQLSRFLSEIQNKPKKSLSQNFLVDQ
RSMA_PARUW      ----------------------------MPIYKPSELRLFLNQLGIFPKKGLSQNFLIDG
RSMA_ALKMQ      ---------------------------MDKIVSPSKTKAIVEKYKFRFSKSLGQNFLIDQ
RSMA_ALKOO      ---------------------------MDRISSPKKTKEIVQKYEFKFSKSLGQNFLIDQ
RSMA_CLOD6      ---------------------------MDRLSSHNATKEVVQKYNFKFSKSLGQNFLIDS
RSMA_LACP7      ---------------------------MAYLGDPKQTIEVLNRYRFIFQKKFGQNFLIDT
RSMA_CLOPE      --------------------------MDINEIKDIKTKELVQKYNFRFSKSLGQNFLIDD
RSMA_CLOP1      --------------------------MDINEIKDIKTKELVQKYNFRFSKSLGQNFLIDD
RSMA_CLOPS      --------------------------MDINEIKDIKTKELVQKYNFRFSKSLGQNFLIDD
RSMA_CLOAB      -------------------------------MKEFNTRQIVEKYNFRFSKRLGQNFLTDN
RSMA_CLOB6      ----------------------------------MNTKEIVNKYEFKFNKNLGQNFLIDE
RSMA_CLOBJ      ----------------------------------MNTKEIVNKYEFKFNKNLGQNFLIDE
RSMA_CLOB1      ----------------------------------MNTKEIVNKYEFKFNKNLGQNFLIDE
RSMA_CLOBL      ----------------------------------MNTKEIVNKYEFKFNKNLGQNFLIDE
RSMA_CLOBK      ----------------------------------MNTKEIVNKYEFKFNKNLGQNFLIDE
RSMA_CLOBM      ----------------------------------MNTKEIVNKYEFKFNKNLGQNFLVDE
RSMA_HALOH      --------------------------MDKVIATPGGTNEIIRKYNLKLHKGLGQNFLIDQ
RSMA_MOOTA      ---------------------------MDSVATPGRTLALVREKGLVPRKSRGQNFLVDA
RSMA_PELTS      ---------------------------MIVVASPAVVREIMRRHGISPRKSLGQNFLIDL
RSMA_SYMTH      ----------------------------MDLANPGALKALMAQYGLRPQHRLGQNFLIDG
RSMA_CALS4      ---------------------------------------------MKAKKKWGQNFIFDK
RSMA_DEHMB      ------------------MGKDVPLLVASAPSLMAQAKEMMEGYTLKARKGLGQHFLISQ
RSMA_DEHMC      ------------------MEKDVPLLVASAPSLMAQAKEMMEGYTLKARKGLGQHFLISQ
RSMA_DEHM1      ------------------MEKDAPLAATGTPSLMAQAKEMMEGYTLRARKGLGQHFLISQ
RSMA_DESHD      -----------------------------MENAANYTRRILKG-GAKAHKSLGQNFLMDD
RSMA_DESHY      -----------------------------MENAANYTRRILKG-GAKAHKSLGQNFLMDD
RSMA_GEOKA      --------------------------MYKDIATPGRTKEILERYGFSFKKSLGQNFLIDA
RSMA_GEOTN      --------------------------MHKDIATPGRTKEILARYGFSFKKSLGQNFLIDT
RSMA_GEOSW      --------------------------MNKDIATPGRTREILEKYGFSFKKSLGQNFLIDT
RSMA_ANOFW      --------------------------MYKDIATPTRTKEILEKYGFSFKKSLGQNFLIEP
RSMA_BACLD      --------------------------MNKDIATPIRTKEILNKYGFSFKKSLGQNFLIDT
RSMA_BACSU      --------------------------MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDT
RSMA_BACP2      --------------------------MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDT
RSMA_BACAN      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACAA      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACHK      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACCZ      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACAC      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACC7      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACC0      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACC1      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACCQ      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACCR      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACC4      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACC2      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACC3      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACAH      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACMK      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACCN      ---------------------------MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDT
RSMA_BACHD      --------------------------MTKDIATPIRTKEILAKHGFTFKKSLGQNFLIDP
RSMA_LYSSC      --------------------------MHKDIATPIRTQEILKKYGFSFKKSLGQNFLIDP
RSMA_BACSK      ------------------------MNLNKDIATPARTNAILKKHGFTLKKSLGQNFLIDL
RSMA_OCEIH      ------------------------MTTNKYIATPSRTKDILGKYHFTFKKSLGQNFLVDV
RSMA_LISMC      --------------------------MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDS
RSMA_LISMF      --------------------------MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDS
RSMA_LISMO      --------------------------MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDS
RSMA_LISMH      --------------------------MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDS
RSMA_LISIN      --------------------------MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDS
RSMA_LISW6      --------------------------MSKDIATPGKTTEILKKYGFLFKKSLGQNFLIDS
RSMA_STAAT      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAA3      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAC      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAA2      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAA9      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAS      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAA1      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAM      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAW      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAN      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAA8      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAB      ------------------------MLDNKDIATPSRMRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAE      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAAR      ------------------------MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDV
RSMA_STAES      -------------------------MEYKDIATPSRTRALLDQYGFNFKKSLGQNFLIDV
RSMA_STAEQ      -------------------------MEYKDIATPSRTRALLDQYGFNFKKSLGQNFLIDV
RSMA_STAHJ      -------------------------MERKDIATPSRTKALLDQFGFNFKKSLGQNFLVDV
RSMA_STACT      -------------------------MNKKDIATPTRTRALLDKYQFDFKKSLGQNFLIDV
RSMA_STAS1      -------------------------MDYKDIATPTRTKALLNQYGFNFKKSLGQNFLIDV
RSMA_MACCJ      -------------------------MEYNDIATPTRTKQLLDQYGFKFKKSLGQNFLVDT
RSMA_STRA1      ----------------------------MRIADKTVTRAILERHGFTFKKSFGQNFLTDT
RSMA_STRA5      ----------------------------MRIADKTVTRAILERHGFTFKKSFGQNFLTDT
RSMA_STRA3      ----------------------------MRIADKTVTRAILERHGFTFKKSFGQNFLTDT
RSMA_STRMU      ----------------------------MKIADKTVTRAILERHGFTFKKLFGQNFLTDT
RSMA_STRS7      ----------------------------MRIADYSVTKAILDRYGFTFKKSFGQNFLTDT
RSMA_STREM      ----------------------------MRIADYSVTKAILDRYGFTFKKSFGQNFLTDT
RSMA_STRE4      ----------------------------MRIADYSVTKSILDRYGFTFKKSFGQNFLTDT
RSMA_STRPB      --------------------MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRPC      --------------------MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRP1      ----------------------------MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRPF      --------------------MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRPD      --------------------MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRPM      --------------------MIIKRREYMRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRP8      ----------------------------MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRPG      ----------------------------MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRP6      ----------------------------MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRP3      ----------------------------MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRU0      ----------------------------MRIADYSVTRAVLDRHGFTFKKSFGQNFLTDT
RSMA_STRT2      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRTD      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRT1      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRGC      ----------------------------MRIADYSVTRAILERHGFTFKKSFGQNFLTDT
RSMA_STRSV      ----------------------------MRIADYSVTRAILERHGFTFKKSFGQNFLTDT
RSMA_STRPN      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRZT      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRPJ      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRP7      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRZJ      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRPI      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRP4      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRR6      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRP2      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRPS      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_STRZP      ----------------------------MRIADYSVTKAVLERHGFTFKKSFGQNFLTDT
RSMA_LACLA      ----------------------MTENNIDRISNIIRTQDILRRHDFNFKKKFGQNFLTDH
RSMA_ENTFA      ------------------------MTDYKEIATPSRTKEILKKHGFSFKKSLGQNFLTEP
RSMA_LACSS      ---------------------------MEDIANPERTKKILKRYGFKFKKSLGQNFLTNI
RSMA_LACPL      -----------------------MMSRDLDIANPARTRAIMHTYGLQVKKSLGQNFLTDQ
RSMA_LACS1      -----------------------MANELPEIANPTRTRAIMETYGLTFKKSLGQNFLTDI
RSMA_LACBA      -----------------------MTNELPEIGSPARTKAILNRYRLVAKKSLGQNFLSDL
RSMA_PEDPA      ------------------------MNNQMDIGNPTRTRAILEKYGLSAKKSLGQNFLTDP
RSMA_LACRD      ------------------------MSNSPEIGSRTRTRAIMEKYGIRTKKSFGQNFLTDL
RSMA_LACRJ      ------------------------MSNSPEIGSRTRTRAIMEKYGIRTKKSFGQNFLTDL
RSMA_LEUCK      ------------------------MADIIDIANPTRTQAILNQYGLHAKKKFGQNFLTDL
RSMA_LEUMM      ------------------------MAQTIDIANPTRTQAILNEYGLRAKKKFGQNFLTDL
RSMA_OENOB      ------------------------MNDIPAIGSPIRTRTILNEYDLHASKRLGQNFLIDL
RSMA_LACAC      ------------------------MANNIPIGSPVRTKAIINRYFVKAKKNLGQNFLVDQ
RSMA_LACH4      ------------------------MANNIPIGSAVRTQVIINRYFVKAKKNLGQNFLIDQ
RSMA_LACJO      ------------------------MSNSMPIASPVRTQAIVNRYFMHAKKNLGQNFLVDL
RSMA_LACDA      ------------------------MTNRIPIASPVRTAAIVNRYFVHAKKNLGQNFLVDL
RSMA_LACDB      ------------------------MTNRIPIASPVRTAAIVNRYFVHAKKNLGQNFLVDL
RSMA_CARHZ      ----------------------------MNLWSPTTLKEILARHNLTLSHGLGQHFLTDF
RSMA_ACIF2      ---------------------------------------MQEGGLPRAKKRFGQNFLVQP
RSMA_ACIF5      --------------------------------------MMQEGGLPRAKKRFGQNFLVQP
RSMA_HALHL      ---------------------------------------MSH----RPRKRFGQNFLRDP
RSMA_ACISJ      -------------------------------------------MKHIPRKRFGQHFLSDQ
RSMA_ACIET      -------------------------------------------MKHIPRKRFGQHFLSDS
RSMA_ACIAC      -------------------------------------------MKHIPRKRFGQHFLADQ
RSMA_POLSJ      --------------------------MLEPVGERPQLWRAELIVKHIPRKRFGQHFLTDQ
RSMA_POLNA      -------------------------------------------MKHIARKRFGQHFLTDR
RSMA_RHOFT      -------------------------------------------MKHIARKRFGQHFLTDG
RSMA_VARPS      -------------------------------------------MAHIARKRFGQHFLSDG
RSMA_VEREI      --------------------------------MTRPAEPARAAGRHRPRKRLGQHFLTDQ
RSMA_LEPCP      -------------------------------------------MKHIPRKRFGQHFLADQ
RSMA_METPP      -------------------------------------------MKHIARKRFGQHFLSDA
RSMA_BURCM      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURA4      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURCA      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURCH      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURCC      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURCJ      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURL3      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURM1      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURVG      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURMA      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURPS      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURM9      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURM7      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURMS      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURP1      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURP0      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURP6      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_BURTA      --------------------------------MSNS--RQ--HQGHFARKRFGQNFLVDH
RSMA_PARPJ      --------------------------------MSTSRQQQGRHQGHIARKRFGQNFLVDM
RSMA_PARXL      --------------------------------MSTSRQQQGRHQGHIARKRFGQNFLVDM
RSMA_PARP8      --------------------------------MSNSSSRQ--HQGHFARKRFGQNFLVDL
RSMA_CUPTR      -----------------------------------M--RSNVHQGHVARKRFGQNFLVDD
RSMA_CUPNH      -----------------------------------M--RSNVHQGHVARKRFGQNFLVDD
RSMA_CUPPJ      -----------------------------------M--RSNMHQGHVARKRFGQNFLVDD
RSMA_CUPMC      -----------------------------------M--RSNVHQGHVARKRFGQNFLVDD
RSMA_RALSO      --------------------------------MARS--TSGVHQGHQARKRFGQNFLVDD
RSMA_BURSP      --------------------------------MILAKARI---QGHTARKRFGQHFLIDS
RSMA_BORBR      ------------------------------------------MSAHQARKRFGQHFLTDE
RSMA_BORPE      ------------------------------------------MSAHQARKRFGQHFLTDE
RSMA_BORPA      ------------------------------------------MSAHQARKRFGQHFLTDE
RSMA_BORA1      ------------------------------------------MSQHQARKRFGQHFLTDE
RSMA_BORPD      ------------------------------------------MSRHQARKRFGQHFLTDD
RSMA_HERAR      -------------------------------------------MKHIPRKRFGQNFLTDD
RSMA_JANMA      -------------------------------------------MKHIPRKRFGQNFLTDD
RSMA_AROAE      ------------------------------------------MSEHRARKRFGQNFLSDP
RSMA_THIDA      --------------------------------------------MHTPRKRFGQNFLIDD
RSMA_METFK      -------------------------------------------MKHVAKKRFGQNFLTDR
RSMA_CHRVO      ------------------------------------------MSKHIPRKRFGQNFLQDA
RSMA_LARHH      ------------------------------------------MSRHIPKKRFGQNFLQDA
RSMA_NEIG1      ------------------------------------------MKEHKARKRFGQNFLQDT
RSMA_NEIG2      ------------------------------------------MKEHKARKRFGQNFLQDT
RSMA_NEIMA      ------------------------------------------MKEHKARKRFGQNFLQDT
RSMA_NEIM0      ------------------------------------------MKEHKARKRFGQNFLQDT
RSMA_NEIMB      ------------------------------------------MKEHKARKRFGQNFLQDT
RSMA_NEIMF      ------------------------------------------MKEHKARKRFGQNFLQDT
RSMA_DECAR      ------------------------------------------MKGHVARKRFGQNFLVDQ
RSMA_NITEU      -------------------------------------------MRHTPRKRFGQHFLVDT
RSMA_NITEC      -------------------------------------------MRHIPRRRFGQHFLVDH
RSMA_NITMU      -------------------------------------------MQHTPRRRFGQNFLVDS
RSMA_PSYA2      --------------------------MSKISFDAQSISNSLRAAKHQPRKRFGQNFLHDR
RSMA_PSYCK      --------------------------MSKTTFDAQSITNSLRAAKHQPRKRFGQNFLHDR
RSMA_ACIAD      --------------------------MEVFMYQINALNP--KEEGHKARKRFGQNFLHDQ
RSMA_COXBU      ------------------------------------------MKKMPMRKRFGQHFLHDS
RSMA_COXB2      ------------------------------------------MKKMPMRKRFGQHFLHDS
RSMA_COXBR      ------------------------------------------MKKMPMRKRFGQHFLHDS
RSMA_COXBN      ------------------------------------------MKKMPMRKRFGQHFLHDS
RSMA_COXB1      ------------------------------------------MKKMPMRKRFGQHFLHDS
RSMA_ALCBS      ------------------------------------------MKEHRTRKRFGQHFLHDR
RSMA_HAHCH      -----------------------------------MGRHNENI-GHQARKRFGQNFLHDQ
RSMA_MARHV      --------------------------------------MSNKH-GHQARKRFGQNFLHDP
RSMA_MARMS      --------------------------------------MSKSQ-PHKARKRFGQNFLHDH
RSMA_PSEF5      --------------------------------------MTEQY-QHRARKRFGQNFLHDA
RSMA_PSEPF      --------------------------------------MTEQY-QHKARKRFGQNFLHDA
RSMA_PSE14      --------------------------------------MTEQY-QHRARKRFGQNFLHDA
RSMA_PSESM      --------------------------------------MTEQF-QHRARKRFGQNFLHDA
RSMA_PSEU2      --------------------------------------MTEQY-QHRARKRFGQNFLHDA
RSMA_PSEPK      --------------------------------------MNEQY-QHRARKRFGQNFLHDA
RSMA_PSEAE      --------------------------------------MSELY-QHRARKRFGQNFLHDA
RSMA_CHRSD      ---------------------------MPDFPKEHATPMSNRPPAHQARKRFGQNFLRDT
RSMA_SACD2      ----------------------------------MKNKNTDPMQGHRARKRFGQNFLEDQ
RSMA_METCA      -------------------------------------------MRHVPRKRFGQNFLRDP
RSMA_LEGPC      -------------------------------------------MRHSPRKRFGQNFLQDK
RSMA_LEGPA      -------------------------------------------MRHSPRKRFGQNFLQDK
RSMA_LEGPL      -------------------------------------------MRHSPRKRFGQNFLQDK
RSMA_LEGPH      -------------------------------------------MRHSPRKRFGQNFLQDK
RSMA_NITOC      ----------------------------------------MNTLGHRARKRFGQHFLHDK
RSMA_HYDCU      ------------------------------------------MAKHQHKKRFGQNFLNND
RSMA_XANAC      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XANC5      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XANOR      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XANOM      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XANOP      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XANCP      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XANC8      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XANCB      ---------------------------------------MNSSFSAPAKKSLGQHFLADR
RSMA_XYLFA      --------------------------------------MESQLFNAPAKKAFGQHFLVDR
RSMA_XYLFT      --------------------------------------MESRLFNTPAKKAFGQHFLVDR
RSMA_DICNV      ------------------------------------------MTEIKAVKRLGQHFLRDE
RSMA_ACTP2      ----------------------------------MSNQNSKKHLGHTARKRFGQNFLHDM
RSMA_ACTP7      ----------------------------------MSNQNSKKHLGHTARKRFGQNFLHDM
RSMA_ACTPJ      ----------------------------------MSNQNSKKHLGHTARKRFGQNFLHDM
RSMA_HAEDU      ----------------------------------MRTSNSKKHLGHTARKRFGQNFLSDM
RSMA_HAEIE      -------------------------------------MNSKKHLGHTARKRFGQNFLHDT
RSMA_HAEIG      -------------------------------------MNSKKHLGHTARKRFGQNFLHDT
RSMA_HAEIN      -------------------------------------MNSKKHLGHTARKRFGQNFLHDT
RSMA_HAEI8      -------------------------------------MNSKKHLGHTARKRFGQNFLHDT
RSMA_PASMU      -------------------------------------MNSKKHLGHTARKRFGQNFLHDN
RSMA_MANSM      -------------------------------------MNSKRHLGHTARKRFGQNFLHDD
RSMA_HAES1      -------------------------------------MKSKTHLGHTARKRFGQNFLHDN
RSMA_HISS2      -------------------------------------MKSKTHLGHTARKRFGQNFLHDN
RSMA_PSYIN      -------------------------------------MNDKTHLGHTARKRFGQNFLHDD
RSMA_AERHH      ------------------------------------MQSNKVHMGHTARKRFGQNFLHDR
RSMA_TOLAT      ------------------------------------MINDNVHLGHRARKRFGQNFLHDQ
RSMA_ALIF1      -----------------------------------MSTRNDVHLGHKARKRFGQNFLNDP
RSMA_ALIFM      -----------------------------------MSTRNDVHLGHKARKRFGQNFLNDP
RSMA_ALISL      -----------------------------------MSTRNDVHLGHKAKKRFGQNFLNDP
RSMA_VIBA3      -------------------------------------MRNDVHLGHKARKRFGQNFLNDP
RSMA_VIBCH      -------------------------------------MRNDVHLGHKARKRFGQNFLNDP
RSMA_VIBC3      -------------------------------------MRNDVHLGHKARKRFGQNFLNDP
RSMA_VIBCB      -------------------------------------MRNDVHLGHKARKRFGQNFLNDP
RSMA_VIBPA      -------------------------------------MRNDVHLGHKARKRFGQNFLNDP
RSMA_VIBVU      -------------------------------------MRNDVHMGHKARKRFGQNFLNDP
RSMA_VIBVY      -------------------------------------MRNDVHMGHKARKRFGQNFLNDP
RSMA_PHOPR      ------------------------------------MSSDQVHLGHRARKRFGQNFLNDP
RSMA_SHEB5      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_SHEB2      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_SHEB8      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_SHEB9      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_SHEPC      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_SHESW      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_SHESM      -------------------------------------MSSKVHLGHTARKRFGQNFLTDD
RSMA_SHESR      -------------------------------------MSSKVHLGHTARKRFGQNFLTDD
RSMA_SHESA      -------------------------------------MSSKVHLGHTARKRFGQNFLTDD
RSMA_SHEON      -------------------------------------MSSKVHLGHTARKRFGQNFLTDD
RSMA_SHEDO      -------------------------------------MSNKVHLGHTARKRFGQNFLTDD
RSMA_SHEFN      -------------------------------------MSNKVHLGHTARKRFGQNFLTDQ
RSMA_SHEHH      -------------------------------------MSNKVHLGHTARKRFGQNFLTDE
RSMA_SHEPA      -------------------------------------MSNKVHLGHTARKRFGQNFLTDE
RSMA_SHEPW      -------------------------------------MSNKVHLGHTARKRFGQNFLTDE
RSMA_SHESH      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_SHEWM      -------------------------------------MSNKVHLGHTARKRFGQNFLTDH
RSMA_SHELP      -------------------------------------MSNKVHLGHTARKRFGQNFLTDS
RSMA_SHEAM      -------------------------------------MSNKVHLGHTARKRFGQNFLTDG
RSMA_PSET1      -------------------------------------MTDKVHLGHRARKRFGQNFLFDD
RSMA_COLP3      -------------------------------------MNDKKHLGHQAKKRFGQNFLHND
RSMA_IDILO      --------------------------MSKNQGGNKHQGGSKTHLGHRARKRFGQNFLNDD
RSMA_SALA4      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALDC      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALEP      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALG2      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALHS      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALPA      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALPK      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALPB      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALPC      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALTI      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALTY      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALAR      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALNS      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALCH      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_SALSV      -------------------------------------MNNRVHQGHLARKRFGQNFLNDR
RSMA_CITK8      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_KLEP3      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_KLEP7      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOUT      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO27      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOK1      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO45      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOL6      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOL5      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO81      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO55      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOLC      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOHS      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_SHIBS      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOBW      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECODH      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOLI      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOSM      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO7I      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO8A      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_SHIF8      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_SHISS      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_SHIB3      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOSE      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO57      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO5E      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_SHIFL      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ESCF3      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_SHIDS      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECO24      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ECOLU      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_CROS8      -------------------------------------MNNRVHQGHLARKRFGQNFLNDQ
RSMA_ENT38      -------------------------------------MNTRVHQGHLARKRFGQNFLNDQ
RSMA_PECAS      -------------------------------------MNNRVHQGHFARKRFGQNFLNDH
RSMA_PECCP      -------------------------------------MNNRVHQGHFARKRFGQNFLNDH
RSMA_YERPE      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERPP      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERPN      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERPG      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERPA      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERPS      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERPB      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERP3      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERPY      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_YERE8      -------------------------------------MNNRVHQGHFARKRFGQNFLNDQ
RSMA_SERP5      -------------------------------------MNNKVHQGHFARKRFGQNFLTDQ
RSMA_PHOLL      -------------------------------------MNNRVHQGHFARKRFGQNFLTDQ
RSMA_ERWT9      -------------------------------------MNSRVHQGHFARKRFGQNFLNDQ
RSMA_SODGM      -------------------------------------MNNRVHQGHLARKRFGQNFLHDS
RSMA_PROMH      -------------------------------------MNNRVHQGHFARKRFGQNFLTDS
RSMA_HAMD5      -------------------------------------MNRKLYQGHFAKKRFGQNFLTDE
RSMA_BAUCH      -------------------------------------MYNYFYQGHLVRKCLGQHFLHDQ
RSMA_BLOFL      -------------------------------------MQKKYYKNHVIQKKWGQIFLKDQ
RSMA_BLOPB      -------------------------------------MKKIYYKNHLIKKKWSQVFLKDQ
RSMA_BUCAI      --------------------------------------MPKNFKKHLPLKKYGQNFLINK
RSMA_BUCAP      --------------------------------------MKKKIKKHLPLKRFSQNFLINQ
RSMA_BUCBP      --------------------------------------MVKK-NTFFANKNLGQNFLVDS
RSMA_WIGBR      --------------------------------------------MHKPIKKLGQNFLKDK
RSMA_FRATF      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRATH      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRATO      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRATM      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRATW      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRATT      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRAT1      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRATN      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_FRAP2      -----------------------------------------MQYKTKAKKSLGQNFLQDE
RSMA_BACFR      ------------------------------------------MKLVKPKKFLGQHFLKDL
RSMA_BACFN      ------------------------------------------MKLVKPKKFLGQHFLKDL
RSMA_BACTN      ------------------------------------------MKLVKPKKFLGQHFLKDL
RSMA_BACV8      ------------------------------------------MGLVKPKKFLGQHFLKDL
RSMA_PARD8      ------------------------------------------MRLVKPKKALGQHFLKDL
RSMA_PORGI      ------------------------------------------MMRVKAKKALGQHFLRDL
RSMA_PORG3      ------------------------------------------MMRVKAKKALGQHFLRDL
RSMA_FLAJ1      ------------------------------------------MEKVKAKKHLGQHFLKDE
RSMA_FLAPJ      ------------------------------------------MEAVKAKKHLGQHFLKDE
RSMA_CYTH3      ------------------------------------------MEKVKAKKHLGQHFLNDQ
RSMA_CHLP8      ----------------------------------MTKVEYKHT-HIAAKKKLGQNFLLDK
RSMA_CHLTE      ----------------------------------MTKVEYKHT-HIAAKKKLGQNFLLDR
RSMA_CHLPB      ----------------------------------MKKIEYKHT-EIAVKKKLGQNFLTDQ
RSMA_PROA2      ----------------------------------MTKVQYKHT-EIAVKKKLGQNFLTDR
RSMA_CHLL2      ----------------------------------MTKVEYKHT-EIAVKKQLGQNFLTDR
RSMA_CHLPD      ----------------------------------MIKVEYKHT-EIAVKKKLGQNFLTDR
RSMA_PELLD      ----------------------------------MTRVEYKHT-EIAVKKKLGQNFLTDR
RSMA_CHLCH      ----------------------------------MINVEYKHT-QVAAKKKLGQNFLTDR
RSMA_SALRD      ------------MERSHVGRDCGSRSSPRAFSVPTSNVPMKMSIPFRPKQSLGQNFLHDP
RSMA_ANAD2      -----------------------------MTDHYPSPRALLDRYDLRAKKSWGQNFLGDE
RSMA_ANASK      -----------------------------MTDHYPSPRALLDRYDLRAKKSWGQNFLGDE
RSMA_ANADE      -----------------------------MTDRYPSPRALLDRYDLRAKKSWGQNFLGEE
RSMA_MYXXD      ---------------------------------MESPRDILKRHGLRAKYSWGQNFLGDE
RSMA_GEOMG      ----------------------------------------MRGEGIRARKALGQNFLVDR
RSMA_GEOSL      ----------------------------------------MRGDGIRARKALGQNFLTDR
RSMA_PELCD      -------------------------------------------MNHRPKKRFGQNFLQDR
RSMA_MAGMM      ------------------------------MSHYGRIKLLLEQHGLSPNKRFGQNFLVDP
RSMA_DESAH      ---------------------------------MTYPGILLKKQQLMARKELGQNFLSDP
RSMA_DESOH      ---------------------------------MTSPRTILSGHDIAPKKSLGQNFLCDP
RSMA_DESPS      ------------------------------MSSYGRTRTDLKKHKLAPKKRFGQNFLVHK
RSMA_SYNAS      ---------------------------------MTFVRQILRNHDIKPVKRLGQCFLADF
RSMA_MYCCT      ---------------------------------------------MKAKKYYGQNFISDL
RSMA_MYCMS      ---------------------------------------------MKAKKYYGQNFISDL
RSMA_MESFL      -------------------------------------------MKVEAKKKFGQNFISDQ
RSMA_FUSNN      -------------------------------------------MEFKHKKKYGQNFLNNK
RSMA_AYWBP      -------------------------------------------MHHTNKKKYGQNFLTDV
RSMA_ONYPE      -------------------------------------------MHHTTKKKYGQNFLTDV
RSMA_PHYAS      -------------------------------------------MQHQPKKKYGQNFLKDV
RSMA_MYCH7      ------------------------------------------MQKPVPKKHLGQNFLKDR
RSMA_MYCHJ      ------------------------------------------MQKPVPKKHLGQNFLKDR
RSMA_MYCH2      ------------------------------------------MQKPVPKKRLGQNFLKDR
RSMA_MYCMO      -------------------------------------------MSHNFKKSLGQNFLQDK
RSMA_MYCS5      ----------------------------------------MNHLDKNAKKSLGQNFLRDK
RSMA_MYCPU      ---------------------------------------------MRAKKRFGQNFLIDQ
RSMA_MYCA5      -------------------------------------------MEVIAKKRFGQNFLINK
RSMA_KORVE      ----------------------------------MPKMAAEKNSKPAKKAKLGQNFLSDA
RSMA_ACIC5      --------------------------MRGGWGRFPPKSREVAAISGKHKPKLGQNFLVSE
RSMA_THEMA      ---------------MDGCHLSRDKLQGDGEGCDLKTSDYLKKYGVRLKKHLGQVFLSDD
RSMA_THESQ      ----------------------------------MKTSDYLKKYGVRLKKHLGQVFLSDD
RSMA_THEP1      ----------------------------------MKTSDYLKKYGVKLKKHLGQVFLSDD
RSMA_THENN      ----------------------------------MKTSDYLKKYGIRLKKHLGQVFLSDD
RSMA_NOSS1      --------------------------------------------MVRPRKLFAQHWLKSE
RSMA_TRIV2      --------------------------------------------MVRPRRVFAQHWLKSE
RSMA_NOSP7      --------------------------------------------MIRPRKVFAQHWLKSE
RSMA_CROS5      --------------------------------------------MPQPRKRFAQHWLRSE
RSMA_RIPO1      --------------------------------------------MPQPRKRFAQHWLRSE
RSMA_SYNY3      -------------------------------------------MAFRPRKRFGQHWLNHE
RSMA_ACAM1      --------------------------------------------MPRPRKRFAQHWLKSQ
RSMA_SYNE7      ---------------------------------------------MPARKRFGQHWLRSE
RSMA_SYNP6      ---------------------------------------------MPARKRFGQHWLRSE
RSMA_SYNP2      ---------------------------------------------MRPRKRFGQHWLTDQ
RSMA_THEEB      --------------------------------------------MIRARKRFGQHWLRSE
RSMA_SYNJB      --------------------------------------------MPYPRKRFGQHWLKDP
RSMA_SYNJA      --------------------------------------------MPYPRKRFGQHWLKDP
RSMA_GLOVI      ---------------------------------------------MYTLKRFGQHWLNDG
RSMA_PROMA      ----------------------------------------MPFSGHVPRKRFGQHWLRDD
RSMA_PROM4      ----------------------------------------MSFSGHSARKRFGQHWLKDV
RSMA_PROM3      ----------------------------------------MAFSGHHARKRFAQHWLIDA
RSMA_PROMM      ----------------------------------------MAFSGHHARKRFAQHWLIDA
RSMA_SYNS3      ----------------------------------------MTFSGHTARKRFGQHWLINE
RSMA_SYNPW      ----------------------------------------MSFGGHTPRKRFGQHWLRDE
RSMA_SYNSC      ----------------------------------------MGFSGHHARKRFGQHWLLDE
RSMA_SYNPX      ----------------------------------------MAFQGHQARKRFGQHWLKDQ
RSMA_SYNS9      ----------------------------------------MSFSGHTARKRFGQHWLRDA
RSMA_SYNR3      ----------------------------------------MAFSGHHARKRFGQHWLKDE
RSMA_PROM1      ----------------------------------MGGDNTLNDFRHIPRKRFGQHWLKDQ
RSMA_PROMT      ----------------------------------MGGDNTLNDFRHIPRKRFGQHWLKDQ
RSMA_PROM0      ----------------------------------------MNSKNYHQKKRFGQHWLVNK
RSMA_PROM9      ----------------------------------------MNSKNYHQKKRFGQHWLVNK
RSMA_PROMS      ----------------------------------------MNSKNHHQKKRFGQHWLVNK
RSMA_PROM2      ----------------------------------------MNSKNYHQKKRFGQHWLVNK
RSMA_PROM5      ----------------------------------------MNFKNHHQKKRFGQHWLVNN
RSMA_PROMP      ----------------------------------------MNFKNHHQKKRFGQHWLVNN
RSMA_TREPA      -------------------------MCCPNYNSARALAQFLTERGLRMHKKWGQNFLLDP
RSMA_TREPS      -------------------------MCCPNYNSARALAQFLTERGLRMHKKWGQNFLLDP
RSMA_TREDE      -------------------MNSGFFLSPPNYDSPAELKSLLETLGFAMQKKFGQNFLIDK
RSMA_BORAP      -------------------MLLSLLSMNINYNSITSIKQTLKEKKIAPRKLWGQNYLINE
RSMA_BORBP      -------------------MILSLLSMNINYNSITSIKQILKERKIAPRKLWGQNYLINE
RSMA_BORBU      -------------------MILSLLSMNINYNSITSIKQTLKERKIAPRKLWGQNYLINE
RSMA_BORBZ      -------------------MILSLLSMNINYNSITSIKQTLKERKIAPRKLWGQNYLINE
RSMA_UREPA      -------------------------------MNKSFIKNKLKQESFVPSKKMGQNFLLSN
RSMA_UREP2      -------------------------------MNKSFIKNKLKQESFVPSKKMGQNFLLSN
RSMA_UREU1      -------------------------------MNKTVIKNKLKQESFVPSKKMGQNFLLSN
RSMA_MYCPE      ----------------------------MIGKEENKFISFIKKNKFFASRKMGQNFLINE
RSMA_MYCGE      ------------------------------------------MNSFFPSRKLGQNFTVNL
RSMA_MYCPN      ------------------------------------------MNSFYPSRKLGQNFTVDQ
RSMA_MYCGA      --------------------------------MINKINKFFKNNEFSPSKQRGQNFLIDQ
RSMA_ARCB4      ------------------------------------------MEKVKAKKQYGQNFLKDS
RSMA_SULDN      ------------------------------------------MEKIVAKKKFGQNFLKDE
RSMA_HELHP      ------------------------------------------MEEYRSKKRFGQNFLQDS
RSMA_CAMC1      --------------------------------------------MIKAKKHFGQNFLQDK
RSMA_CAMC5      --------------------------------------------MIRAKKHFGQNFLQDE
RSMA_CAMHC      --------------------------------------------MYIAKKKFGQNFLKDK
RSMA_CAMFF      --------------------------------------------MIKVKKKFGQNFLQDE
RSMA_CAMJE      --------------------------------------------MVKAKKQYGQNFLIDK
RSMA_CAMJR      --------------------------------------------MVKAKKQYGQNFLIDK
RSMA_HELPY      --------------------------------------------MVVAKKSLGQHFLTDE
RSMA_HELPH      --------------------------------------------MVVAKKSLGQHFLTDE
RSMA_HELPG      --------------------------------------------MVVAKKSLGQHFLTDE
RSMA_HELP2      --------------------------------------------MVVAKKSLGQHFLTDE
RSMA_HELPS      --------------------------------------------MVVAKKSLGQHFLTDE
RSMA_HELPJ      --------------------------------------------MVVAKKSLGQHFLMDE
RSMA_HELAH      --------------------------------------------MVVAKKSLGQHFLTDE
RSMA_BDEBA      -----------------------------MSYSRERLQRAQEAMGIAAKKSLGQNFLVSD
                                                                     *      

RSMA_RHIEC      NLTQKVARTAGALEETTVF----------EVGPGPGGLTRAILALGAKK---VIAVERDA
RSMA_RHIE6      NLTQKVARTAGGLEGMTVF----------EVGPGPGGLTRAILALGAKK---VIAVERDA
RSMA_RHILW      NLTQKIARTAGALEEATIF----------EVGPGPGGLTRAILALGARK---VIAVERDT
RSMA_RHIL3      NLTQKIARTAGALEDATVF----------EVGPGPGGLTRAILALGARK---VIAIERDT
RSMA_AGRVS      NITQKVARTAGDLTNATVF----------EVGPGPGGLTRALLALGAKK---VIAIERDS
RSMA_RHIME      NLTQKIARTAGPLEDVTVI----------EVGPGPGGLTRAILALGAKK---VVAIERDS
RSMA_SINMW      NLTQKIARTAGPLEGVTVI----------EVGPGPGGLTRAILALGAKK---VVAIERDS
RSMA_SINFN      NLTQKIARTAGPLEDVTVI----------EVGPGPGGLTRAILALGARK---VVAIERDP
RSMA_AGRFC      NLTQKIARTAGPLDGVTVI----------EVGPGPGGLTRAILSLGAKK---VIAVERDS
RSMA_CHESB      NLTRRIARTAGGLDNATVL----------EVGPGPGGLTRALLMEGARR---VVAIERDE
RSMA_RHILO      NLTGKIARSAGDLTNTAVI----------EVGPGPGGLTRALLSNGARR---VVAIERDE
RSMA_BARHE      NLTSKIAHQAGNIEGKPVI----------EVGPGPGGLTRALLAKGAI----VTAIERDE
RSMA_BARQU      NLTSKIAHQAGNIEGKPVI----------EVGPGPGGLTRALLAKGAL----VIAIERDE
RSMA_BART1      NLTSKIAHQAGTIEGKPVL----------EIGPGPGGLTRALLAKGAI----VTAIERDE
RSMA_BARBK      NLTSKIARQAGNIEGKPVI----------EIGPGPGGLTRALLAKGAI----VTVIERDK
RSMA_BRUA2      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUA1      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUC2      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUMB      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUO2      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUSU      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUME      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUSI      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_BRUAB      NLTSKIARQAGDLRDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDD
RSMA_OCHA4      NLTSKIARQAGNLQDQPVI----------EVGPGPGGLTRALLAQGAY----VTAIERDE
RSMA_AZOC5      NLTARIARGSGPLEGATVV----------EVGPGPGGLTRALLALGARK---VIAIERDH
RSMA_XANP2      NLTGRIARASGPLEGATVV----------EVGPGPGGLTRALLALGARR---VIAIERDQ
RSMA_METRJ      NLTGRIARAAGPLAGVTVV----------EVGPGPGGLTRALLAEGAAR---VVAIERDP
RSMA_BRASB      NLTARIARAAGPLEDATVV----------EIGPGPGGLTRALLALGARH---VIAVEHDE
RSMA_BRASO      NLTARIARAAGPLEDATVV----------EIGPGPGGLTRALLALGARH---VIAVEHDE
RSMA_BRADU      NLTARIARAAAPLDNSTIV----------EIGPGPGGLTRALLALGARR---VVAIEHDE
RSMA_NITHX      NLTARIARAAGPLEDATVI----------EIGPGPGGLTRALLAMGAQR---VIAIERDA
RSMA_NITWN      NLTSRIARAAGPLQDATVV----------EIGPGPGGLTRALLAVGAKH---VIAIERDE
RSMA_RHOPA      NLTARIARAAGPLEGVTVV----------EIGPGPGGLTRALLATGAKR---VIAIERDE
RSMA_RHOPT      NLTARIARAAGPLEGVTVV----------EIGPGPGGLTRALLATGAKR---VIAIERDE
RSMA_RHOPS      NLTARIARAAGPLDDVTVV----------EIGPGPGGLTRALLATGARR---VIAIERDE
RSMA_RHOP2      NLTARIARAAGPLDDVTVV----------EIGPGPGGLTRALLATGARR---VIAIERDE
RSMA_RHOP5      NLTTRIARAAGPLEDSTVI----------EVGPGPGGLTRALLALGAKR---VIAIERDE
RSMA_RHOPB      NLLTRIARAAGPLDGATVI----------EIGPGPGGLTRALLALGAAK---VIAIERDE
RSMA_OLICO      NLTARIARAAGPLDDVTVI----------EIGPGPGGLTRALLATGAKR---VIAVERDE
RSMA_RUEPO      NLTAKIARQAGDLSECDVL----------EIGPGPGGLTRGLLAEGARR---VLAIEKDA
RSMA_RUEST      NLTAKIARQAGDLTGCDVL----------EIGPGPGGLTRGLLSEGARK---ILAIEKDQ
RSMA_ROSDO      NLTAKIARQAGDLSACDVL----------EIGPGPGGLTRGLLAQGARR---VLAIEKDA
RSMA_PARDP      NLTAKIARAAGDLTGCDVI----------EVGPGPGGLTRGLLAEGARH---VLAIEKDA
RSMA_DINSH      NLTARIARVPGDLSGADVL----------EVGPGPGGLTRGLLAEGARK---VLAIEKDA
RSMA_RHOS4      NLTAKIARLAGDLTNSDVL----------EVGPGPGGLTRGLLAEGARR---VLAIEKDA
RSMA_RHOS1      NLTAKIARLAGDLTNSDVL----------EVGPGPGGLTRGLLAEGARR---VLAIEKDA
RSMA_RHOSK      NLTAKIARLAGDLTNSDVL----------EVGPGPGGLTRGLLAEGARR---VLAIEKDA
RSMA_RHOS5      NLTAKIARLAGDLKGSDVL----------EVGPGPGGLTRGLLAEGARR---VLAIEKDA
RSMA_JANSC      NLTAKIARLAGDLTSVDVL----------EVGPGPGGLTRGLLAEGARR---VVAVEKDP
RSMA_ERYLH      QLLDRIAGIPGGLENRAVL----------EIGPGPGGLTRALLKAGAR----VTAIEMDR
RSMA_NOVAD      QLLDRIARVPGKLKGENVL----------EVGPGPGGLTRALLRAGAK----VTAIEMDK
RSMA_SPHAL      QLLDRIAAIPGDLDGATVF----------EVGPGPGGLTRALLRTGAR----VIAVERDE
RSMA_ZYMMO      QLLDRIARVPGDLTQKTVY----------EVGPGPGGLTRALLKAGAK----VTAVERDR
RSMA_MAGSA      NLTGRIARAAGDLTVGSVI----------EIGPGPGGLTRALLDAGARQ---VIAIERDD
RSMA_RHORT      NLTGRIARAGGEIDQGTVI----------EIGPGPGGLTRALLGAGARR---VIAIERDS
RSMA_GLUOX      GICARIAALGGDLTGRSVV----------EIGPGPGGLTRALLDTPASR---VDVVEIDE
RSMA_CAUVC      NVTRKIARLAQVGEGDTVV----------EVGPGPGGLTRALLETGA-R---VVAIEKDS
RSMA_PHEZH      NITRKIARLAQVGDGDVVI----------EVGPGPGGLTRALLETGA-R---VIAVEKDE
RSMA_MARMM      NLTAKIARLAGDMSRDQAI----------EVGPGPGGLTRAILAEGAAS---LLAVEMDS
RSMA_ANAMF      SMAEKIVSYAGSIEGYNII----------EVGPGFGTMTEIILRSKVAS---LLAIEKDR
RSMA_ANAMM      SMAEKIVSYAGSIEGYNII----------EVGPGFGTMTEIILRSKVAS---LLAIEKDR
RSMA_ANAPZ      AIAEKIVSYAGCLEQYNVI----------EVGPGLGIMTQSILNKEVRR---LTAIEKDR
RSMA_EHRCJ      HITDKIVNYAGNISDYSII----------EIGPGLGTMTYSILNKNPKR---LISIEKDS
RSMA_EHRCR      HITDQIVNYAGNISDYSII----------EIGPGLGTMTYSILNKNPKK---LISIEKDR
RSMA_EHRRG      DITDKIVNYAGNISNFSII----------EIGPGLGTMTYSILKKNPKK---LISIEKDS
RSMA_EHRRW      DITDKIVNYAGNISNFSII----------EIGPGLGTMTYSILKKNPKK---LISIEKDS
RSMA_WOLPM      EITKKIVALAGSLENFNVI----------EIGPGYGALTREILVHNPKS---LLSIEKDR
RSMA_WOLWR      EITKKIVALAGSLENFNVI----------EIGPGYGALTREILVHNPKS---LLSIEKDR
RSMA_WOLTR      EITKRIVVLAGNLEDFNVI----------EIGPGYGALTKEILAHNPKS---LLAIEKDS
RSMA_WOLPP      EIIKRIVALAGSLKDFNVI----------EIGPGYGALTREILAYNPKF---LLSIEKDS
RSMA_NEOSM      EVLDKIIDAATSVKGKHIF----------EIGAGSGTLSAAILLREPAS---LISVEKDK
RSMA_RICPU      SLCDKIVRASNLAENSRVL----------EIGPGTGGLTRSILQKNPES---LTVIETDE
RSMA_RICRS      SLCDKIVRASNLAENSRVL----------EIGPGTGGLTRSILQKNPES---LTVIETDE
RSMA_RICAE      SLCDKIVRASNLAENSRVL----------EIGPGTGGLTRAILQKNPES---LTVIETDE
RSMA_RICFE      SLCDKIVRASNLAENSRVL----------EIGPGTGGLTRSILQKNPAS---LTVIETDE
RSMA_RICAH      SLCDKIVRASHLAENSRVL----------EIGPGTGGLTRSILQKNPES---LTVIETDE
RSMA_RICCK      SLCHKIVRVSNLEENSRVL----------EIGPGSGGLTRSILQKNPES---LTVIETDE
RSMA_RICPR      SLCDKIIRASNVLENSNVI----------EIGPGIGGLTRSILQKNPKS---LTVIEIDE
RSMA_RICTY      SLCDKIIRASNISENSKVI----------EIGPGVGGLTRSILHKNPKS---LTVIEIDE
RSMA_RICB8      SLCDKIVRASGLEENSNVL----------EIGPGTGGLTRSILHKNPKL---LTVIETDE
RSMA_RICBR      SLCDKIVRASGLEENSNVL----------EIGPGTGGLTRSILHKNPKL---LTVIETDE
RSMA_PELUB      EVLEKIVSITDI-TNKEVL----------EIGPGSGNLTTYILKKKPKK---LYVVEKDD
RSMA_PERMH      GVIQKIVECLDIKEDDTVV----------EIGVGTGQLTEEILRRNPKI---VYGIEIDK
RSMA_SULSY      NVIEKIVDEINISKEDIIV----------EIGPGTGALTEEILLRNPKI---LYAIEIDT
RSMA_AQUAE      GVLKKIAEELNIEEGNTVV----------EVGGGTGNLTKVLLQHPLKK---LYVIELDR
RSMA_HYDS0      NIAHSIVELLDVKEDDTVI----------EIGPGLGALTEFLYQKPKKE---LILVELDK
RSMA_DESVH      NIAARIAAQLHIGPDDWVI----------EIGPGPGALTRHIHAAGPAR---LFLLEKDH
RSMA_DESVV      NIAARIAAQLHIGPDDWVI----------EIGPGPGALTRHIHAAGPAR---LFLLEKDH
RSMA_DESAG      NISAKIVAALQIGPADCVI----------EIGPGPGALTDFIQKAAPAS---LWLLEKDT
RSMA_DESAD      NIARKIVDSLKITENDSII----------EIGPGQGALTKFILEAGPES---LTLVEKDR
RSMA_LAWIP      AIAYRIVKLLDIHEGENIF----------EIGPGQGALTRHIYGYNPGQ---LLLVEKDS
RSMA_HALMA      RVLDRIPEYATDADIDLSH--------VLEIGAGPGALTDRLLATAER----VTAVERDP
RSMA_NATPD      RVLDRLPGYLPDSA-DTDH--------VLEIGGGTGALTDRLLDVADR----VTVIERDP
RSMA_HALWD      RVLDRIPTYLLDST-DTTH--------ILEIGAGTGALTDRLLAVGDT----VTVIERDA
RSMA_HALSA      RVLDRIPTYADGFD--RGH--------VLEIGAGTGALTDRLLSVADR----VTAVERDE
RSMA_HALS3      RVLDRIPTYADGFD--RGH--------VLEIGAGTGALTDRLLSVADR----VTAVERDE
RSMA_METHJ      RIVARIADILDISG---RI--------VLEIGPGEGILTEALLERGAR----VISVELDR
RSMA_METAC      GYLDRIVVAAELSP--QDT--------ILEIGAGIGNLTERLARRAKK----VIAVELDP
RSMA_METMA      GYLDRIVAAAELSP--QDT--------VLEIGAGIGNLTERLARRAKK----VIAVELDP
RSMA_METBF      GYLDRIVAAAELGP--KDV--------VLEIGAGVGNLTERLAKKVKK----VIAIELDP
RSMA_METBU      RSLDSIVDQAELSE--KDV--------VLEIGGGIGNLTERLLEKAGK----VYVIELDP
RSMA_ARCFU      RVISRIVGYAELSE--DDV--------VLEVGCGTGNLTSALLRKCS-----VVGIEKDP
RSMA_METTH      VKRQRILEYADLRE--DDR--------VLEIGPGIGTLTLPMAELAGH----VTAIESDP
RSMA_METST      NKLNIILENADIQD--NET--------ILEIGAGIGTLTLPMAKKAKK----VIAIEKDP
RSMA_PYRAB      DVIDKAIEVAEVSK--SDV--------VLEVGPGLGFLTDELSKRAKK----VFTIELDR
RSMA_PYRHO      DVIEKAIETANVNE--NDV--------ILEVGPGLGFLTDELAKRAKK----VYTIEIDQ
RSMA_PYRFU      DVIIKAVETSEIKK--SDV--------VLEVGPGFGFLTDELSKRAGK----VYAIELDK
RSMA_THEKO      DIIERNIERAEVGE--KDT--------VLEIGPGLGVLTDPLSKRAGK----VYAIEKDC
RSMA_THEGJ      DIIERNVKRAELSE--KDT--------VLEIGPGLGVLTDELSKKAGK----VYAIEADS
RSMA_THEON      DIIERNVERAELSG--RDV--------VLEIGPGLGVLTDALSKRAGK----VYAIEKDP
RSMA_THESM      DVIKREVERAEIKN--SET--------ILEIGPGLGVLTDELAKRAGK----VYAIEKDS
RSMA_METKA      NILEFMVEAAEVRE--DDI--------VLEIGPGPGLLTRYLMTRAGQ----VIAVELDG
RSMA_METM6      NFVKKAINRAEITD--KDI--------VLEVGLGEGALTKELAKLAKK----VYVIELDE
RSMA_METM7      NFVKKAINRAELTD--KDI--------VLEVGLGEGALTKELAKIAKK----VYVIELDE
RSMA_METMP      NFVKKAINRAEITN--NDI--------VLEVGLGEGALTKELAKIAKK----VYVIELDE
RSMA_METM5      NFVKKAINRAEITN--KDV--------VLELGLGEGALTKELAKIAKK----VYVIELDE
RSMA_METVS      NFVKKAIKSADITE--NDI--------VLEVGLGEGALTKELAKLAKF----VYVIELDM
RSMA_META3      NIVKKAINAANINK--NDI--------VLEIGLGKGILTKELAKQCKK----VIVIELDK
RSMA_METJA      NFVNKAVESANLTK--DDV--------VLEIGLGKGILTEELAKNAKK----VYVIEIDK
RSMA_PYRAE      SVAEYIAGLVPSGL----D--------VIEVGPGAGALTIPLAKRSKT----VYAIEIDK
RSMA_PYRIL      SVAQFITELVPSGL----D--------IIEVGPGRGALTLPLAEKSKT----IYAIEIDP
RSMA_RUBXD      NTAR--IVAAGLTE--RDV--------VLEIGPGRGFLTAFLAERAGL----VHAVEIDP
RSMA_NATTJ      NIIQKIIAAAELKE--QDI--------VLEIGPGLGTLTRDMSFYVNE----IFAIELDQ
RSMA_RHOBA      NLVELIARSAEIGP--SDI--------VLEIGTGVGSLTSIMASQAGA----ILTVEIDQ
RSMA_PAEAT      NTIRRIVAAAAIGD--DET--------VLEVGPGLGSLTLGLLDAAKA----VVAVEIDP
RSMA_ARTS2      NTIRRIVAAADIHA--DET--------VLEVGPGLGSLTLGLLDAAKS----VVAVEIDP
RSMA_STRAW      NTVRRIVRTAGVRP--DDV--------VVEVGPGLGSLTLALLEAADR----VIAVEIDD
RSMA_STRCO      NTVRRIVRTAEVRP--DDV--------VVEVGPGLGSLTLALLEAADR----VTAVEIDD
RSMA_STRGG      NTVRRIVRTAEVRP--DDT--------VVEVGPGLGSLTLALLEAADR----VVAVEIDD
RSMA_THEFY      GTVRRIVRAAQVSP--DDV--------VVEVGPGLGSLTLALLPHVRH----VTAVEIDP
RSMA_KINRD      NTVRRIVRVADLTP--EDV--------VVEVGPGLGSLTLALLEAVDR----VVAVEIDP
RSMA_LEIXX      NTVRRIVRVAGVEA--GEV--------VVEVGPGLGSLTLGLLEAGAR----VVAVEIDG
RSMA_CUTAK      NTVRRIVSLAQVGA--ADR--------VIEVGPGLGSLTLGLLETGAE----VVAIEIDE
RSMA_CORGL      NTVRRIVAAAELTP--DDH--------VVEVGPGLGSLTLALVESAAS----VTAVEIDP
RSMA_CORGB      NTVRRIVAAAELTP--DDH--------VVEVGPGLGSLTLALVESAAS----VTAVEIDP
RSMA_COREF      NTVRRIVTAADLTP--EDH--------VVEVGPGLGSLTLALVEKAAS----VTAVEIDP
RSMA_CORDI      NTVRMIVSAADLNS--DDH--------VIEVGPGLGSLTLALLDTAQK----VTAVEIDP
RSMA_CORJK      NTVRKIVKAADVTA--DDN--------VVEIGPGLGSLTLALLEAGAS----VTAVEIDP
RSMA_MYCA1      NTVRRVVSTSGVSR--SDH--------VLEVGPGLGSLTLALLDRGAH----VTAVEIDP
RSMA_MYCPA      NTVRRVVSTSGVSR--SDH--------VLEVGPGLGPLTLALLDRGAH----VTAVEIDP
RSMA_MYCLE      NTVRRVVSTSRVNR--SDF--------VLEVGPGFGSLTLALLDCGAA----VSAIEIDP
RSMA_MYCLB      NTVRRVVSTSRVNR--SDF--------VLEVGPGFGSLTLALLDCGAA----VSAIEIDP
RSMA_MYCTU      NTVRRVVAASGVSR--SDL--------VLEVGPGLGSLTLALLDRGAT----VTAVEIDP
RSMA_MYCTA      NTVRRVVAASGVSR--SDL--------VLEVGPGLGSLTLALLDRGAT----VTAVEIDP
RSMA_MYCBT      NTVRRVVAASGVSR--SDL--------VLEVGPGLGSLTLALLDRGAT----VTAVEIDP
RSMA_MYCBO      NTVRRVVAASGVSR--SDL--------VLEVGPGLGSLTLALLDRGAT----VTAVEIDP
RSMA_MYCBP      NTVRRVVAASGVSR--SDL--------VLEVGPGLGSLTLALLDRGAT----VTAVEIDP
RSMA_MYCGI      NTVRRIVSASSVNR--SDH--------VLEVGPGLGSLTLALLDRGAR----VTAVEIDP
RSMA_MYCVP      NTVRRIVSASSINR--SDH--------VLEVGPGLGSLTLALLDRGAK----VTAVEIDP
RSMA_MYCSJ      NTVRRIVSASGVHR--HDH--------VLEVGPGLGSLTLALLDRGAH----VTAVEIDP
RSMA_MYCSS      NTVRRIVSASGVHR--HDH--------VLKVGPGLGSLTLALLDRGAH----VTAVEIDP
RSMA_MYCSK      NTVRRIVSASGVHR--HDH--------VLEVGPGLGSLTLALLDRGAH----VTAVEIDP
RSMA_RHOOB      NTVRRIVATAGVGR--EDT--------VLEVGPGLGSLTLALLDVVDR----VIAVEIDP
RSMA_RHOJR      NTVRRIVATAGVGR--EDT--------VLEVGPGLGSLTLALLDVVDK----VIAVEIDP
RSMA_RHOE4      NTVRRIVTTAGVTR--DDV--------VLEVGPGLGSLTMALMDVVDR----VIAVEIDP
RSMA_NOCFA      NTVRRIVTAAGVGR--ADT--------VLEVGPGLGSLTLALLDVVDS----VVAVEIDP
RSMA_BIFLD      GTVRRIVREAGVTA--ANH--------VMEVGPGLGSLTLAILETGAT----MTAVEIDP
RSMA_BIFLS      GTVRRIVREAGVTA--ADH--------VMEVGPGLGSLTLAILETGAT----MTAVEIDP
RSMA_BIFLO      GTVRRIVREAGVTA--ADH--------VMEVGPGLGSLTLAILETGAT----MTAVEIDP
RSMA_BIFAA      GTVRRIVREAGVTA--DDH--------VLEVGPGLGSLTLAILETGAT----MTAVEIDP
RSMA_ACIC1      GVLRKIARYAELSS--EDI--------ALEIGPGFGSLTLVLLPLVRR----LLAVEIDR
RSMA_OPITP      NIVRKSLELAQVRR--GDA--------VVEIGPGLGTLTGALLEAGAE----VWAVEKDR
RSMA_DEIGD      NILRAIAQAGGAAP--GVP--------VLEVGPGLGVLTRELAARGAH----VTALEKDE
RSMA_DEIRA      NILRAIAEAGGAAP--GEN--------VLEIGPGLGVLTREVASRGAR----VTALEKDE
RSMA_THET2      VHLRRIVEAARPFT--G-P--------VFEVGPGLGALTRALLEAGAE----VTAIEKDL
RSMA_THET8      AHLRRIVEAARPFT--G-P--------VFEVGPGLGALTRALLEAGAE----VTAIEKDL
RSMA_CHLTR      NILRKILTTAEVQP--GDW--------VLEIGPGFGALSEVLLSQGAN----VIALEKDP
RSMA_CHLTA      NILRKILTTAEVQP--GDW--------VLEIGPGFGALSEVLLSQGAN----VIALEKDP
RSMA_CHLT2      NILRKILTTAEVQP--GDW--------VLEIGPGFGALSEVLLSQGAN----VIALEKDP
RSMA_CHLTB      NILRKILTTAEVQP--GDW--------VLEIGPGFGALSEVLLSQGAN----VIALEKDP
RSMA_CHLMU      NILRKILATADVQP--GDW--------VLEIGPGFGALSEVLVSQGAN----VIALEKDP
RSMA_CHLCV      NILRKILAVSCVEA--GDW--------VLEIGPGFGALTEVLVNQGAH----VVALEKDP
RSMA_CHLFF      NILRKILAVSCVEA--GDW--------VLEIGPGFGALTEVLVNQGAH----VVALEKDP
RSMA_CHLAB      NILRKILAVSCVQA--GDW--------VLEIGPGFGALTEVLVNQGAH----VVALEKDS
RSMA_CHLPN      NIVKKIVATSEVIP--QDW--------VLEIGPGFGALTEELIAAGAQ----VIAIEKDP
RSMA_PARUW      NIIRKIVRASDVQP--GNL--------VLEIGPGPGSLTQAMLEVEAH----VVAVEKDF
RSMA_ALKMQ      NILEDIVDGADIQP--DDC--------VIEIGPGIGTLTQFIAEKAHK----VVAIEIDR
RSMA_ALKOO      NILDNIVDGANVSE--GDC--------IIEVGPGIGSLTQNIAERADS----VLAVEIDK
RSMA_CLOD6      NIIDKILSGARITR--GDN--------IIEVGPGIGTLTREMGKIAEK----VVAIEIDR
RSMA_LACP7      HVLEKIIRSAEITK--DDL--------VLEIGPGIGTMTQYLCENARE----VVAVEIDK
RSMA_CLOPE      SVPRDIVNGADVCE--DDL--------VIEIGPGVGTLTVQLLKRAKR----VVAIELDS
RSMA_CLOP1      SVPRDIVNGADVCE--DDL--------VIEIGPGVGTLTVQLLKRAKR----VVAIELDS
RSMA_CLOPS      SVPRDIVNGADVCE--DDL--------VIEIGPGVGTLTVQLLKRAKR----VVAIELDS
RSMA_CLOAB      TVLDDIVENAEIQK--DDF--------IIEIGPGVGTLTRRLLEKAKK----VCAIELDE
RSMA_CLOB6      SVLEDIIEGAEINK--EDT--------VIEIGPGVGTLTKELLERAKE----VYSIELDG
RSMA_CLOBJ      SVLEDIIEGAEINK--EDT--------VIEIGPGVGTLTKELLERAKE----VYSIELDG
RSMA_CLOB1      SVLEDIIEGAEINK--EDT--------VIEIGPGVGTLTKELLERAKE----VYSIELDG
RSMA_CLOBL      SVLEDIIEGAEISK--EDT--------VIEIGPGVGTLTKELLERAKE----VYSIELDG
RSMA_CLOBK      SVLEDIIEGAEISK--EDT--------VIEIGPGVGTLTKELLERAKE----VYSIELDG
RSMA_CLOBM      SVLEDIIKGAEISK--EDT--------VIEIGPGVGTLTKELLERAKE----VYSIELDG
RSMA_HALOH      NIVDKIINTADLNN--EDI--------VIEIGPGIGSLTQKIVPRSGR----VFAFEKDK
RSMA_MOOTA      NIVRKIARAAEVGP--GDT--------VVEIGPGLGALTQELAARAGL----VIAIEIDR
RSMA_PELTS      NIIDKIIKAADLTP--ADL--------VVEIGPGLGALTARAAARAGK----VLAVEVDR
RSMA_SYMTH      RVLDGIVSAAGLEP--TDV--------VLEIGPGLGTLTQRLAAKAGR----VVCVELDR
RSMA_CALS4      NLLSKIVRASGVGE--EDF--------VLEVGTGHGGLTEELAKKVKK----VVSFEIDK
RSMA_DEHMB      GVLNKILAAADLKP--TDT--------VIEVGPGLGVLTEELLKRAGQ----VIAVEVDD
RSMA_DEHMC      GVLNKILAAADLKP--TDT--------VIEVGPGLGALTEELLKRAGQ----VIAVELDD
RSMA_DEHM1      GVLNKILLAADLKP--TDT--------VIEVGPGLGVLTEELIKRAGQ----VIAVELDD
RSMA_DESHD      RVIEAIAAASIKDP--EIP--------VVEIGPGLGVLTRVLAQKAQK----VWAVELDR
RSMA_DESHY      RVIEAIAAASIKDP--EIP--------VVEIGPGLGVLTRVLAQKAQK----VWAVELDR
RSMA_GEOKA      NILRKIVDVADISP--DTG--------AIEIGPGIGALTEQLARRAKK----VVAFEIDG
RSMA_GEOTN      NILRKIVDAAGISG--DTG--------AIEIGPGIGALTEQLARRAKK----VVAFEIDS
RSMA_GEOSW      NILRKIVDFAELSD--ETG--------AIEIGPGIGALTEQLARRAKK----VVAFEIDQ
RSMA_ANOFW      NILHRIVDFAQLSE--RTG--------VIEIGPGIGALTEQLARRAKK----VVAFEIDQ
RSMA_BACLD      NILDRIVDHAGVTE--RTG--------VIEIGPGIGALTEQLAKRAKK----VTAFEIDQ
RSMA_BACSU      NILNRIVDHAEVTE--KTG--------VIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACP2      NILDRIVDHAEVTD--ETG--------VIEIGPGIGALTEQLAKRAKK----VTAFEIDQ
RSMA_BACAN      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACAA      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACHK      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACCZ      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACAC      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACC7      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACC0      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACC1      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACCQ      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACCR      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACC4      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACC2      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACC3      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACAH      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACMK      NVLNRIVDHAEIGS--ESG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACCN      NVLNRIVDYAEIGP--KGG--------AIEIGPGIGALTEQLAKRAKK----VVAFEIDQ
RSMA_BACHD      NVLRNIVDVASLTP--QSG--------AIEIGPGIGALTEQLARQAKR----VVAFEIDQ
RSMA_LYSSC      NILRNIVSHAKLTE--NSG--------AIEVGPGIGALTEHLARSAKK----VVSFEIDQ
RSMA_BACSK      NILAKIVEASGFDE--QDG--------IVEIGPGIGALTEQLAKKADK----VVAFEIDG
RSMA_OCEIH      SVLQNIIRHAGITK--DTA--------AIEIGPGIGALTEQLAIHADQ----VVAFEIDQ
RSMA_LISMC      NILTRITDTAEITK--ETN--------VIEIGPGIGALTEQLAKTANE----VVAFEIDQ
RSMA_LISMF      NILTRITDTAEITK--ETN--------VIEIGPGIGALTEQLAKTANE----VVAFEIDQ
RSMA_LISMO      NILTRITDTAEITK--ETN--------VIEIGPGIGALTEQLAKTANE----VVAFEIDQ
RSMA_LISMH      NILTRITDTAEITK--ETN--------VIEIGPGIGALTEQLAKTANE----VVAFEIDQ
RSMA_LISIN      NILTRITDTAEITK--ETN--------VIEIGPGIGALTEQLAKTANE----VVAFEIDQ
RSMA_LISW6      NILTRITDTAGISK--ETN--------VIEIGPGIGALTEQLAKTANE----VVAFEIDQ
RSMA_STAAT      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAA3      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAC      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAA2      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAA9      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAS      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAA1      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAM      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAW      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAN      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAA8      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAB      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAE      NIINNIIDASDIDA--QTG--------VIEIGPGIGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAAR      NIINNIIDASDIDA--QTG--------VIEIGPGMGSLTEQLARHAKR----VLAFEIDQ
RSMA_STAES      NIINKIIEASHIDC--TTG--------VIEVGPGMGSLTEQLAKNAKK----VMAFEIDQ
RSMA_STAEQ      NIINKIIEASHIDC--TTG--------VIEVGPGMGSLTEQLAKNAKK----VMAFEIDQ
RSMA_STAHJ      NIIHKIIDASEIDD--NTG--------IIEVGPGMGSLTEQLAKRAKK----VMSFEIDQ
RSMA_STACT      NIIQKIIDASNIDE--RTG--------VIEVGPGMGSLTEQLAKHAKK----VVAFEIDQ
RSMA_STAS1      NIIHNIIDASDIDE--QTG--------IIEVGPGMGSLTEQLAKSAKK----VMAFEIDQ
RSMA_MACCJ      NVIRNIIEAAGIDK--TSG--------VIEIGPGMGSLTEQLAKHAKQ----VLAFEIDQ
RSMA_STRA1      NILQKIVDTAEIDK--GVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRA5      NILQKIVDTAEIDK--GVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRA3      NILQKIVDTAEIDK--GVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRMU      NILQKIVDTAEIDK--TVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRS7      NILQKIVDTAEIDK--SVN--------VIEIGPGIGALTEFLAERAAE----VMAFEIDE
RSMA_STREM      NILQKIVDTAEIDK--SVN--------VIEIGPGIGALTEFLAERAAE----VMAFEIDE
RSMA_STRE4      NILQKIVDTAEIDK--SVN--------VIEIGPGIGALTEFLAERAAE----VMAFEIDE
RSMA_STRPB      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRPC      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRP1      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRPF      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRPD      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRPM      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRP8      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRPG      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRP6      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRP3      NILQKIVDTAEIDQ--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRU0      NILQKIVDTAEIDR--SVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRT2      NILQKIVDTAEINK--NVN--------VIEIGPGIGALTEFLAENASE----VMAFEIDE
RSMA_STRTD      NILQKIVNTAEINK--NVN--------VIEIGPGIGALTEFLAENASE----VMAFEIDE
RSMA_STRT1      NILQKIVDTAEINK--NVN--------VIEIGPGIGALTEFLAENASE----VMAFEIDE
RSMA_STRGC      NILQKIVDTAEIDK--NVN--------VIEIGPGIGALTEFLAENAAE----VMAFEIDD
RSMA_STRSV      NILQKIVDTAEIDK--KVN--------VIEIGPGIGALTEFLAESAAE----VMAFEIDD
RSMA_STRPN      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRZT      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRPJ      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRP7      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRZJ      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRPI      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRP4      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRR6      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRP2      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMAFEIDH
RSMA_STRPS      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAQ----VMTFEIDH
RSMA_STRZP      NILQKIVDTAEIDD--QVN--------VIEIGPGIGALTEFLAERAAE----VMAFEIDH
RSMA_LACLA      NILTKITQTAELSK--EVN--------VIEIGPGIGSLTQYLLEEAAE----VMAFEIDK
RSMA_ENTFA      NILRKIVETAGINQ--QTN--------VVEVGPGIGALTEQLAMNAAQ----VVAFEIDD
RSMA_LACSS      TILKQIVEAGEITK--DDD--------VIEIGPGIGSLTEQIARKAHQ----VLSFEIDD
RSMA_LACPL      NVLHNIVATADIGT--NDN--------VIEIGPGIGALTEYLARAAHH----VLAFEIDD
RSMA_LACS1      NILKNIVAAAEVSE--EDN--------VIEIGPGIGALTEQLAKRANK----VMALEIDD
RSMA_LACBA      NILRNIVAAGDVND--HDN--------VIEIGPGIGALTEQIAKRAHK----VVAFEIDE
RSMA_PEDPA      NVLLNIVDAAEVSP--EDD--------VIEVGPGIGSLTEQIAKRAHH----VLAFEIDR
RSMA_LACRD      NVLKNIVEAADITA--NDN--------VIEIGPGIGALTEQLAQAAGE----VLALEIDQ
RSMA_LACRJ      NVLKNIVEAADITA--NDN--------VIEIGPGIGALTEQLAQAAGE----VLALEIDQ
RSMA_LEUCK      NVLHGIVDVAGITS--EDY--------VIEIGPGIGALTEQLARSAKK----VVAFEIDP
RSMA_LEUMM      NVLHNIVEAAEITA--EDY--------VIEIGPGIGALTEQLARSAKK----VLAFEIDS
RSMA_OENOB      NVLQEIVQGAAIGP--DDT--------VIEIGPGIGSLTEQLAKAAKQ----VVAYEIDK
RSMA_LACAC      DAILGIVEAADIQP--GDQ--------VIEIGPGIGSLTEQLLLAGAK----VFAYEVDD
RSMA_LACH4      NAILGIVEAADIHA--GDQ--------VIEIGPGIGSLTEQLLLAGAK----VFAYEVDD
RSMA_LACJO      PAIKGIVEAADIQP--GDQ--------VIEIGPGIGSLTEQLLLAGAK----VLAYEVDQ
RSMA_LACDA      DAVQGIVRAAGIEP--GDQ--------VVEVGPGIGSLTEQLLLAGGK----VAAYEVDQ
RSMA_LACDB      DAVQGIVRAAGIEP--GDQ--------VVEVGPGIGSLTEQLLLAGGK----VAAYEVDQ
RSMA_CARHZ      GILAKIVEKAEITK--DDA--------VLEIGPGAGVLTRLLAQAAKY----VVAIEIDK
RSMA_ACIF2      QIVERIVAAIRPAS--GDH--------LVEIGPGPGALTKSLLRLLPQ----FTVVELDR
RSMA_ACIF5      QIVERIVAAIRPAS--GDH--------LVEIGPGPGALTKSLLRLLPQ----FTVVELDR
RSMA_HALHL      AVIQRMVTAIAPRE--GET--------LLEIGPGEGALTEPLLARLGT----LTAVELDR
RSMA_ACISJ      GIIDAIVRAIAPEP--GQP--------MVEIGPGLAALTQPLVERLGR----LTVVELDR
RSMA_ACIET      GIIDAIVRAIAPEP--GQP--------MVEIGPGLAALTQPLVERLGR----LTVVELDR
RSMA_ACIAC      AIIDAIVRAIAPAP--GQP--------MVEIGPGLAALTQPLVERLGR----LTVVELDR
RSMA_POLSJ      GIIEGIVQAIAPRA--GQA--------VVEIGPGLAALTQPLVERLGH----LTVIELDR
RSMA_POLNA      LIIEGIVEAIAPLP--GQP--------MVEIGPGLAAMTRPLVERLGH----LTVIELDR
RSMA_RHOFT      AMIEAIVDAIGPRP--GQA--------MVEIGPGLAALTQPLVERLGQ----LTVIELDR
RSMA_VARPS      GIIDAIVQEIAPQP--GDA--------MVEIGPGLAALTQPLVERLGR----LTVIELDR
RSMA_VEREI      RIIDAIVQAIAPQP--GQP--------MVEIGPGLAALTQPLVERLGR----LTVIELDR
RSMA_LEPCP      SVLDRIVQLIDPQP--GEA--------LVEIGPGLGAMTDPVVERCKR----LTVVELDR
RSMA_METPP      AVVDAIVGLIDPRP--GQA--------LVEIGPGLGAMTDPLVARCEH----LTVVELDR
RSMA_BURCM      GVIDSIVTTIGPAR--GQR--------MVEIGPGLGALTEPLIARLATPESPLHAVELDR
RSMA_BURA4      GVIDSIVTTIGPAR--GQR--------MVEIGPGLGALTEPLIARLATPESPLHAVELDR
RSMA_BURCA      GVIDSIVATIGPAR--GQR--------MVEIGPGLGALTGPLIERLATPESPLHAVELDR
RSMA_BURCH      GVIDSIVATIGPAR--GQR--------MVEIGPGLGALTGPLIERLATPESPLHAVELDR
RSMA_BURCC      GVIDSIVATIGPAR--GQR--------MVEIGPGLGALTGPLIERLATPESPLHAVELDR
RSMA_BURCJ      GVIDSIVATIGPAR--GQR--------MVEIGPGLGALTEPLIERLATPESPLHAVELDR
RSMA_BURL3      GVIDSIVSTIGPAR--GQR--------MVEIGPGLGALTEPLIERLATPESPLHAVELDR
RSMA_BURM1      GVIDSIVATIAPAR--GQR--------MVEIGPGLGALTEPLIARLATPETPLHAVELDR
RSMA_BURVG      GVIDSIVATIGPVR--GQR--------MVEIGPGLGALTEPLIARVATPESPLHAVELDR
RSMA_BURMA      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURPS      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURM9      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURM7      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURMS      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURP1      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURP0      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURP6      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPGSPLHAVELDR
RSMA_BURTA      GVIDAIVAAIRPER--GER--------MVEIGPGLGALTGPVIARLATPDSPLHAVELDR
RSMA_PARPJ      GVIDSIVDVIRPQR--GER--------MVEIGPGLGALTEPLIERLATPEAPLHAVELDR
RSMA_PARXL      GVIDSIVDVIRPQR--GER--------MVEIGPGLGALTEPLIERLATPEAPLHAVELDR
RSMA_PARP8      GIIDSIVDVIRPQR--GER--------MVEIGPGLGALTEPLVERLATPEAPLHAVELDR
RSMA_CUPTR      TIIHGIVNAISPQA--GDV--------LVEIGPGLGALTDPLLERIPQ----MQVVELDR
RSMA_CUPNH      TIIHGIVNAISPQA--DDV--------LVEIGPGLGALTDPLLERIPQ----MQVVELDR
RSMA_CUPPJ      SIIHGIVNAINPLA--DDV--------LVEIGPGLGALTDPLLERVPQ----MQVVELDR
RSMA_CUPMC      GIIHGIVSAIDPQP--NDI--------VVEIGPGLGALTDPLLERLPG----MQVVELDR
RSMA_RALSO      GVIHAIVAAIDPQP--DDV--------LVEIGPGLGALTVPLMERVPT----LQVVELDR
RSMA_BURSP      AVIDAIVSAIAPAP--QDC--------LVEIGPGLGALTWPLLERLGGAGR-LHAIEMDR
RSMA_BORBR      SVVESIVRAIGPAR--DDR--------VVEIGPGLSALTRPLLDRIDH----LTAVEIDR
RSMA_BORPE      SVVESIVRAIGPAR--DDR--------VVEIGPGLSALTRPLLDRIDH----LTAVEIDR
RSMA_BORPA      SVVESIVRAIGPAR--DDR--------VVEIGPGLSALTRPLLDRIDH----LTAVEIDR
RSMA_BORA1      SVIDAIVRAIAPAR--DDA--------IVEIGPGLSALTAPLIARLNR----LSVVEIDR
RSMA_BORPD      SVVEAIVRAIAPAR--GDR--------VVEIGPGLSALTQPLLRGLDH----LTVVEIDR
RSMA_HERAR      GVLHNIILAIDPQP--QDT--------MVEIGPGLAAMTRLLLDGVNQ----MHVVELDR
RSMA_JANMA      TVLYNIIRAIDPQP--QDT--------MVEIGPGLAAMTRLLLEGVQQ----MHVVELDR
RSMA_AROAE      NIIRKIIDAIHPVP--GET--------VVEIGPGLGAMTDPLVERLGH----LHVVEIDR
RSMA_THIDA      GIVHAIVNAIHPQA--GET--------VVEIGPGLGALTRPLLERLPH----LHAVELDR
RSMA_METFK      AIINSLIDAIAPQP--QDC--------MVEIGPGLGAMTQPLLERLQH----LHVVEIDR
RSMA_CHRVO      SVIAGIVHAVNPQP--DDI--------VIEIGPGLGAITKPLLARLKH----LHVVEIDR
RSMA_LARHH      FIIHSIVAAVDARP--GDV--------VVEIGPGLGALTRPLLRALPQ----LHVVEIDR
RSMA_NEIG1      RIIGDIVNAVRPQA--DDV--------VIEIGPGLAAITEPLAKKLNR----LHVVEIDR
RSMA_NEIG2      RIIGDIVNAVRPQA--DDV--------VIEIGPGLAAITEPLAKKLNR----LHVVEIDR
RSMA_NEIMA      RIISDIVNAVRPQA--DDV--------VIEIGPGLAAITEPLAKKLNR----LHVVEIDR
RSMA_NEIM0      RIISDIVNAVRPQA--DDV--------VIEIGPGLAAITEPLAKKLNR----LHVVEIDR
RSMA_NEIMB      RIISDIVNAVRPQA--DDV--------VIEIGPGLAAITEPLAKKLNR----LHVVEIDR
RSMA_NEIMF      RIISDIVNAVRPQA--DDV--------VIEIGPGLAAITEPLAKKLNR----LHVVEIDR
RSMA_DECAR      GIIAAIISAVDPKR--DET--------VVEIGPGLGAITEPLMARVDH----LHVIEIDR
RSMA_NITEU      SVIAEIIHIIHPVP--GDR--------MIEIGPGLGALTKPLLNVLDE----LQVIEIDR
RSMA_NITEC      HIIAEIIHIICPLP--GDR--------MIEIGPGLGALTQPLLNNLDT----LQAIELDR
RSMA_NITMU      QTVTDIVHALHPRR--EDV--------MVEIGPGLGALTQPLLQSLEH----LHVVEIDR
RSMA_PSYA2      SVIREIVESIRLER--DDN--------LIEIGPGMGALTEPLLAEVDA----MTVVELDR
RSMA_PSYCK      SVIREIVESIRLER--DDN--------LIEIGPGMGALTEPLLAEVDA----MTVVELDR
RSMA_ACIAD      RVIAKIVRSVNPRP--GDN--------VVEIGPGLAALTSPLIGECDA----LTVVELDR
RSMA_COXBU      FVLQKIVSAIHPQK--TDT--------LVEIGPGRGALTDYLLTECDN----LALVEIDR
RSMA_COXB2      FVLQKIVSAIHPQK--TDT--------LVEIGPGRGALTDYLLTECDN----LALVEIDR
RSMA_COXBR      FVLQKIVSAIHPQK--TDT--------LVEIGPGRGALTDYLLTECDN----LALVEIDR
RSMA_COXBN      FVLQKIVSAIHPQK--TDT--------LVEIGPGRGALTDYLLTECDN----LALVEIDG
RSMA_COXB1      FVLQKIVSAIHPQK--TDT--------LVEIGPGRGALTDYLLTECDN----LALVEIDR
RSMA_ALCBS      NLVDRMIRTLGLQT--GDT--------LVEIGPGRGALTYPLLEELPH----LHVVELDR
RSMA_HAHCH      GVIDRIVRSINPKS--DQN--------LVEIGPGLGALTEELLKSGGS----VTAVELDR
RSMA_MARHV      GVIERIVRAINPKP--EDS--------IVEIGPGLGAITEEILAINPR----LQVVELDR
RSMA_MARMS      GVIRRIVACIGPKK--GQR--------IVEIGPGKGALTEGIISVTER----MDVVELDR
RSMA_PSEF5      GVIDRILRSIHAKP--EDR--------MLEIGPGQGALTEGLLGSGAQ----LDVVELDK
RSMA_PSEPF      GVIDRILRSINAKA--GDR--------MLEIGPGQGALTAGILNSGAQ----LDVVELDK
RSMA_PSE14      GVIDKILRAIRAKP--EDR--------LLEIGPGQGALTEGLLNSGAQ----LDVVELDK
RSMA_PSESM      GVIDKILRAIRAKP--EDR--------LLEIGPGQGALTEGLLNSGAQ----LDVVELDK
RSMA_PSEU2      GVIDKILRAIRARP--EDR--------LLEIGPGQGALTEGLLDSGAQ----LDVVELDK
RSMA_PSEPK      GIIDRILRAINAKA--GEH--------LLEIGPGQGALTEGLLGSGAQ----LDVVELDK
RSMA_PSEAE      GVIHRILRAIHARE--GQR--------LLEIGPGQGALTEGLLGSGAR----LDVIELDQ
RSMA_CHRSD      GVIDRIVRVIAPRS--DQR--------LIEIGPGQGALTEPLLDAVGA----LEVIELDR
RSMA_SACD2      GIINAIVRSIGPKA--SDN--------LVEIGPGKGAITAQLIESCPS----MQVVELDR
RSMA_METCA      GVIQEIVAAVGPAP--SDR--------LVEIGPGEGVLTRELLQSGAC----LEAIELDR
RSMA_LEGPC      YIINEILRAINPLA--DDN--------MLEIGPGLGALTQPLLQKLNR----LTAIEIDT
RSMA_LEGPA      YIINEILRAINPLA--DDN--------MLEIGPGLGALTQPLLQKLNR----LTAIEIDT
RSMA_LEGPL      YIINEILRAINPLA--DDN--------MLEIGPGLGALTQPLLQKLNR----LTAIEIDT
RSMA_LEGPH      YIINEILRAINPLA--DDN--------MLEIGPGLGALTQPLLQKLNQ----LTAIEIDT
RSMA_NITOC      GVIERLLRAINPQL--NDL--------MVEIGPGQGALTLPLLHCLGH----LEAIELDR
RSMA_HYDCU      RIIQQIVAAIAPKP--DQH--------LVEIGPGEAALTGPLLDIVKK----LDIIEIDN
RSMA_XANAC      YYIDRIVQAVDPRA--GQH--------LVEIGPGQGAITFPLLRKHGA----LTVIEFDR
RSMA_XANC5      YYIDRIVQAVDPRA--GQH--------LVEIGPGQGAITFPLLRRHGA----LTVIEFDR
RSMA_XANOR      YYIDRIVQAVDPRA--GQH--------LVEIGPGQGAITFPLLRKHGA----LTVIEFDR
RSMA_XANOM      YYIDRIVQAVDPRA--GQH--------LVEIGPGQGAITFPLLRKHGA----LTVIEFDR
RSMA_XANOP      YYIDRIVQAVDPRA--GQH--------LVEIGPGQGAITFPLLRKHGA----LTVIEFDR
RSMA_XANCP      YYIDRIVQAVDPRP--GQH--------LVEIGPGQGAITFPLLRKHGA----LTVIEFDR
RSMA_XANC8      YYIDRIVQAVDPRP--GQH--------LVEIGPGQGAITFPLLRKHGA----LTVIEFDR
RSMA_XANCB      YYIDRIVQAVDPRP--GQH--------LVEIGPGQGAITFPLLRKHGA----LTVIEFDR
RSMA_XYLFA      YYIDRIIHAITPQP--NDH--------IVEIGPGQGAITLPLLKCCGS----LTAIELDR
RSMA_XYLFT      YYIDRIIHAINPQP--NDH--------IVEIGPGQGAITLPLLKCCGS----LTAIELDR
RSMA_DICNV      GIITQLLAAIDPKP--QQK--------ILEIGPGLGALTLPVLERCHE----LYAVELDH
RSMA_ACTP2      NVIHNIVSAINPKN--GQF--------LLEIGPGLGALTEPVAEQVDK----LTVVELDR
RSMA_ACTP7      NVIHNIVSAINPKN--GQF--------LLEIGPGLGALTEPVAEQVDK----LTVVELDR
RSMA_ACTPJ      NVIHNIVSAINPKN--GQF--------LFEIGPGLGALTEPVAEQVDK----LTVVELDR
RSMA_HAEDU      NVIHNIVAAINPRN--EDF--------LLEIGPGLGALTEPVAEQVEK----LTVIELDR
RSMA_HAEIE      SVIQGIVAAIYPQP--NQF--------LVEIGPGLGALTEPVGELVDH----LTVVELDR
RSMA_HAEIG      SVIQGIVAAIYPQP--NQF--------LVEIGPGLGALTEPVGELVDH----LTVVELDR
RSMA_HAEIN      SVIQGIVAAIYPQP--NQF--------LVEIGPGLGALTEPVGELVDH----LTVVELDR
RSMA_HAEI8      SVIQGIVAAIYPQP--NQF--------LVEIGPGLGALTEPVGELVDH----LTVVELDR
RSMA_PASMU      NVIHGIVSAIYPQK--DQF--------LVEIGPGLGALTEPVGELVDH----LTVVELDR
RSMA_MANSM      NVIQGIVAAIYPQK--GQF--------LVEIGPGLGALTEPVADQTDR----LTVVELDR
RSMA_HAES1      NIIQNIVMAIYPQK--EQF--------LVEIGPGLGALTEPVAEKVER----LTVIELDR
RSMA_HISS2      NIIQNIVMAIYPQK--EQF--------LVEIGPGLGALTEPVAEKVER----LTVIELDR
RSMA_PSYIN      YIIDSIVGAIAPQW--EDN--------IVEIGPGLGALTEPVASKVKC----LNVIELDR
RSMA_AERHH      YVIDQIVAAINPQP--GQN--------LVEIGPGLAALTEPVASQMDK----MTVVELDR
RSMA_TOLAT      YTIDSIVSAIAPRQ--NDV--------MVEIGPGLGALTEPVCDQIDK----LHVVELDR
RSMA_ALIF1      YVIDGIVSAINPLP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_ALIFM      YVIDGIVSAINPLP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_ALISL      YVIDGIVSAINPLP--GQN--------LVEIGPGLGAITEPVGREIDK----FTVIELDR
RSMA_VIBA3      YIIDGIVSSINPLP--GQN--------LVEIGPGLGAITEPVGKLVDK----FTVIELDR
RSMA_VIBCH      YIIDGIVSAINPKP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_VIBC3      YIIDGIVSAINPKP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_VIBCB      YIIDGIVSAINPRP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_VIBPA      YIIDGIVSAINPKP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_VIBVU      YIIDGIVSAINPRP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_VIBVY      YIIDGIVSAINPRP--GQN--------LVEIGPGLGAITEPVGREVDK----FTVIELDR
RSMA_PHOPR      YIIDGIVSSINPLP--GQN--------LVEIGPGLGALTEPVGRLVDK----FSVIELDR
RSMA_SHEB5      NVIDRIVGAISPDN--HHV--------MVEIGPGLGALTEPVAEAVDN----LTVVELDR
RSMA_SHEB2      NVIDRIVGAISPDN--HHV--------MVEIGPGLGALTEPVAEAVDN----LTVVELDR
RSMA_SHEB8      NVIDRIVGAIAPDN--HHV--------MVEIGPGLGALTEPVAEAVDN----LTVVELDR
RSMA_SHEB9      NVIDRIVGAIAPDN--HHV--------MVEIGPGLGALTEPVAEAVDN----LTVVELDR
RSMA_SHEPC      NVINRIVGAIAPDN--NHV--------MVEIGPGLGALTEPVAMAVDN----LTVVELDR
RSMA_SHESW      NVINRIVGAIAPDN--NHV--------MVEIGPGLGALTEPVAMAVDN----LTVVELDR
RSMA_SHESM      NVINRIVGAIAPDN--DHV--------MVEIGPGLGALTEPVATAIDN----LTVVELDR
RSMA_SHESR      NVINRIVGAIAPDN--DHV--------MVEIGPGLGALTEPVATAIDN----LTVVELDR
RSMA_SHESA      NVINRIVGAIVPDN--DHV--------MVEIGPGLGALTEPVATAIDN----LTVVELDR
RSMA_SHEON      NVINRIVGAIAPDN--DHV--------MVEIGPGLGALTEPVATAIDN----LTVVELDR
RSMA_SHEDO      SIISRIVGAISPDN--DHV--------MVEIGPGLGAITEPVAMSIDK----LSVVELDR
RSMA_SHEFN      GVISSIVGAIAPDN--DHV--------MVEIGPGLGALTEPVADMIDN----LTVVELDR
RSMA_SHEHH      NVINRIVGAISPDN--DHV--------MVEIGPGLAALTEPVASGIDK----LIVVELDK
RSMA_SHEPA      NVINRIVGAISPDN--DHV--------MVEIGPGLAALTEPVASGIDK----LIVVELDK
RSMA_SHEPW      NVINRIVGAISPDN--EHV--------MVEIGPGLAALTEPVASGIDK----LTVVELDK
RSMA_SHESH      NVINRIVGAIAPDN--DHV--------MVEIGPGLGALTEPVANGIDK----LTVVELDK
RSMA_SHEWM      NVINRIVGAISPDN--DHV--------MVEIGPGLAALTEPVANAIDK----LTVVELDK
RSMA_SHELP      NVINRIVGAISPDN--DHV--------MVEIGPGLAALTEPVAESIDK----LTVVELDK
RSMA_SHEAM      NIINRIVGAISPDD--DHV--------MVEIGPGLAALTEPVAMGIKN----LTVIELDR
RSMA_PSET1      MIIGKIVSAIDPKP--EDN--------LVEIGPGLGAITEPVAELSGH----LTVVELDK
RSMA_COLP3      AVISDIVDAINPEP--GEN--------LIEIGPGLGALTEPVIERAGK----LSVVELDR
RSMA_IDILO      YIIEQIVDAINPLP--GEN--------LIEIGPGLAALTEPTVDRSGH----LKVIEIDR
RSMA_SALA4      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALDC      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALEP      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALG2      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALHS      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALPA      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALPK      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALPB      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALPC      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALTI      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALTY      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALAR      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALNS      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALCH      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_SALSV      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_CITK8      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_KLEP3      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_KLEP7      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOUT      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO27      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOK1      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO45      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOL6      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOL5      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO81      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO55      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOLC      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOHS      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_SHIBS      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOBW      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECODH      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOLI      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOSM      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO7I      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO8A      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_SHIF8      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_SHISS      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_SHIB3      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECOSE      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO57      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO5E      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_SHIFL      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ESCF3      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_SHIDS      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ECO24      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_ECOLU      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDK----LTVIELDR
RSMA_CROS8      FVIDSIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDQ----LTVIELDR
RSMA_ENT38      FVIESIVSAINPQK--GQA--------MVEIGPGLAALTEPVGERLDE----MTVIELDR
RSMA_PECAS      FVIDSIVSAIHPQP--GQA--------VVEIGPGLGALTAPIGERMDR----FTVIELDR
RSMA_PECCP      FVIDSIVSAIHPQP--GQA--------VVEIGPGLGALTAPVGERMDR----FTVIELDR
RSMA_YERPE      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERPP      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERPN      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERPG      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERPA      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERPS      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERPB      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERP3      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERPY      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_YERE8      FVIDSIVSAIHPVP--GEA--------VVEIGPGLGALTEPVAARMDH----MTVIELDR
RSMA_SERP5      FVIDSIVSAIHPMP--GEA--------VVEIGPGLGALTEPVGARMDR----MTVIELDR
RSMA_PHOLL      FVIDSIAAAINPQP--GQA--------VLEIGPGLGALTEPVGERMDK----MTVVELDR
RSMA_ERWT9      YIIDSIVNAIHPQR--GEA--------VVEIGPGLGALTEPVGERLDN----MTVVELDR
RSMA_SODGM      SIIDAIVAAIHPQP--GQA--------IVEIGPGLGALTEPVAERVDE----MTVIELDR
RSMA_PROMH      YIIESIVESIYPQP--GEA--------VIEIGPGLGALTEPVGERMDK----MTVVEIDR
RSMA_HAMD5      FVIDQIISSIHPSP--EQT--------LIEIGPGLGALTLPLADQMDK----ILVIELDR
RSMA_BAUCH      NIIESIVAVIHPLP--SQA--------LVEIGPGLGALTKYVAKYVKT----ITVIELDH
RSMA_BLOFL      NIIHSIISILNLKK--YQN--------VIEIGPGLGALTKPISDIIDF----LILIERDP
RSMA_BLOPB      NVIDTIVKTINPKK--HQK--------ILEIGPGLGALTKQILNIADLDS--LILIERDS
RSMA_BUCAI      DTIKNIIKIIDPKT--TET--------LVEIGPGLAALTKPMCELLEE----LIVIEIDQ
RSMA_BUCAP      NLIKKIVKFINPQL--KQT--------LVEIGPGLGALTKPICNIVDE----LIVIEIDL
RSMA_BUCBP      EVINRIINVINPKS--HDF--------MIEIGPGLGALTYPICKILHK----LFVIEHDN
RSMA_WIGBR      KIIKKIINFINPKY--KDK--------IIEIGPGLGALTIPISKISKS----ITAIEIDK
RSMA_FRATF      NIIRKIVQLANIKK--HDI--------VVEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRATH      NIIRKIVQLANIKK--HDI--------VVEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRATO      NIIRKIVQLANIKK--HDI--------VVEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRATM      NIIRKIVQLANIKK--HDI--------VVEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRATW      NIIRKIVQLANIKK--HDI--------VVEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRATT      NIIRKIVQLANIKK--HDI--------VVEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRAT1      NIIRKIVQLANIKK--HDI--------VVEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRATN      NIIRKIVQLANIKK--HDI--------VIEIGPGLGALTRYLLSSSNN----VSVVEFDA
RSMA_FRAP2      NIIRKIVQLANIKK--DDI--------VLEIGPGLGALTRYILKCSDN----VNVVEFDA
RSMA_BACFR      KVAQDIADTVDTFP--DLP--------ILEVGPGMGVLTQFLV-KKERL---VKVVEVDY
RSMA_BACFN      KVAQDIADTVDTFP--DLP--------ILEVGPGMGVLTQFLV-KKERL---VKVVEVDY
RSMA_BACTN      KVAQDIADTVDTFP--ELP--------VLEVGPGMGVLTQFLV-KKDRL---VKVVEVDY
RSMA_BACV8      SIAKDIADTVDVCP--DLP--------ILEVGPGMGVLTQFIM-QKNRP---VKVVELDY
RSMA_PARD8      QIAQRIADTLDTFK--SLP--------VLEIGPGMGVLTQFLL-EAGHD---LTVVELDM
RSMA_PORGI      SIAERIADTLSEHK--ALP--------VLEIGPGMGVLTQFLL-RKGHD---VRVIEIDG
RSMA_PORG3      SIAERIADTLSEHK--ALP--------VLEIGPGMGVLTQFLL-RKGHD---VRVIEIDG
RSMA_FLAJ1      SIAKAIADTLSLKG--YDE--------VLEIGPGMGVLTKYLL-DKPVN---TRVIEIDT
RSMA_FLAPJ      SIAKDIADTLNLEG--YDN--------VLEIGPGMGVLTKYLL-AKEVT---TYVIEIDT
RSMA_CYTH3      QIAQDIVDGLTLHGS-YKE--------VLEIGPGMGVLTQYLLKNNSYH---TKVVDIDG
RSMA_CHLP8      NIPRKIVRESGIKE--GDL--------VLEIGPGFGALSTAILEVMPS----FTAIEKDP
RSMA_CHLTE      NIPRKIVRESGIKE--GDR--------VVEIGPGFGALTTAILEVMPS----FTAIEKDR
RSMA_CHLPB      NICRKIVESAQLQE--NDH--------VLEIGPGFGALTTAILEVVPR----FTAVEKDR
RSMA_PROA2      NTIRKIVQSAEIQP--GDH--------VVEIGPGFGALTSAILEVCPS----FTAVEKDR
RSMA_CHLL2      NITRKIVRLSGAKP--EEN--------ILEIGPGFGALTKEIIEVCPS----FTVVEKDP
RSMA_CHLPD      NITRKIVTESETNP--DDT--------ILEIGPGFGALTREISTITPR----FTVVEKDP
RSMA_PELLD      NITRKIVAASGAGS--QDR--------ILEIGPGFGALTREILEVCPA----FTVVEKDR
RSMA_CHLCH      NITRKTVLLSGAKP--DDQ--------VVEIGPGFGALTRELVEECHN----LTVIEKDP
RSMA_SALRD      NMAEKIVGTLTAPP--EAH--------VVEVGAGTGVLTERLAERHDR----LTALEIDE
RSMA_ANAD2      AVLDDIARLAAPRA--GDA--------VLELGAGLGHLTARLLARGAR----VAAVERDR
RSMA_ANASK      AVLDDIARLAAPRA--GDA--------VLELGAGLGHLTARLLARGAR----VAAVERDR
RSMA_ANADE      AVLDDIARLAAPRA--GDP--------VLELGAGLGHLTARLLARGAR----VVAVERDR
RSMA_MYXXD      DALEAIADALNLRA--DEP--------VVELGPGLGHLTRFLAATGAR----VTAVERDR
RSMA_GEOMG      HVLARIADIVDMRP--DDR--------ILEVGPGKGALTEMLAHRCAR----LVAVELDT
RSMA_GEOSL      SVLSRIAALVSAGA--GER--------ILEIGPGKGALTSYLAEQAGQ----LVAVELDD
RSMA_PELCD      QVVDGIFAAADLQP--EDR--------VLEIGPGLGALTDRLLPEVAR----LHVIEIDR
RSMA_MAGMM      SVAPRIVALAGIKA--GDR--------VLEIGPGVGSLTIPLLQKAGA----VTAVEKDR
RSMA_DESAH      NAARMIVTKAGISD--QDR--------VLEIGPGLGALTIPAAKLARD----LVAVEKDT
RSMA_DESOH      QAAEMIVRKCGLSK--ADV--------VVEVGPGTGALTIPAAGQAAW----VYAIETDG
RSMA_DESPS      QTAEAIVRAGEVGE--DDI--------ITEIGVGLGALTVPMAHQAKH----VYGIEIDN
RSMA_SYNAS      SVMKKIVELAEIKE--DET--------IVEIGSGLGLMTSLMAERAAW----VHAVEIDG
RSMA_MYCCT      N-LINKIVDVLDQNK-DQL--------IIEIGPGKGALTKELVKRFDK----VVVIEIDQ
RSMA_MYCMS      N-LINRIVDVLDQNK-NQL--------IIEIGPGKGALTKELVKRFDK----VVVIEIDQ
RSMA_MESFL      N-LINKIVSILGNDK-DQL--------IIEIGPGTGALTKLLAQKYNK----VVAIEIDT
RSMA_FUSNN      DEILNKIIEVSNIDD-NDE--------ILEIGPGQGALTSLLVERVKK----ITCVEIDK
RSMA_AYWBP      N-LLNKIVTKASITD-KN---------VLEIGPGKGALTKIIVPQAKN----VLAYEIDA
RSMA_ONYPE      N-LLNKIVTKASITD-KN---------VLEIGPGKGALTKIIVPQAKH----VLAYEIDA
RSMA_PHYAS      N-LLKKIVSKANLKG-KN---------VIEIGPGKGSLTNLITKEANL----LLAYEIDP
RSMA_MYCH7      K-IAEKIVENIDLKN-KE---------IIEIGCGTGFLTNFLLERAKF----VTCYEIDR
RSMA_MYCHJ      K-IAEKIVENIDLKN-KE---------IIEIGCGTGFLTNFLLEKAKF----VTCYEIDR
RSMA_MYCH2      K-IAEKIVENIDLKN-KE---------IIEIGCGTGFLTNFLLEKAKF----VTCYEIDK
RSMA_MYCMO      N-IIEKIVNFIPLEN-ED---------VLEIGPGQGALTNLLVKKSKN----VLAYEIDK
RSMA_MYCS5      N-IINKIVNVFNIEN-EK---------VLEIGPGQGDLTKELLKKAKK----VLAFEIDK
RSMA_MYCPU      N-IINKIVDSSEVEN-RN---------IIEIGPGKGALTKILVKKANK----VLAYEIDQ
RSMA_MYCA5      A-IQKAIVDVACVDD-EN---------VIEIGPGLGALTDLIKELSKE----LIAYEIDN
RSMA_KORVE      S-GALKIVEALGDIS-DAT--------VVEIGPGRGAITDHLAKRAKR----LIAVEIDR
RSMA_ACIC5      A-ACRSIVEALGNLG-ART--------VVEIGPGKGAITELLANRAER----LIAIELDR
RSMA_THEMA      R-IAKRIVKAAELTP-EDV--------VVEIGAGAGTLTEELAKTGAR----VIAYEIDE
RSMA_THESQ      R-IAKRIVKAADLTP-EDV--------VVEIGAGAGTLTEELTKTGAR----VIAYEIDE
RSMA_THEP1      R-IAKRIVKEVGLTP-EDV--------VVEIGAGAGTLTEELAKTGAR----VIAYEIDE
RSMA_THENN      R-IAKRIVKEADLKP-DDV--------VVEIGAGAGTLTEELAKTGAR----VIAYEIDE
RSMA_NOSS1      KALDAIVKAAECST--NDR--------ILEIGPGTGILTRRLLPAV----QSLVAVEIDR
RSMA_TRIV2      KALDAIVKAAECST--NDR--------ILEIGPGTGILTRRLLPLV----EALLAVEIDR
RSMA_NOSP7      KALDAIIKAAECTE--SDRSPK--GDCILEIGPGTGILTRRLLPLV----QSLIAVEIDR
RSMA_CROS5      TALEQIIQAANLKK--SDR--------LLEIGPGTGILTRRLLPLV----QSLIAVELDW
RSMA_RIPO1      TALDQIIEAAQLNM--SDL--------VLEIGPGTGILTRRLLPLV----QSIVAVELDR
RSMA_SYNY3      PTLQAIVAAADIQS--GAPQSGSLRDRLLEIGPGMGVLTKQLLATG----NPVVAVELDR
RSMA_ACAM1      AVLRQIIAAAKIQG--CDR--------ILEIGPGRGVLTRELLAQA----QSVVSVELDR
RSMA_SYNE7      AILDRIVAAAELRP--SDR--------VLEIGPGRGALTQRLLAAV----DGLVAVELDR
RSMA_SYNP6      AILDRIVAAAELRP--SDR--------VLEIGPGRGALTQRLLAAV----DGLVAVELDR
RSMA_SYNP2      QILDEIVAAANLQP--TDR--------VLEIGPGKGALTSRLLPQV----EALLSVEIDR
RSMA_THEEB      AILAQIIAAAELHP--GDR--------VLEIGPGRGALTRPLLVSG----AEVVAVELDR
RSMA_SYNJB      AVHEAILRAAQLND--LERGA--DPTWVLEIGPGTGQLTRRLLAQG----VQVVAVEIDR
RSMA_SYNJA      AVHEAIVRAAQLPP--PQR----DPAWVLEIGPGTGQLTQRLLAQG----VHVVAVEIDR
RSMA_GLOVI      AVLDRIVAAAGLAC--GDR--------VLEIGPGLGSLTARLLRQ-----VPVVAVEIDR
RSMA_PROMA      SILEKILLAADLQE--EDR--------ILEIGPGRGALTEKLLESNV---KLVHGVELDA
RSMA_PROM4      AILEKIVEAAELCE--NDR--------VLEIGPGRGALTHKLLNSKV---SLVHAIELDT
RSMA_PROM3      AVLTQILDAADVQP--DDR--------LLEVGPGRGALTERLLASSA---SAVHAVELDR
RSMA_PROMM      AVLTQILDAADVQP--DDR--------LLEVGPGRGALTERLLASSA---SAVHAVELDR
RSMA_SYNS3      RVLDRIVEAAELQD--GDR--------VLEVGPGRGALTERLLASAA---AAIHAVELDR
RSMA_SYNPW      RVLDRILDASDLGD--DDR--------VLEVGPGRGALTERLLASSA---AAVHAVELDR
RSMA_SYNSC      SVLQRIIEAADLQS--TDR--------VLEVGPGRGALTERLLAAGL---KAVHAIELDR
RSMA_SYNPX      TVLDRIVAAADLQP--SDR--------VLEVGPGRGALTERLLSSPA---AAVQAVELDR
RSMA_SYNS9      RVLDQIVEAARLQQ--DDC--------VLEVGPGRGALTERLLASPA---AQIHAIELDR
RSMA_SYNR3      SVLQRIVAAAALQP--DDH--------VLEVGPGRGALTAQLLASPA---ASVQAVELDR
RSMA_PROM1      GVLDQIVKAAELNP--EDC--------VLEVGPGKGALTEKLIESQA---KFIQAIELDR
RSMA_PROMT      GVLDQIVKAAELNP--EDC--------VLEVGPGKGALTEKLIESQA---RFIQAIELDR
RSMA_PROM0      KILEKIKEIAVLNE--NDF--------ILEIGPGKGALTSKLLNSEI---KKLHAIELDK
RSMA_PROM9      KILEKIKEIAVLNE--NDF--------ILEIGPGKGALTSKLLDSEI---KKLHAIELDK
RSMA_PROMS      KILEKIKEIAVLNQ--NDF--------ILEIGPGKGALTSKLLDSEI---KKLHAIELDK
RSMA_PROM2      KILEKIKEIAVLNE--NDF--------ILEIGPGKGALTAKLLDSKI---KKLHAVELDN
RSMA_PROM5      LILEKIKEVAELDE--KDF--------ILEIGPGKGALTSKLLDSKI---SRLHAVELDK
RSMA_PROMP      LILEKIKEVAELEE--KDF--------ILEIGPGRGALTSKLLDSKI---SRLHAIELDE
RSMA_TREPA      VLRTQLVKILAPER--GER--------VWEIGAGIGAMTALLVQNSDF----LTVFEIDR
RSMA_TREPS      VLRTQLVKILAPER--GER--------VWEIGAGIGAMTALLVQNSDF----LTVFEIDR
RSMA_TREDE      KTRENLISFLTLDK--GTR--------VWEVGPGLGAMTYLLLEKGVH----LTAFEIDK
RSMA_BORAP      NIRQKIIESLDIKE--NEK--------IWEIGPGLGAMTDILLK-KTNLL---TAFEIDL
RSMA_BORBP      SIRQKIIESLDIKE--NEK--------IWEIGPGLGAMTDILLK-KTNLL---TAFEIDL
RSMA_BORBU      SIRQKIIESLDIKE--NEK--------IWEIGPGLGAMTEILLK-KTNLL---TAFEIDL
RSMA_BORBZ      SIRQKIIESLDIKE--NEK--------IWEIGPGLGAMTEILLK-KTNLL---TAFEIDL
RSMA_UREPA      NIKNKIVDVANINK--DDL--------ILEIGPGWGAITEILVQ-KTNIL---IAIELDK
RSMA_UREP2      NIKNKIVDVANINK--DDL--------ILEIGPGWGAITEILVQ-KTNIL---IAIELDK
RSMA_UREU1      EIKNKIVNVANISK--DDL--------ILEIGPGWGAITELLVQ-KTDTL---VAIELDK
RSMA_MYCPE      NIKKKIVDSLEIKP--DDH--------VLEIGPGFGALTKIVLS-QTKNL---TVVELDK
RSMA_MYCGE      SVIKRIFAFVKNLN--PQA--------IVEIGVGKGALTNYLLK-LKIPY---KGIEIDK
RSMA_MYCPN      SVIAKTCRLIKSLN--PTA--------LIEVGPGKGALTKALLK-LQLPY---HGIELDK
RSMA_MYCGA      NIINNVVEAVSKIN--PSK--------VLEIGPGLGAISEQLIKRFADNY---YAIELDK
RSMA_ARCB4      TILDKIIQSMPN-NNNHIV----------EIGPGLGDLTKNLVKYKD-----LTAYEVDT
RSMA_SULDN      SVLQKIIEAMPN-NDNKIV----------EIGPGLGDLTKFLVDVKS-----VDAFEVDT
RSMA_HELHP      HFLHKIIQSIPD-IPIQCI----------EIGVGLGDLTQELLKIES-----LIAYEVDL
RSMA_CAMC1      ATLDKIIQAIPK-DVENVV----------EIGPGLGDLTFRLLQIYK-----TTSFEIDR
RSMA_CAMC5      AVLNKIIQAIPK-DTQNIV----------EIGPGLGDLTFKILQICS-----VTAYEIDS
RSMA_CAMHC      NALNKIIESIPE-NAENIV----------EIGAGLGDLTYELLRKFK-----VKSYEIDK
RSMA_CAMFF      NIKNQIIQAIPN-DVKRIV----------EIGPGLGDLTQKLVKLDSM----IDCFEIDS
RSMA_CAMJE      SVLAKIIQAIPK-EMNNII----------EIGPGLGDLTQELLKISQ-----VKAYEIDN
RSMA_CAMJR      SVLAKIIQAIPK-EMNNII----------EIGPGLGDLTQELLKISQ-----VKAYEIDN
RSMA_HELPY      SFLDRIVNALPPLNPLKLV----------EIGVGLGDLTLKLLDRYP-----LKTYEIDS
RSMA_HELPH      SFLDRIVDALPPLNPLKLV----------EIGVGLGDLTLKLLDRYP-----LKTYEIDS
RSMA_HELPG      SFLDRIVNALPPLNPLKLI----------EIGVGLGDLTLKLLDRYP-----LKTYEIDS
RSMA_HELP2      SFLDRIVNALPPLNPLKLI----------EIGVGLGDLTLKLLDRYP-----LKTYEIDS
RSMA_HELPS      SFLDRIVDALPPLNPLKLI----------EIGVGLGDLTLKLLDHYP-----LKTYEIDS
RSMA_HELPJ      SFLDRIVNALPPLNSLRLI----------EIGVGLGDLTLKLLDRYP-----LKTYEIDS
RSMA_HELAH      SFLDRIVSALPPLNSLRLI----------EIGVGLGDLTLKLLDRYP-----LKTYEIDS
RSMA_BDEBA      TVINRIIDQVKAFAPEELV----------EVGPGPGALTDLLLELNLP----LQLIELDS
                                             ::* * . ::                 : * 

RSMA_RHIEC      RCLPALAEIADHYPG-------RLEVIEGDALKTDFEALAP-------------------
RSMA_RHIE6      RCLPALAEIADHYPG-------RLEVIEGDALKADFESLAP-------------------
RSMA_RHILW      RCLPALAEIADHYPG-------RLEVIEGDALKTDFEALAP-------------------
RSMA_RHIL3      RCLPALAEIADHYPG-------RLEVIEGDALKTDFETLAP-------------------
RSMA_AGRVS      RCLPALAEISDHYPG-------RLEVIEGDALKTDFEAMAP-------------------
RSMA_RHIME      RCLPALAEIGAHYPG-------RLDIIEDDALKVDFEALA--------------------
RSMA_SINMW      RCLPALAEIGAHYPE-------RLDVVEGDALKVDFEALA--------------------
RSMA_SINFN      RCLPALAEISAHYPG-------RLDVVEGDALKVDFERLA--------------------
RSMA_AGRFC      RCLPVLAEIEAHYPG-------RLEVIEGDALKTDFEALVP-------------------
RSMA_CHESB      RCIAALEEIAAHYPG-------RLEIVAGDAMKADFAALA--------------------
RSMA_RHILO      RCLAALAEVSAHYPG-------RLEVVSGDALKTDFAALASAAG----------------
RSMA_BARHE      RCIPALLEIEKHYPQ-------KLKIICNDALKQDFSKLFE-------------------
RSMA_BARQU      RCIPALLAIEKHYPK-------KLKLICNDALKQNFSKLFE-------------------
RSMA_BART1      RCIPALLEIEKHYPN-------QLKLICNDALKQDFSKLFG-------------------
RSMA_BARBK      RCLPALLEIEKHYPK-------KLNLIFDDALKQDLSKLSE-------------------
RSMA_BRUA2      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUA1      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUC2      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUMB      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUO2      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUSU      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUME      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUSI      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_BRUAB      RCLEALAEIAAHYPG-------RLRIIAGDALEQDFTALFP-------------------
RSMA_OCHA4      RCLDALAEIEAHYPG-------RLRIISGDALEQDFSALFP-------------------
RSMA_AZOC5      RCIAALNEIAAAYPG-------RLEIIEGDALKVDVRPHLD-------------------
RSMA_XANP2      RCLDALAEVSDHYPG-------RLEVISGDALKVDVRPLVG-------------------
RSMA_METRJ      RALPALAEIAAHYPG-------RLEVVDADALAFDPRPLVG-------------------
RSMA_BRASB      RAIPALQAIAERYPG-------RLEIVCTDARTFDVRPYLG-------------------
RSMA_BRASO      RAIPALRTIADRYPG-------RLEIVYTDARTFDVRPYLG-------------------
RSMA_BRADU      RAIPALQDISARYPG-------RLEIVHGDAMTFDPRPLLN-------------------
RSMA_NITHX      RALGALEEISGRYPG-------RLTIVNADATQFDSRPLLG-------------------
RSMA_NITWN      RALGALEEISDRYPG-------RLTIINADATDFDPRPLLG-------------------
RSMA_RHOPA      RALGALEEIAAHYPG-------RLDIISGDAMEFDPRPLLN-------------------
RSMA_RHOPT      RALGALEEIAAHYPG-------RLDIISGDAMEFDPRPLLN-------------------
RSMA_RHOPS      RALGALEEIAAHYPG-------RLEIVCADAMDFDPTPLLG-------------------
RSMA_RHOP2      RALGALEEIAAHYPG-------RLEIVCADAMEFDPRPLLG-------------------
RSMA_RHOP5      RALGALAEISAHYPG-------RLDIVCADAMTYDPRPLLG-------------------
RSMA_RHOPB      RALGALQEIAAHYPG-------RLEIVCADATIYDPRPLLG-------------------
RSMA_OLICO      RAIPALEEIARRYPG-------RLEIIHGDATTFDPTPLLQ-------------------
RSMA_RUEPO      RCLPALAEIAAAYSG-------RLEVINGDALEIDPLAHMT-------------------
RSMA_RUEST      RCLPALEDIAAAYPG-------RLEVINGDALEIDPLAHLT-------------------
RSMA_ROSDO      RCLPALAEIAAVYPG-------RLEVMNGDALEIDPLSALT-------------------
RSMA_PARDP      RALPALAEIATAYPG-------RLEVIHGDALEIDPLAHLT-------------------
RSMA_DINSH      RCLPALQQIAAAYPG-------RLEVIEGDALEVDATAYLS-------------------
RSMA_RHOS4      RCLPALAEVAAAWPG-------RLEVLNADALEVDVAARLT-------------------
RSMA_RHOS1      RCLPALAEVAAAWPG-------RLEVLNADALEVDVAARLT-------------------
RSMA_RHOSK      RCLPALAEVAAAWPG-------RLEVLNADALEVDLAARLT-------------------
RSMA_RHOS5      RCLPALAEVAAAWPG-------RLEVLNADALEVDVAARLT-------------------
RSMA_JANSC      RCLPVLAEIEAIYPG-------RLKVLNADALELDWAADLQ-------------------
RSMA_ERYLH      RCLPALAELSEVYPG-------KLSVIHGDAMKLDHAELMGE------------------
RSMA_NOVAD      RCLPALAELADAFPG-------QLTVIEGDATKIAPETLFDG------------------
RSMA_SPHAL      RCLPLLADLAEAFPG-------QLTVIADDAMAVDVDALTGGD-----------------
RSMA_ZYMMO      RCLPALAELSAHFPD-------QLQVISGDAMEIDEAAVLGE------------------
RSMA_MAGSA      RAIAIQNEIAEAYPG-------RLEIMAADAMTVDAAELGEV------------------
RSMA_RHORT      RCRGVLAEIAAVWPG-------RLETIEGDALDIDVAALGEA------------------
RSMA_GLUOX      RAWPLLDELATYYPD-------RLHVVRQDALKLDAATLAPA------------------
RSMA_CAUVC      RFLPLLAEVAEVAEG-------RLELVEGDALKVD-AAQAAG------------------
RSMA_PHEZH      RFRPLLQEVADAAP--------HLTLVFGDALTADEAALSAG------------------
RSMA_MARMM      RFLGALDEINVASGG-------RLTVEQGDALEVDETALLTGP-----------------
RSMA_ANAMF      RLSPMHKGLMQKYP--------NYRYIEHDVLEINLETMIS-------------------
RSMA_ANAMM      RLSPMHKGLMQKYP--------NYRYIEHDVLEINLETMIS-------------------
RSMA_ANAPZ      RLSNIHSKLKEAHA--------EYDCIFEDILDVNIEQLLSQ------------------
RSMA_EHRCJ      RLMPIHKKIVDEFNG-------KYEFILSDALNIDLRTIIE-------------------
RSMA_EHRCR      RLSTIHEKIVEEFQG-------KYEFILSDALNIDLRDIIE-------------------
RSMA_EHRRG      RLLPIHDKIIKEFQG-------KYEFILSDALDIDLRNIAK-------------------
RSMA_EHRRW      RLLPIHDKIIKKFQG-------KYEFILSDALDIDLRNIAK-------------------
RSMA_WOLPM      DLVKHHDQLLNEHQG-------KYRIIEADALHIIEEELIE-------------------
RSMA_WOLWR      DLVKHHDQLLNEHQG-------KYRIIEADALHVTEEELIE-------------------
RSMA_WOLTR      NLVKCHDQLLNEHQG-------KFRIVEADALYVVEEELIE-------------------
RSMA_WOLPP      SLVKHHEQLLNEHQG-------KYRIIEADALNVVEKELVE-------------------
RSMA_NEOSM      RFSESLSSLMAQYQ--------NYKYTIGDALLIRLSSLFKQ------------------
RSMA_RICPU      RCLPLLNEIKEYYP--------NLNIIKQDALKINLTDLSCDIVNSVGFAYKKREAKPIT
RSMA_RICRS      RCLPLLNEIKEYYP--------NLNIIKQDALKINLTDLSCDIVNSVGFAYKKREAKPIT
RSMA_RICAE      RCLPLLNEIKEYYP--------NLNIIKQDALKINLTDLSCDIVNSVGFAYKKREAKPIT
RSMA_RICFE      RCIPLLNEIKEYYP--------NLNIIKQDALKINLTDLGYD------------------
RSMA_RICAH      RFIPLLNEIKEYYP--------NLNIIKQDALKINLTDLDYD------------------
RSMA_RICCK      RFIPLLNEIKEYYP--------NLNIIKQDALKINLTDLGYD------------------
RSMA_RICPR      RCIPLLNEIQEYYP--------NLNIIKQDVLKINLTDLIYD------------------
RSMA_RICTY      RCIPLLNEIQGYYP--------NLNIIKQDVLKINLTDLIYD------------------
RSMA_RICB8      RCIPLLNEIKQYHP--------NLNIIKQDALKLKLSDLNTN------------------
RSMA_RICBR      RCIPLLNEIKQYHP--------NLNIIKQDALKLKLSDLNTN------------------
RSMA_PELUB      ---DLAILLKEKFDT-------EIKIINDDILKVSESTISDQ------------------
RSMA_PERMH      TVYPIIEERFKDFKN-------FVLIKEDFFDVDLRKLT--D------------------
RSMA_SULSY      SVHPVLEEKFSIYSN-------FKLIKSDFFDVNLYELISDE------------------
RSMA_AQUAE      EMVENLKSIGD--ER-------LEVINEDASKFPFCSLG---------------------
RSMA_HYDS0      DIFGLLEKKYK---N-------ATLLNEDASLVDLSSYK---------------------
RSMA_DESVH      HWAREHRLHPLAGTP-------EAQVVLTDALLFPWERLDAA------------------
RSMA_DESVV      HWAREHHLHPLAGTP-------EAQVVLTDALLFPWERLDAA------------------
RSMA_DESAG      YWAGEHRRSDSRTPV-------EKQVVLTDALTFPWERLSDD------------------
RSMA_DESAD      DLAPALE----AEYP-------EARVELEDALKFDWAGLDPD------------------
RSMA_LAWIP      CWVDYHSSVKQQNVS-------KVTIHHLDALKFSWETLCG-------------------
RSMA_HALMA      DFAAHLREEFTEEV-----AADRLTIVEGDALEVDLPD----------------------
RSMA_NATPD      GLATFLTDEFADEI-----EAGSLTVIEGDALEVPLPD----------------------
RSMA_HALWD      TLAAFLREEFAVMI-----DDGRLNIIEGDALEVTLPA----------------------
RSMA_HALSA      SYASFLREEFADAI-----AAGDLDVVAGDALAVDLPA----------------------
RSMA_HALS3      SYASFLREEFADAI-----AAGDLDVVAGDALAVDLPA----------------------
RSMA_METHJ      TLIERLSRRFASEI-----ADGSLTLLQGDAVKVPLPP----------------------
RSMA_METAC      ALVSVLHDRFDKVE--------NIEVIAGDALKVDFPE----------------------
RSMA_METMA      ALVSVLHDRFDAAE--------NIEIIAGDALKVDFPE----------------------
RSMA_METBF      VLVRVLHDRFDKVG--------NIEIIAGDALKVEFPE----------------------
RSMA_METBU      ALVHVLKDRFSDNE--------KLEIIPGDVLKLDLPK----------------------
RSMA_ARCFU      LMVKRLRERFSDFI-----GKGRFRLIQGDALKVDFPY----------------------
RSMA_METTH      LIAAILMDRL---------QVDNVDVIVGDALRVDFPE----------------------
RSMA_METST      IIVDILKQQII-KE-----KLTNIEIIKDDALKVDFPK----------------------
RSMA_PYRAB      RIIEILRNEY---------SWNNVEIIQGDAVKVEWPS----------------------
RSMA_PYRHO      KIIEILKKEY---------SWNNVKIIQGDAVRVEWPK----------------------
RSMA_PYRFU      RIIEILENEY---------NWENVEIIQGDAVKIEWPE----------------------
RSMA_THEKO      RIVEILRREY---------NWPNVEIIEGDALKVEWPE----------------------
RSMA_THEGJ      RMIEILQREY---------SWPNVELIKGDAVKVEWPE----------------------
RSMA_THEON      RLVEILRKEY---------NWSNVEIIEGDALKVDFPE----------------------
RSMA_THESM      RIIEILKKEY---------NWSNVEIMQGDALKIKFPE----------------------
RSMA_METKA      RMVEILKREL---G-----EAPNLEIVRADFLEYDVPDD---------------------
RSMA_METM6      RLKPFADEIT---S-----EFENVEIIWSDALKVDLKNLG--------------------
RSMA_METM7      RLKPFADEIT---S-----EFENVEIIWSDALKVDLKTLG--------------------
RSMA_METMP      RLKPFADEIT---A-----EFENVEIIWSDALKVDLKNLG--------------------
RSMA_METM5      RLKPFADEIT---S-----EFENVEIIWSDALKVDLKNLG--------------------
RSMA_METVS      RLEPFANQIM---S-----EFKNVKVIWNDALKVDLKELG--------------------
RSMA_META3      KLEIFWEDII---K-----EYPNVEIIWNDALKVNLKELG--------------------
RSMA_METJA      SLEPYANKLK---E-----LYNNIEIIWGDALKVDLNKLD--------------------
RSMA_PYRAE      ALAERLRGIA----------PPNVVIIVGDALEVEWPR----------------------
RSMA_PYRIL      TLAEFLKRQA----------PPNVVVIVGDALEIEWPR----------------------
RSMA_RUBXD      DVLPELRRAV---G-----ARGNVRIHEADALRFDYGALS--------------------
RSMA_NATTJ      RMIDILQETV---G-----SCDNVNIIHNDALKLDYQELISDFIEFSPAQLQCKSKQI--
RSMA_RHOBA      NLFQLASEEL---A-----PFPHVKMIQGDALKNKSTFRDDIMESIREAKSRLP------
RSMA_PAEAT      VLAEKLPETVRAWR--------PGAEENFHLVLSDAMKV--TELP---------------
RSMA_ARTS2      VLAAKLPGTVQQWR--------PGAAKDFHLVLADAMKV--TELP---------------
RSMA_STRAW      VLAGALPATIAARM--------PERAERFALVHSDAMHV--RELPG--------------
RSMA_STRCO      VLAGALPATVAARM--------PARADRFALVHSDAMHV--RELPG--------------
RSMA_STRGG      VLAAALPATVQARM--------PERADRFALVHSDAMLV--TELPG--------------
RSMA_THEFY      RLAEALPGTVADHA--------PAYAHRLRVVTADALRI--TELPD--------------
RSMA_KINRD      VLAAELPATVAARG--------RP-GTSFEVVLADAVQL--AELPG--------------
RSMA_LEIXX      RLAERLPLTVAQLA--------PEAAGRLTVVHSDALAV--TELP---------------
RSMA_CUTAK      VLANQLPGTVAERM--------PGAAERLEVVLSDALDV--KVIPG--------------
RSMA_CORGL      RLAAELPETFQWRA--------PALAHKLSIVLKDALKVQQSDMAV--------------
RSMA_CORGB      RLAAELPETFQWRA--------PALAHKLSIVLKDALKVQQSDMEV--------------
RSMA_COREF      RLAAELPATFAWRA--------PGLADKLTVVQKDALKVQQSDFTT--------------
RSMA_CORDI      RLAQQLPLTVAERA--------GQFADRLNLIHKDALTVAPDDID---------------
RSMA_CORJK      RLAAKLPATLEEQG--------AAEAD-VAVILKDAMEVAVQDFADAG------------
RSMA_MYCA1      VLAERLPHTVAEHS--------HSEIQRLTVLNRDVLTLRRDELAE--------------
RSMA_MYCPA      VLAERLPHTVAEHS--------HSEIQRLTVLNRDVLTLRRDELAE--------------
RSMA_MYCLE      VLAGRLPQTVAEHS--------NNEIHRLTVCNRDVLSFRRGDLAT--------------
RSMA_MYCLB      VLAGRLPQTVAEHS--------NNEIHRLTVCNRDVLSFRRGDLAT--------------
RSMA_MYCTU      LLASRLQQTVAEHS--------HSEVHRLTVVNRDVLALRREDLAA--------------
RSMA_MYCTA      LLASRLQQTVAEHS--------HSEVHRLTVVNRDVLALRREDLAA--------------
RSMA_MYCBT      LLASRLQQTVAEHS--------HSEVHRLTVVNRDVLALRREDLAA--------------
RSMA_MYCBO      LLASRLQQTVAEHS--------HSEVHRLTVVNRDVLALRREDLAA--------------
RSMA_MYCBP      LLASRLQQTVAEHS--------HSEVHRLTVVNRDVLALRREDLAA--------------
RSMA_MYCGI      VLATQLPTTIAAHS--------HSEVNRLTVLNRDILTFKQSDMTE--------------
RSMA_MYCVP      VLANQLPTTIAAHS--------HSEVNRLTVLNRDILTFKQSDMTE--------------
RSMA_MYCSJ      LLAQQLPTTIADHS--------HSEINRLTVLNQDILTLMPSDLEN--------------
RSMA_MYCSS      LLAQQLPTTIADHS--------HSEINRLTVLNQDILTLMPSDLEN--------------
RSMA_MYCSK      LLAQQLPTTIADHS--------HSEINRLTVLNQDILTLMPSDLEN--------------
RSMA_RHOOB      NLAARLPVTVADRA--------PDLADRLTVVGADAMRVKPSEIPG--------------
RSMA_RHOJR      NLAARLPVTVADRA--------PELADRLTVVGADAMRVKPSEIPG--------------
RSMA_RHOE4      NLAARLPKTVAERA--------PELADRLTVVEADAMRVLPSQIPG--------------
RSMA_NOCFA      VLAEHLPRTVADRA--------PALAGRLRVVRDDALRVRAADLPA--------------
RSMA_BIFLD      PLAERLPGTVAEFM--------PEATSRLTVVNRDALTVTPENVPDFS------------
RSMA_BIFLS      PLAERLPGTVAEFM--------PEATSRLTVVNRDALTVTPENVPDFS------------
RSMA_BIFLO      PLAERLPGTVAEFM--------PEATSRLTVVNRDALTVTPENVPDFS------------
RSMA_BIFAA      PVAERLPKTIAEFM--------PDAVDRFRVVNRDALTVNPENLPDFK------------
RSMA_ACIC1      VLAAVLPETIRRRC--------PAFADRLVVVHGDVLRL--TTLPD--------------
RSMA_OPITP      TLHAHLSSTLQ-----------PRHPDTFHLLEADAVEHPLADLPA-A------------
RSMA_DEIGD      RLRPVLAETLAGQ--------------DVQVVWGDALEFDYASLPA--------------
RSMA_DEIRA      RLRPVLAETLAGL--------------DVNVIWGDALDFDYAALPA--------------
RSMA_THET2      RLRPVLEETLSGL--------------PVRLVFQDALLYPWEEVPQ--------------
RSMA_THET8      RLRPVLEETLSGL--------------PVRLVFQDALLYPWEEVPQ--------------
RSMA_CHLTR      MFEESLSQLPM-------------DIEITDACKYPLTSLEDKGWKG--------------
RSMA_CHLTA      MFEESLSQLPM-------------DIEITDACKYPLTSLEDKGWKG--------------
RSMA_CHLT2      MFEESLSQLPM-------------DIEITDACKYPLTSLEDKGWKG--------------
RSMA_CHLTB      MFEESLSQLPM-------------DIEITDACKYPLTSLEDKGWKG--------------
RSMA_CHLMU      MFEESLSQLPI-------------DIEITDACKYPLASLDDKGWKG--------------
RSMA_CHLCV      MFEETLKQLPI-------------DLEITDACKYPLSQLEEKGWQG--------------
RSMA_CHLFF      MFEETLKQLPI-------------DLEITDACKYPLSQLQEKGWQG--------------
RSMA_CHLAB      MLEETLKQLPI-------------HLEITDACKYPLSQLQDQGWQG--------------
RSMA_CHLPN      MFAPSLEELPI-------------RLEIIDACKYPLDQLQEYKTLG--------------
RSMA_PARUW      VLARELKRFQTPSK--------QLEIFCEDILMFSVEEELQSRLRDD-------------
RSMA_ALKMQ      NLIPIL-KHTLADY-------QNVEVINQDVLKVDLHQLIADKFEG--------------
RSMA_ALKOO      TLIPIL-KETLGAY-------PNVEVINEDVLKLDLHKLIEEKFPG--------------
RSMA_CLOD6      NLIPIL-KDTLSDL-------DNTEVVNQDILKVDIQELVKDKLNG--------------
RSMA_LACP7      NLIPILEQDTLSSY-------DNVTIINEDILKVDINQIVKEKNGG--------------
RSMA_CLOPE      SLIPIL-TAELGDN-------PKFQLIHNDALKVDFNEIIGDE-----------------
RSMA_CLOP1      SLIPIL-TAELGDN-------PKFQLIHNDALKVDFNEIIGDE-----------------
RSMA_CLOPS      SLIPIL-TAELGDN-------PKFQLIHNDALKVDFNEIIGDE-----------------
RSMA_CLOAB      SLIPII-TNEMKEY-------DNFTLIHNDALKVDFNNIIGEE-----------------
RSMA_CLOB6      DLIPIL-QEELKEY-------NNFTLIHKDALKIDFNRLMENK-----------------
RSMA_CLOBJ      DLIPIL-QEELKEY-------NNFTLIHKDALKIDFNELMENK-----------------
RSMA_CLOB1      DLIPIL-QEELKEY-------NNFTLIHKDALKIDFNELMENK-----------------
RSMA_CLOBL      DLIPIL-QEELKEY-------NNFTLIHKDALKIDFNELMENK-----------------
RSMA_CLOBK      DLIPIL-QEELKEY-------NNFTLIHKDALKINFNELMENK-----------------
RSMA_CLOBM      DLIPIL-QEELKEY-------NNFTLIHKDALKIDFNGLMENK-----------------
RSMA_HALOH      RLVKVL-RELFNGY-------NHLEVIGQDVLEVDWKHFFDSRGISD-------------
RSMA_MOOTA      ELFAALEETLAGR--------DNVRLVAGDALKVDFDRLVAGILGTGEGR----------
RSMA_PELTS      GLLPALAEVLEGA--------GNVEIIRGDALDVDFDRLAGEKTDGAFGR----------
RSMA_SYMTH      GLVQVLHDTVQKAY-------DNVEVIHGDAGRIDLHKLLGERLAP--------------
RSMA_CALS4      ELFEMS-REKLKIY-------KNVVIINEDILEVDLLEIAQEHFDG--------------
RSMA_DEHMB      KLIDAL-TEKFKGY-------PNFRLIHSDILKTSPEEILGQN-----------------
RSMA_DEHMC      KLIDAL-TEKFKGY-------PNFRLIHSDILKTSPEEILGQD-----------------
RSMA_DEHM1      KLVTAL-TEKFKAY-------PNFRIIHSDILKTSPAEILGQN-----------------
RSMA_DESHD      GKVNLL-QRELQGL-------P-VDILNMDALKLDLKDIWGTG-----------------
RSMA_DESHY      GKVNLL-QRELQGL-------P-VDILNMDALKLDLKDIWGTG-----------------
RSMA_GEOKA      RLLPIL-ADTLSPY-------DNVRIFHQDVLKADLHAVIAEELAD--------------
RSMA_GEOTN      RLLPIL-ADTLSAY-------DNVRIIHQDVLKADLHAVIAEEFAE--------------
RSMA_GEOSW      RLLPIL-EDTLSPY-------GNIRIIHQDVLKADIHRVISEEFTG--------------
RSMA_ANOFW      RLLPIL-ADTLSPY-------TNVSIIHEDILKADVQQVIAEQFTD--------------
RSMA_BACLD      RLLPIL-EDTLSPY-------DNVTVIHQDVLKADVRAVMDEQFQD--------------
RSMA_BACSU      RLLPIL-KDTLSPY-------ENVTVIHQDVLKADVKSVIEEQFQD--------------
RSMA_BACP2      RLLPIL-NDTLSPY-------DNVTIIHQDVLKADVGKVIEENFAD--------------
RSMA_BACAN      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACAA      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACHK      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACCZ      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACAC      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACC7      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACC0      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACC1      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACCQ      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACCR      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFNEQFEE--------------
RSMA_BACC4      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFNEQFEE--------------
RSMA_BACC2      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFNEQFEE--------------
RSMA_BACC3      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACAH      RLLPIL-DETLAPY-------GNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACMK      RLLPIL-DETLAPY-------SNVTVINKDVLKADVHEVFSEQFEE--------------
RSMA_BACCN      RLLPIL-DETLAPY-------DNVTIINKDVLKANVHEVFQEQFEE--------------
RSMA_BACHD      RLIPVL-RETLAPY-------ENVTVINEDVLKADVKQVIATTFEE--------------
RSMA_LYSSC      RLLPVL-EDTLSPY-------NNVSIVHSDILKADVAKVIAEEMPG--------------
RSMA_BACSK      RLIPVL-EDTLSAY-------PNVKIIHSDVLKADLPGVLDAEFSK--------------
RSMA_OCEIH      RLLPIL-QDTLGEY-------SNVSVIHQDILKADVTKVIDEHFKE--------------
RSMA_LISMC      RLLPIL-DDTLSAY-------NNIQVVHGDVLKADVEEVIAEQFAKP-------------
RSMA_LISMF      RLLPIL-DDTLSAY-------NNIQVVHGDVLKADVEEVIAEQFAKP-------------
RSMA_LISMO      RLLPIL-DDTLSAY-------NNVKVVHGDVLKADVEEVIAEQFAKP-------------
RSMA_LISMH      RLLPIL-DDTLSAY-------SNVQVVHGDVLKADVEEVVAEQFAKP-------------
RSMA_LISIN      RLLPIL-DDTLSNY-------DNVRVVHNDVLKADVAEVITEQFAKP-------------
RSMA_LISW6      RLLPIL-DDTLSAY-------NNIQVVHGDVLKADVEEVITQQFSKS-------------
RSMA_STAAT      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAA3      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAC      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAA2      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAA9      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAS      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAA1      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAM      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAW      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAN      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAA8      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAB      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAE      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAAR      RLIPVL-NDTLSPY-------DNVTVINEDILKANIKEAVENHLQD--------------
RSMA_STAES      RLIPVL-KDTLSPY-------DNVTIINEDILKADIAKAVDTHLQD--------------
RSMA_STAEQ      RLIPVL-KDTLSPY-------DNVTIINEDILKADIAKAVDTHLQD--------------
RSMA_STAHJ      RLIPVL-KETLAPY-------DNVTIINEDILKADIGKAVKTYLND--------------
RSMA_STACT      RLIPVL-EDTLSDY-------DNVTVINEDILKADVVEAVQTHLSD--------------
RSMA_STAS1      RLIPVL-KDTMRPY-------DNVTVINEDILKADIAHYITEHLTD--------------
RSMA_MACCJ      RLIPIL-GETLSPY-------DNVTVINEDILKADVASAIETYLHH--------------
RSMA_STRA1      RLIPIL-ADTLARF-------DNVQVVNQDILKADLQTQIQAFKNP--------------
RSMA_STRA5      RLIPIL-ADTLARF-------DNVQVVNQDILKADLQTQIQAFKNP--------------
RSMA_STRA3      RLIPIL-ADTLARF-------DNVQVVNQDILKADLQTQIQAFKNP--------------
RSMA_STRMU      RLVPIL-ADTLRDF-------DNIKVVNEDILKSDLQTRIKEFANP--------------
RSMA_STRS7      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQLKQFSNP--------------
RSMA_STREM      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQLKQFSNP--------------
RSMA_STRE4      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQLKQFSNP--------------
RSMA_STRPB      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRPC      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRP1      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRPF      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRPD      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRPM      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRP8      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRPG      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRP6      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRP3      RLVPIL-ADTLRDF-------DNVQVVNQDILKADLQTQIKQFKNP--------------
RSMA_STRU0      RLIPIL-ADTLRDF-------DNVQVINQDILKSDLQSQIKQFKNP--------------
RSMA_STRT2      RLVPIL-EDTLRDH-------DNVKVINEDVLKADLQTRVKEFENP--------------
RSMA_STRTD      RLVPIL-EDTLRDH-------DNVKVINEDVLKADLQTRVKEFENP--------------
RSMA_STRT1      RLVPIL-EDTLRDH-------DNVKVINEDVLKADLQTRVKEFENP--------------
RSMA_STRGC      RLVPIL-ADTLRDF-------DNVTVVNQDILKVDLAQYIAEFKNP--------------
RSMA_STRSV      RLVPIL-ADTLRDF-------DNVTVVNQDILKVNLAQYIAEFKNP--------------
RSMA_STRPN      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRZT      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRPJ      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRP7      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRZJ      RLMPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRPI      RLVPIL-VDTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRP4      RLVPIL-VDTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRR6      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRP2      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRPS      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_STRZP      RLVPIL-ADTLRDF-------DNVTVVNEDILKVDLAQHIQNFKNP--------------
RSMA_LACLA      SLIPIL-EETMAPY-------DNFTLVSADILKVDLLSEIQKFKNP--------------
RSMA_ENTFA      RLIPVL-ADTLSRY-------DNVTVVHQDVLKADLVETTNQVFQE--------------
RSMA_LACSS      RLIPVL-KDTLNHY-------HNVTVLNQDILEADLPTLIAKHFDG--------------
RSMA_LACPL      RLLPIL-DETLADY-------DNVTVVNQDILKADLAAMISEHLD-N-------------
RSMA_LACS1      RLLPVL-ADTLSPY-------ENVEVVHQDILKADLKALIAEHFE-P-------------
RSMA_LACBA      NLLPVL-DETLMDY-------KNVKIINEDILKANLPAVVADEFE-A-------------
RSMA_PEDPA      NLMNVL-DETLSPY-------DNITVVNQDVLKANVNEEVENHLD-G-------------
RSMA_LACRD      DLIPVL-KEVLSPY-------DDVKVINQDVLQANLPELIKKEFKDP-------------
RSMA_LACRJ      DLIPVL-KEVLSPY-------DDVKVINQDVLQANLPELIKKEFKDP-------------
RSMA_LEUCK      HMVAVL-AETLLPY-------DNVKVIENDILKVNLAHVIATEFG-E-------------
RSMA_LEUMM      QMVEVL-ADTLKPY-------DNVKVIENDVLKVDLAKVISEEFG-D-------------
RSMA_OENOB      KLIPIL-SETLRPY-------KNVEIVNRDILKADFSIFAK-------------------
RSMA_LACAC      SLPEIL-HNELPKKIGEQSLNDRFKLLLKDVLKADFQNDLAGFFDM--------------
RSMA_LACH4      SLPEIL-QNELPKKIGDAPLEDRFKLMLKDVLKANFKEDLAGFFDM--------------
RSMA_LACJO      DLPEIL-NNELPQKIDGEELKDRFKLVMKDVLKANFVEDNDGFLDL--------------
RSMA_LACDA      SLPEIL-ANELPEKVDGQDLDQRFKLIMKDVLKADFATDLAGFFDL--------------
RSMA_LACDB      SLPEIL-ANELPEKVDGQDLDQRFKLIMKDVLKADFATDLAGFFDL--------------
RSMA_CARHZ      KLLPVL-AETTGDL-------GNVVVVNADAREINFDRVMAEQTGGEFGF----------
RSMA_ACIF2      DMIAGLRALAP---------PEQLRVLQADALEVDFAALAGAG-----------------
RSMA_ACIF5      DMIAGLRALAP---------PEQLRVLQADALEVDFAALAGAG-----------------
RSMA_HALHL      DLAPRLQERFA---------PA-LRVIEGDALALDPAELAPAQ-----------------
RSMA_ACISJ      DLAARLRQH------------GQLDVIESDVLKVDFAQVAQAL-----------------
RSMA_ACIET      DLAARLRQH------------GQLDVIESDVLKVDFAQVAQAL-----------------
RSMA_ACIAC      DLAQRLRSH------------GQLDVIESDVLKVDFSAVAANL-----------------
RSMA_POLSJ      DLAQQLRAH------------PQLTVVESDVLKVDFRQLAERLQHGPVRSAGLPQAETAP
RSMA_POLNA      DLARQLRSN------------PQLTVIESDVLRVDFLQLAEQVQSAGALRGAASQ-----
RSMA_RHOFT      DLAARLRAH------------PQLVVIESDVLKVDFAQVAQAL-----------------
RSMA_VARPS      DLAKRLREH------------PQLEVIESDVLKVDFAALATRF-----------------
RSMA_VEREI      DLALRLRRH------------AHLQVIQADVLRVDFTALAQTLRATP-------------
RSMA_LEPCP      DLAARLRKR------------PELTVIESDVLKVDFTALAQAA-----------------
RSMA_METPP      DLAARLRRR------------AELQVIESDVLRVDFAALAMAS-----------------
RSMA_BURCM      DLIGRLQQRF----------GPLLELHAGDALAFDFRSLAAPGDK---------------
RSMA_BURA4      DLIGRLQQRF----------GPLLELHAGDALAFDFRSLAAPGDK---------------
RSMA_BURCA      DLIGRLQQRF----------GALLELHAGDALAFDFRSLAAPGDK---------------
RSMA_BURCH      DLIGRLQQRF----------GALLELHAGDALAFDFRSLAAPGDK---------------
RSMA_BURCC      DLIGRLQQRF----------GALLELHAGDALAFDFRSLAAPGDK---------------
RSMA_BURCJ      DLIGRLQQRF----------GALLELHAGDALAFDFRSLAAPGDK---------------
RSMA_BURL3      DLIGRLQQRF----------GALLELHAGDALAFDFRSLAAPGDK---------------
RSMA_BURM1      DLIARLKQRF----------GALLELHAGDALAFDFRSLAAPGDA---------------
RSMA_BURVG      DLIGRLQQRF----------GALLELHAGDALAFDFGSLAAPGHA---------------
RSMA_BURMA      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGDE---------------
RSMA_BURPS      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGDE---------------
RSMA_BURM9      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGDE---------------
RSMA_BURM7      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGDE---------------
RSMA_BURMS      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGDE---------------
RSMA_BURP1      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGDE---------------
RSMA_BURP0      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGGE---------------
RSMA_BURP6      DLIGRLEQRF----------GELLELHAGDALTFDFGSIARPGGE---------------
RSMA_BURTA      DLIGRLKQRF----------GELLELHEGDALAFDFGSLALPGEK---------------
RSMA_PARPJ      DLIGRLKTKF----------GGLLELHAGDALAFDFGSLAAPGEK---------------
RSMA_PARXL      DLIGRLKTKF----------GDLLELHAGDALAFDFGSLAAPGDK---------------
RSMA_PARP8      DLIGRLKKKF----------GNLLELHEGDALAFDFGSLAGEGDK---------------
RSMA_CUPTR      DLVERLRRRY----------GERLQVHAGDALDFDFDKLAVPGR----------------
RSMA_CUPNH      DLVERLRRRY----------GERLQVHAGDALAFDFDKLAVPGR----------------
RSMA_CUPPJ      DLVERLRRRY----------GDRLQVHAGDALAFDFGRLAVPGR----------------
RSMA_CUPMC      DLVERLRRRY----------GDRLVVHAGDALAFDFGKLREPGR----------------
RSMA_RALSO      DLVARLQRRF----------GDKLIVHAGDALAFDFGTLHVPGR----------------
RSMA_BURSP      DLAAHLQRLG----------HASLILHAGDALRFDFAQLA-RAEQ---------------
RSMA_BORBR      DLAARLRRQYP---------AERLTVVEADALTVDFAQFG--------------------
RSMA_BORPE      DLAARLRRQYP---------AERLTVVEADALTVDFAQFG--------------------
RSMA_BORPA      DLAARLRRQYP---------AERLTVVEADALTVDFAQFG--------------------
RSMA_BORA1      DLAARLRKKYP---------PEQLSVVEADALTVDFRQFG--------------------
RSMA_BORPD      DLAARLRNAHA---------PGRLTVIEADALTVDFASLG--------------------
RSMA_HERAR      DLVERLKKTFD---------PKKLIIHSADALQFDFSTIPVPAGS---------------
RSMA_JANMA      DLVERLKKSFD---------PKRLIIHSADALQFDFSTIPVPAGS---------------
RSMA_AROAE      DLIARLHERYS---------PERLTIHEGDALKFDFATLG--------------------
RSMA_THIDA      DIIARLRRAWP---------PERLTLHAGDALKFDFGSLG--------------------
RSMA_METFK      DIIQWMQGHYP---------QDKLTIYASDALKFNFGNIS--------------------
RSMA_CHRVO      DIIERLKAEHP---------ADKLTIHAGDALAFDFASVS--------------------
RSMA_LARHH      DIIARLAAEFP---------PERLVIHEGDALAFDFGALAH-------------------
RSMA_NEIG1      DIVCRLKTLPF---------ADKLVIHEGDVLQFDFNGIS--------------------
RSMA_NEIG2      DIVCRLKTLPF---------ADKLVIHEGDVLQFDFNGIS--------------------
RSMA_NEIMA      DIVCRLKTLPF---------ADKLVIHEGDVLQFDFNGIA--------------------
RSMA_NEIM0      DIVCRLKTLPF---------ADKLVIHEGDVLQFDFNGIA--------------------
RSMA_NEIMB      DIVCRLKTLPF---------ADKLVIHEGDVLQFDFNGIA--------------------
RSMA_NEIMF      DIVCRLKTLPF---------ADKLVIHEGDVLQFDFNGIA--------------------
RSMA_DECAR      DLIARLKKQHT---------PERMTVHEGDALAFDFASIG--------------------
RSMA_NITEU      DIVDYLSRTYP---------GK-LVIHNIDALKFDFSELG--------------------
RSMA_NITEC      DIVDYLSRNYA---------EK-LVIHNVDALKFDFSALG--------------------
RSMA_NITMU      DIVKRLRNEFS---------AKRLTVHEGDALEFDFSSLG--------------------
RSMA_PSYA2      DLADSLRIRIGA-N-----SHPNFTIIKDNAMHVDYRELYSE------------------
RSMA_PSYCK      DLADSLRIRIGA-N-----SHPNFEIIKNNAMHVDYRELYSD------------------
RSMA_ACIAD      DLAAGLPDRVPH-P-----ER--LTIVEADALKYDFSQLATQ------------------
RSMA_COXBU      DLVAFLQKKYNQ-Q-----KN--ITIYQNDALQFDFSSVK--------------------
RSMA_COXB2      DLVAFLQKKYNQ-Q-----KN--ITIYQNDALQFDFSSVK--------------------
RSMA_COXBR      DLVAFLQKKYNQ-Q-----KN--ITIYQNDALQFDFSSVK--------------------
RSMA_COXBN      DLVAFLQKKYNQ-Q-----KN--ITIYQNDALQFDFSSVK--------------------
RSMA_COXB1      DLVAFLQKKYNQ-Q-----KN--ITIYQNDALQFDFSSAK--------------------
RSMA_ALCBS      DLIALLRQE-NT-P-----ER--LTIHESDALRFDFRTLKP-------------------
RSMA_HAHCH      DLTPILRTKFFN-Y-----PQ--FNVIEADALKFDFTQLATP------------------
RSMA_MARHV      DLIPVLRTKFFN-Y-----PE--FRIHEADALSFDFSQLVS-------------------
RSMA_MARMS      DLIPILKVNLFR-F-----PE--LTVHEADAMKFDFTSLTTP------------------
RSMA_PSEF5      DLIPILNQQFAG-K-----SN--FNLHQGDALKFDFNTLGAA------------------
RSMA_PSEPF      DLIPILNQQFAG-K-----SN--FNLHQGDALKFDFNSLNAA------------------
RSMA_PSE14      DLIPILTGQFGN-K-----PN--FNLHQGDALKFDFNSLGAE------------------
RSMA_PSESM      DLIPILNSQFAS-Q-----PN--FNLHQGDALKFDFNTLGAE------------------
RSMA_PSEU2      DLIPILNGQFAS-K-----PN--FNLHQGDALKFDFNTLGAD------------------
RSMA_PSEPK      DLVPILQHKFAD-R-----SN--FRLHQGDALKFDFNQLGVP------------------
RSMA_PSEAE      DLIPLLKLKFGL-E-----SR--FSLHQGDALKFDFASLVES------------------
RSMA_CHRSD      DLIPGLRVQFFN-Y-----PD--FVIHEGDALQFDFAALAAEGET---------------
RSMA_SACD2      DLIPILLAQFAI-Y-----ND--FRIHQTDALKFDFGQLATP------------------
RSMA_METCA      DLVAALKRRFAG-V-----GR--LRIHEGDAMKFDLRTIATG------------------
RSMA_LEGPC      DLQNYLTRLPVS-Q-----GK--LNLIPADALTVDFCQFGP-------------------
RSMA_LEGPA      DLQNYLTRLPVS-Q-----GK--LNLIPADALTVDFCQFGP-------------------
RSMA_LEGPL      DLQSYLTCLPVS-Q-----GK--LNLIPADALTVDFCQFGP-------------------
RSMA_LEGPH      DLQSYLTCLPAS-Q-----GK--LNLIPADALTVDFCQFGP-------------------
RSMA_NITOC      DLAAYLVERCAS-E-----GN--LRLHNVDSLTFDFRTLAHE------------------
RSMA_HYDCU      DLIGPLTKRFSH-N-----PA--FHLHHTDALLFDYSQLLEA-ET---------------
RSMA_XANAC      DLIAPLTEAAA--------PIGALRIIHRDVLSVDFTALAD-------------------
RSMA_XANC5      DLIAPLTEVAA--------PIGALSIIHRDVLSVDFTALAN-------------------
RSMA_XANOR      DLIAPLTEAAA--------PIGALSIIHRDVLSVDFTALAD-------------------
RSMA_XANOM      DLIAPLTEAAA--------PIGALSIIHRDVLSVDFTALAD-------------------
RSMA_XANOP      DLIAPLTEAAA--------PIGALSIIHRDVLSVDFTALAD-------------------
RSMA_XANCP      DLIAPLTDAAA--------PIGQLQIIHRDVLAVDFTAVAD-------------------
RSMA_XANC8      DLIAPLTDAAA--------PIGQLQIIHRDVLAVDFTAVAD-------------------
RSMA_XANCB      DLIAPLTDAAA--------PIGQLQIIHRDVLAVDFTAVAD-------------------
RSMA_XYLFA      DLIAPLTAAAT--------PLGKLDIIHRDVLTVDLSILAKPG-----------------
RSMA_XYLFT      DLIAPLTAAAT--------PIGKLDIIHRDVLTVDLSILAKQG-----------------
RSMA_DICNV      RVLQPLSEKAA--------AVGILHLIERDILNIHFAEVAP-------------------
RSMA_ACTP2      DLAERLRHHPF--------LNHKLTIIEQDALRFNFREYFESLELRE-------------
RSMA_ACTP7      DLAERLRHHPF--------LNHKLTIIEQDALRFNFREYFESLELRE-------------
RSMA_ACTPJ      DLAERLRHHPF--------LNHKLTIIEQDALRFNFREYFESLELKE-------------
RSMA_HAEDU      DLAERLRHHPF--------LHHKLTVIEQDALRFNFRDYFDSLNLNH-------------
RSMA_HAEIE      DLAERLRHHPF--------LHQKLTVIETDAMQFDFGALYTKENLAEK------------
RSMA_HAEIG      DLAERLRHHPF--------LHQKLTVIETDAMQFDFGALYTKENLAEK------------
RSMA_HAEIN      DLAERLRHHPF--------LHQKLTVIETDAMQFDFGALYTKENLAEK------------
RSMA_HAEI8      DLAERLRHHPF--------LHQKLTVIETDAMQFDFDELYTTENLAEK------------
RSMA_PASMU      DLAERLRHHPF--------LHHKITVIETDAMQFDFGQLYRDANLAEK------------
RSMA_MANSM      DLAQRLRHHPF--------LHQKLNVIETDAMQFDFGKLYEDEHLAEQ------------
RSMA_HAES1      DLAERLRHHPF--------LHQKLNVIEYDAMQFNFEQLYIDENLAEK------------
RSMA_HISS2      DLAERLRHHPF--------LHQKLNVIEYDAMQFNFEQLYIDENLAEK------------
RSMA_PSYIN      DLAARLAEHPV--------LGDKLNITQADALQFDFGKLASTE-----------------
RSMA_AERHH      DLAARLREHPT--------LKEKLTVIEADAMRFDFGTLMGEGKG---------------
RSMA_TOLAT      DLAARLREHPR--------LKDKLIVHEADAMKFNFDELAQPGR----------------
RSMA_ALIF1      DLAERLRNHPE--------LGSKLTIHEGDAMRFDFTQLIKENN----------------
RSMA_ALIFM      DLAERLRNHPE--------LGSKLTIHEGDAMRFDFTQLIKENN----------------
RSMA_ALISL      DLAARLRTHPE--------LGSKLTIYEGDAMRFDFTQLIQEGN----------------
RSMA_VIBA3      DLAERLRNHPD--------LAEKLTIYEGDAMKFDFEQLVKPNN----------------
RSMA_VIBCH      DLAERLRNHPE--------LASKLTIHEGDAMRFDFKQLVKPNN----------------
RSMA_VIBC3      DLAERLRNHPE--------LASKLTIHEGDAMRFDFKQLVKPNN----------------
RSMA_VIBCB      DLAERLRNHPE--------LADKLTIHEGDAMRFDFTQLVKPNN----------------
RSMA_VIBPA      DLAERLRNHPD--------LADKLTIHEGDAMRFDFTQLVKPNN----------------
RSMA_VIBVU      DLAERLRTHPE--------LADKLTIHEGDAMRFDFTQLVKPNN----------------
RSMA_VIBVY      DLAERLRTHPE--------LADKLTIHEGDAMRFDFTQLVKPNN----------------
RSMA_PHOPR      DLAKRLRHHPD--------LADKLTIYEGDAMRFDFTQLIKPNN----------------
RSMA_SHEB5      DLVERLHHHPV--------LKDKLTIHQGDALQFDFGQLSVPGK----------------
RSMA_SHEB2      DLVERLHHHPV--------LKDKLTIHQGDALQFDFGQLSVPGK----------------
RSMA_SHEB8      DLVERLHHHPV--------LKDKLTIHQGDALQFDFGQLSVPGK----------------
RSMA_SHEB9      DLVERLHHHPV--------LKDKLTIHQGDALQFDFGQLSVPGK----------------
RSMA_SHEPC      DLVERLHKHPV--------LKDKLTIHQGDALQFDFSQLVVPGK----------------
RSMA_SHESW      DLVERLHKHPV--------LKDKLTIHQGDALQFDFSQLVVPGK----------------
RSMA_SHESM      DLVERLQNHPV--------LKDKLTIHQGDALQFDFSQLVVPGK----------------
RSMA_SHESR      DLVERLQNHPV--------LKDKLTIHQGDALQFDFSQLVVPGK----------------
RSMA_SHESA      DLVERLQNHPV--------LKDKLTIHQGDALQFDFSQLVVPGK----------------
RSMA_SHEON      DLVERLQNHPV--------LKDKLTIHQGDALQFDFSQLVVPGK----------------
RSMA_SHEDO      DLVERLQNHPT--------LKDKLDIHQGDALQFDFSTLQQAGK----------------
RSMA_SHEFN      DLVKRLQYHPV--------LKDKLTIHQGDALQFDFGQLQQPGK----------------
RSMA_SHEHH      DLVERLQTHPV--------LKDKLEIHQGDALKFDFNQLVREDK----------------
RSMA_SHEPA      DLVERLKEHPV--------LKDKLEIHQGDALKFDFNQLVREDK----------------
RSMA_SHEPW      DLVERLKTHPT--------LKDKLEIHQGDALNFDFKQLVREDM----------------
RSMA_SHESH      DLVERLKEHPT--------LKHKLDIHQGDALKFDFSQLVEEGR----------------
RSMA_SHEWM      DLVARLQEHPT--------LKDKLDIHQGDALQFDFSQLVEEGR----------------
RSMA_SHELP      DLVERLQTHPF--------LKDKLEIHQGDALKFDFKQLVEEGK----------------
RSMA_SHEAM      DLAERLKVHPT--------LKDKLTIHQGDAMKFDFSQLVEPER----------------
RSMA_PSET1      DLAQRLIEHPF--------LGPKLTVNQGDAMTFDFASLVRDDK----------------
RSMA_COLP3      DLAHRLRHHPF--------LAKDLTIYETDALKFDFSELATEEQ----------------
RSMA_IDILO      DLVERLQHHPF--------LSSKLEVIQADALSIDFSQFAEEGP----------------
RSMA_SALA4      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALDC      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALEP      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALG2      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALHS      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALPA      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALPK      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALPB      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALPC      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALTI      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALTY      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALAR      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALNS      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALCH      DLAARLQTHPF--------LGSKLTIYQQDAMTMNFGELSAQLG----------------
RSMA_SALSV      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSTQLG----------------
RSMA_CITK8      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELSEKIG----------------
RSMA_KLEP3      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELAEKMG----------------
RSMA_KLEP7      DLAARLQTHPF--------LGPKLTIYQQDAMTMNFGELAEKMG----------------
RSMA_ECOUT      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAAKMG----------------
RSMA_ECO27      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAAKMG----------------
RSMA_ECOK1      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAAKMG----------------
RSMA_ECO45      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAAKMG----------------
RSMA_ECOL6      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAAKMG----------------
RSMA_ECOL5      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAAKMG----------------
RSMA_ECO81      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAAKMG----------------
RSMA_ECO55      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECOLC      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECOHS      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_SHIBS      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECOBW      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECODH      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECOLI      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECOSM      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECO7I      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECO8A      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_SHIF8      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_SHISS      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_SHIB3      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECOSE      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECO57      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECO5E      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_SHIFL      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ESCF3      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_SHIDS      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECO24      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_ECOLU      DLAARLQTHPF--------LGPKLTIYQQDAMTFNFGELAEKMG----------------
RSMA_CROS8      DLAARLQTHPF--------LGPKLTIYQQDAMTMDFGELSQKMG----------------
RSMA_ENT38      DLAARLKTHPF--------LGPKLTIYQQDAMTMNFAELSEKLG----------------
RSMA_PECAS      DLAARLEKHPT--------LKDKLTIIQQDAMTIDFAALAEQAG----------------
RSMA_PECCP      DLAARLETHPT--------LKDKLTIIQQDAMTIDFAALAEQAG----------------
RSMA_YERPE      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERPP      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERPN      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERPG      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERPA      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERPS      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERPB      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERP3      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERPY      DLAARLASHPQ--------LKDKLTIHQQDAMKVNFSELSEQAG----------------
RSMA_YERE8      DLADRLASHPQ--------LKDKLTIHQEDAMKINFSELAELAG----------------
RSMA_SERP5      DLAARLANHPQ--------LKDKLTIHQQDAMTVNFAEMAEQAG----------------
RSMA_PHOLL      DLAARLQVHPQ--------LKDKLTIIQQDAMTVNFGELSQQRG----------------
RSMA_ERWT9      DLAARLQTHPF--------LGPKLTIFQQDAMTFDFAALAQEKG----------------
RSMA_SODGM      DLAARLASHPF--------LQSKLNIVQKDAMTVDFAALSAERG----------------
RSMA_PROMH      DLAARLEVHPT--------LKDKLTIIQQDAMTIDFAQLAKERQ----------------
RSMA_HAMD5      HLADRLNQHPQ--------LKDKLILYQQDVMTVNFSELSATFK----------------
RSMA_BAUCH      NLVAYLANHPI--------LQHKLNILSQDVMKVNFSDLAKKLS----------------
RSMA_BLOFL      NLVNRLLHTF---------TSKKVKIFNKDAMTIDFSKLLTNPN----------------
RSMA_BLOPB      NLVNRLVQMF----------NKKINILHQDIMTTNFFDLSHKVG----------------
RSMA_BUCAI      DLLFLLKKRS---------FYSKLIVFYQNALNFNFLNLFHKKK----------------
RSMA_BUCAP      NLLNFLKKYS---------FYSKLIVFCQDALIFDYLNLFYKKN----------------
RSMA_BUCBP      NLGTRLLKD-----------ISNIEVFVEDVLKFNFLNLINNSF----------------
RSMA_WIGBR      NLVYFLNKNKN--------IKNNLNIINIDIMKLNLKKFFSSFC----------------
RSMA_FRATF      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRATH      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRATO      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRATM      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRATW      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRATT      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRAT1      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRATN      SVIDTLIANCQ--------KYGTPHIYNQDFLKFDISSLENSSN----------------
RSMA_FRAP2      SVIDTLLQNCQ--------KYGEPKVFNEDFLKFDLDIVRADSQ----------------
RSMA_BACFR      ESVAYLREAYP---------SLEDNIIEDDFLKMNLQRLFD-------------------
RSMA_BACFN      ESVAYLREAYP---------SLEDNIIEDDFLKMNLQRLFD-------------------
RSMA_BACTN      ESVAYLREAYP---------SLEDHIIEDDFLKMNLHRLFD-------------------
RSMA_BACV8      ESVAYLRENFP---------ALEDNIIEDDFLKLNLEKLFD-------------------
RSMA_PARD8      ESVDYLNQNFP---------DLKGRIIAEDFLKLDLSKLFP-------------------
RSMA_PORGI      ESVSYLREEFP---------ELSDRIIEGDFLHYPLSELFPG------------------
RSMA_PORG3      ESVSYLREEFP---------ELSDRIIEGDFLHYPLSELFPG------------------
RSMA_FLAJ1      ESVEYLGVNYP---------KLKDKIISEDFLKYNINQVYE-------------------
RSMA_FLAPJ      ESVTYLDQNYP---------KLKDKIISKDFLKYNINEIFE-------------------
RSMA_CYTH3      ESIEYLKKVFP---------QLKDDVIHGDFLKADLADWYP-------------------
RSMA_CHLP8      ELARFIREEHP-----------EINLIEGDFLKVPLEPLTGS------------------
RSMA_CHLTE      ELAKFNREEHP-----------QIELIEDDFLKVPLEPLAAG------------------
RSMA_CHLPB      ILAEFIRNEYP-----------SVRVIEMDFLKIDLEELASE------------------
RSMA_PROA2      KLADFIREEYP-----------SVNLVESDILEVDFAKLAEE------------------
RSMA_CHLL2      KLAAFIRTEYP-----------QLNVIEADFLKIDLEAVTGA------------------
RSMA_CHLPD      KLASFIRNEYP-----------ELTVIEGDFLTVDLKKIAGE------------------
RSMA_PELLD      ALAAFIRQEYP-----------QLQLIEADFLDIDLERLAAG------------------
RSMA_CHLCH      TLATFIRNEYP-----------QIKVIEGDVLTINFSAMAQAG-----------------
RSMA_SALRD      RAVEVLRERVP-----------EADVRETDVRETDWAALADEKG----------------
RSMA_ANAD2      DMVRVLRGELGD----------RITLLEADAARLDYADLAARFGAAAAAGE---------
RSMA_ANASK      DMVRVLRGELGD----------RITLLEADAARLDYADLAARFGAAAAAGE---------
RSMA_ANADE      DMARVLRGELGD----------RITLLEADAARLDHAALAARFGAPAAAGE---------
RSMA_MYXXD      DMVMVLEKEAIP----------GVRVVSGNAATVDFAQVAG-------------------
RSMA_GEOMG      RLVPVLRQAFRD--------NPRVEIVHGDILEIDLRDLLAYEGG---------------
RSMA_GEOSL      RLVPLLRGSFAG--------NPSVTIIEGDILDLDLRETLGRYGT---------------
RSMA_PELCD      DLGAGLQARDED----------KLVVHLGDALKLDWTALLTD------------------
RSMA_MAGMM      KLLPLLRVEAAG--------VGALTLVEEDALLVDYTALAQQLG----------------
RSMA_DESAH      RLAGILMEELKRES-----I-ENVELINNDILHQDL-NTLFR------------------
RSMA_DESOH      RLIEPLKETVRAAG-----L-DNVTVLHRDIMKTDI-REICREA----------------
RSMA_DESPS      GIIKYHEEEQD--L-----P-DNVTLIHQDVLKVGF-GDLAEKC----------------
RSMA_SYNAS      KLVSVLKERLK--E-----Y-HNVTVIHGDILKYDFLTALGENS----------------
RSMA_MYCCT      DMVEILKTKFN---------HSNLEIIQADVLEIDLKQLIS-------------------
RSMA_MYCMS      DMVEILKAKFD---------HSNLEIIQADVLEIDLKQLIS-------------------
RSMA_MESFL      DMEPILKKEIT---------NDNFELFLSDVLLVDFEKLIKEKR----------------
RSMA_FUSNN      DLENTLRKKFSS--------KENYTLVMEDVLEVDLRRYIN-------------------
RSMA_AYWBP      TLKPFLNFENH----------NNVNIIYDDFLKRDLLKDFDHY-----------------
RSMA_ONYPE      TLKPFLNFENH----------NNVNIIYDDFLKRDLLKDFDHY-----------------
RSMA_PHYAS      TLKPFLVFDT-----------TKIKIIYDDFLKRDLVKDFDNY-----------------
RSMA_MYCH7      NLIPILEKKFK---------NKNLRIINEDFLLAELEFKEKK------------------
RSMA_MYCHJ      NLIPILEKKFK---------NKNLRIINEDFLLAELEFKEKK------------------
RSMA_MYCH2      NLIPILEKKFK---------NKNLRIINEDFLLAEFESKEKK------------------
RSMA_MYCMO      ELIPFLKEKIK---------AKNFTLKHEDFLKSEIDFQDKK------------------
RSMA_MYCS5      SLIEHLKNEIK---------DLHFELRDQDFLNVNLNDDEFKD-----------------
RSMA_MYCPU      DMVNILNQQIS---------SKNFVLINKDFLKEEFD--KSQN-----------------
RSMA_MYCA5      DLFKKLLVENQ---------NSNVRFINEDFLNATFD--EKKE-----------------
RSMA_KORVE      VLAAQLRLRYSR--------LENVEILEADILAVELSTVLAQRIGPLRDL----------
RSMA_ACIC5      ELAPRLRERFAR--------RETVTVIEDDVLRVDLSALA--------------------
RSMA_THEMA      SLAPILQERLSK--------YPNVELRFEDFLKAK-------------------------
RSMA_THESQ      SLAPILQERLSK--------YPNVELRFEDFLKAK-------------------------
RSMA_THEP1      SLAPVLRERLSK--------YPNVELRFEDFLKAK-------------------------
RSMA_THENN      GLAPILQERLSK--------YPNVELRFEDFLKAR-------------------------
RSMA_NOSS1      DLCELLAKQLGKK--------ENFLLLQGDFLTIDLAANLGSFPKF--------------
RSMA_TRIV2      DLCKLLVKQLGQK--------ENFLLLQGDFLTLDLVANLLTFPKF--------------
RSMA_NOSP7      DLCQLLSKQLGKT--------ENFLLLQGDFLTLDLPSYLVAFPNF--------------
RSMA_CROS5      DLCKKLVKSLGDE--------DNFLLLQGDILKLDIATEAQQFPKF--------------
RSMA_RIPO1      DLCYRLAKSFGNF--------NHFLLLEGDILSLDLTTQLEQFPQF--------------
RSMA_SYNY3      DLCLKLRKKLGQR--------ENFLLLEGDVLILDLNALLQDFPQF--------------
RSMA_ACAM1      DLCKSLRHTFNDQ--------ENFTLLELDFLNLDVAAELTE------------------
RSMA_SYNE7      DLIGQLQQRFGQA--------ENFCLLEGDILQLDWTAAIADRPRF--------------
RSMA_SYNP6      DLIGQLQQRFGQA--------ENFCLLEGDILQLDWTAAIADRPRF--------------
RSMA_SYNP2      DLCKYMVKNYGDR--------PNFLLLEADYLQTDINEFLGDFPQF--------------
RSMA_THEEB      DLCGQLRRQFDS---------ERFQLIEGDILRLDLAP----------------------
RSMA_SYNJB      DLCRLLRKRFADQ--------PRFHLVEGDFLRLPLPP----------------------
RSMA_SYNJA      DLCRLLQKRFADQ--------PRFHLVEGDFLRLPLPP----------------------
RSMA_GLOVI      RAVAQLQRQFGGD--------KRFVLVEGDILREALPE----------------------
RSMA_PROMA      ELIVGLKQRFAGQ--------SRFTLQEGDALSVSLLPHDG-------------------
RSMA_PROM4      DLVVGLRERFFHE--------TRFSLKGGDALKISLLPPDG-------------------
RSMA_PROM3      DLVSGLRQRFADQ--------ARFSLQEGDVLSVPLTLADG-------------------
RSMA_PROMM      DLVSGLKQRFADQ--------ARFSLQEGDVLSVPLTLADG-------------------
RSMA_SYNS3      DLVAGLQQTFASH--------PKFSLQEGDVLSVPLELSGG-------------------
RSMA_SYNPW      DLVAGLQDRFGDS--------PRFSLREGDVLAVPLTLPDG-------------------
RSMA_SYNSC      DLVQGLRDRFVVQ--------PGFSLHQGDVLEAPLELSDG-------------------
RSMA_SYNPX      DLVDGLRERFAGD--------PRFSLRQGDVLELPLQLEDG-------------------
RSMA_SYNS9      DLVRGLHDRFGSE--------SRFSLREGDVLEAPLHLVDG-------------------
RSMA_SYNR3      DLVAGLQQRFAAE--------PRFQLQSGDVLALPQLGDGE-------------------
RSMA_PROM1      DLVIGLKKRFNHQ--------NKFSLREGDILSAPLDAENG-------------------
RSMA_PROMT      DLVVGLKKRFSHQ--------NKFSLREGDILSAPLDAENG-------------------
RSMA_PROM0      DLINLLNDKFNNN--------DKFSLQQGDILSVNLDSIN--------------------
RSMA_PROM9      DLINLLNDKFNNN--------DKFSLQQGDILSVNLDSIN--------------------
RSMA_PROMS      DLINLLNDKFNNN--------DKFSLQQGDILTVNLDSIN--------------------
RSMA_PROM2      DLINLLNDKFNNN--------DKFSLQHGDILSVNLDSIN--------------------
RSMA_PROM5      DLIDLLNNKFRND--------KKFSLQQGDILSTNLDSIN--------------------
RSMA_PROMP      DLIDLLNNKFRND--------KNFSLQQGDILSTNLDSIN--------------------
RSMA_TREPA      GFVQTLRKLFDAHVR----------VIEGDVLQQWHAAAAQE------------------
RSMA_TREPS      GFVQTLRKLFDAHVR----------VIEGDVLQQWHAAAAQE------------------
RSMA_TREDE      GFISLLKKIFLENSKQ------NFTLIEGDVQKNWLPYLIEHG-----------------
RSMA_BORAP      KYSEILNEKFGKLK--------NFKLIKGDFL--------KKYPNENKN-----------
RSMA_BORBP      KYSEILNEKFGKLK--------NFKLIKGDFL--------KKYPNENKN-----------
RSMA_BORBU      KYSEILNEKFGKLK--------NFKLIKGDFL--------KKYKNENQN-----------
RSMA_BORBZ      KYSEILNEKFGKLK--------NFKLIKGDFL--------KKYKNENQN-----------
RSMA_UREPA      RLYAHLKTYIKT-S--------NFHIINNDVLCVDLDNLILDYNNTQKIQ----------
RSMA_UREP2      RLYAHLKTYIKT-S--------NFHIINNDVLCVDLDNLILDYNNTQKIQ----------
RSMA_UREU1      RLYAHLKTYIKA-P--------NFHIINNDVLCVDLDKLILDYTNTKKNQ----------
RSMA_MYCPE      RLVEFLKQEYK-----------ELRIINIDVL-------KFDFKEFNKDT----------
RSMA_MYCGE      RLIEYLLVEKILTE--------DQLVKGDILK--------KDFNSFFENL----------
RSMA_MYCPN      RLAEYLLVNEILTE--------EQLTIGDALK--------QNLDQYFPDT----------
RSMA_MYCGA      KLFHHL--NERLLK--------DHILHADALE--------IDWKSIFDNLG---------
RSMA_ARCB4      DLIGILKSKFAIEIE-----KGNLKLIHTDVLEAWDKLKNLH------------------
RSMA_SULDN      DLCKVLQNKFEREIA-----TKQLRIHCGDVLTAWKS--ELI------------------
RSMA_HELHP      DLCSLLNKKFSNQIQ-----SGRLNIIYKDILNLPSQQAWLH------------------
RSMA_CAMC1      ELFQILKVKFANEIQ-----NGQLKLFCKDALEQWQQEGGLS------------------
RSMA_CAMC5      ELFALLGKKFAKEVQ-----NGRLKLFCKDALEKWD-EGGVS------------------
RSMA_CAMHC      DLIEFLKSKFACELE-----NRKFELVFGDALKFWK--NGLC------------------
RSMA_CAMFF      ELYTILLDKFRSELD-----SGKLNIINSDALNAWD---KLS------------------
RSMA_CAMJE      DLIPILKKKFQKELE-----CGKFNLIHQDASEAFN--PSLD------------------
RSMA_CAMJR      DLIPILKKKFQKELE-----CGKFNLIHQDASEAFN--PSLD------------------
RSMA_HELPY      HLCEKMRSKLKAQKK-----PFKLELVEKDALFLKE------------------------
RSMA_HELPH      SLCEKMRSKLKVQKK-----PFKLELVEKDALFLKE------------------------
RSMA_HELPG      NLCEKMRARLKAQKK-----PFQLELVEKDALFLKE------------------------
RSMA_HELP2      NLCEKMRSKLKAQKK-----PFKLELVEKDALFLKE------------------------
RSMA_HELPS      SLCEKMRSKLKAQKK-----PFALELVEKDALFLKE------------------------
RSMA_HELPJ      NLCEKMRARLRAEKK-----PFQLELVEKDALFLKE------------------------
RSMA_HELAH      SLCEKMRERLKKQKK-----PFELELAEKDALFLKE------------------------
RSMA_BDEBA      AIAAYWREK-------------GLTVIEQDALRLDWKQFYTG------------------
                                                                            

RSMA_RHIEC      --------------------------------------EG--PVKIIANLPYNVGTQLLV
RSMA_RHIE6      --------------------------------------EG--AVKIIANLPYNVGTQLLV
RSMA_RHILW      --------------------------------------DG--PIKIIANLPYNVGTQLLV
RSMA_RHIL3      --------------------------------------QG--PIKIIANLPYNVGTQLLV
RSMA_AGRVS      --------------------------------------DG--PVKIVANLPYNVGTQLLI
RSMA_RHIME      --------------------------------------DG--PVRIIANLPYNVGTQLLV
RSMA_SINMW      --------------------------------------DG--PVRIIANLPYNVGTQLLV
RSMA_SINFN      --------------------------------------EG--PVRIIANLPYNVGTQLLV
RSMA_AGRFC      --------------------------------------AGE-PVRIIANLPYNVGTQLLV
RSMA_CHESB      -------------------------------------GNSG-DVKIVANLPYNIGTELLI
RSMA_RHILO      -------------------------------------GASG-QVRIVANLPYNIGTELLV
RSMA_BARHE      --------------------------------------ISPEKPRIIANLPYNIGTQLLL
RSMA_BARQU      --------------------------------------TYPEKPRIIANLPYNIGTQLLL
RSMA_BART1      --------------------------------------SSPEKPRIIANLPYNIGTQLLL
RSMA_BARBK      --------------------------------------TYPEKPRIIANLPYNIGTQLLL
RSMA_BRUA2      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUA1      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUC2      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUMB      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUO2      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUSU      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUME      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUSI      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_BRUAB      --------------------------------------EGP-KPRIVANLPYNVGTQLLL
RSMA_OCHA4      --------------------------------------DGP-KPRIVANLPYNVGTQLLL
RSMA_AZOC5      ---------------------------------------GA-EARVVANLPYNVGTQLLV
RSMA_XANP2      ---------------------------------------DG-EVRVVANLPYNIATLLLI
RSMA_METRJ      ---------------------------------------DA-PARIVANLPYNVGTALLT
RSMA_BRASB      ---------------------------------------ST-KAKIVANLPYNIATHLLI
RSMA_BRASO      ---------------------------------------ST-KAKIVANLPYNIATHLLI
RSMA_BRADU      ---------------------------------------GE-SAKIVANLPYNIATQLLI
RSMA_NITHX      ---------------------------------------TT-RAKIVANLPYNIATALLI
RSMA_NITWN      ---------------------------------------TT-RAKIVANLPYNIATALLI
RSMA_RHOPA      ---------------------------------------GD-RARIVANLPYNIATPLLI
RSMA_RHOPT      ---------------------------------------GD-RARIVANLPYNIATPLLI
RSMA_RHOPS      ---------------------------------------GE-RAKIVANLPYNIATPLLI
RSMA_RHOP2      ---------------------------------------GA-RARIVANLPYNIATPLLI
RSMA_RHOP5      ---------------------------------------GA-RAKIVANLPYNIATPLLI
RSMA_RHOPB      ---------------------------------------GA-RAKIVANLPYNIATPLLI
RSMA_OLICO      ---------------------------------------GE-RARIVANLPYNIATLLLT
RSMA_RUEPO      -----------------------------------------PPIRIAANLPYNVGTELLV
RSMA_RUEST      -----------------------------------------PPIRVAANLPYNVGTELLV
RSMA_ROSDO      -----------------------------------------PPIRVAANLPYNVGTELLV
RSMA_PARDP      -----------------------------------------PPIRIVANLPYNVGTELLI
RSMA_DINSH      -----------------------------------------PPIHIAANLPYNVGTELLV
RSMA_RHOS4      -----------------------------------------PPIRIVANLPYNVGTELLT
RSMA_RHOS1      -----------------------------------------PPIRIVANLPYNVGTELLT
RSMA_RHOSK      -----------------------------------------PPIRIVANLPYNVGTELLT
RSMA_RHOS5      -----------------------------------------PPIRIVANLPYNVGTELLT
RSMA_JANSC      -----------------------------------------APRKIVANLPYNVGTELLV
RSMA_ERYLH      ------------------------------------------PFAVVANLPYNVGTALFV
RSMA_NOVAD      ------------------------------------------PWHVAANLPYNVGTQLFT
RSMA_SPHAL      ------------------------------------------PYHIVANLPYNVGTALFT
RSMA_ZYMMO      ------------------------------------------HVHIVANLPYNVGTALLI
RSMA_MAGSA      ------------------------------------------PRRIVANLPYNISTALLL
RSMA_RHORT      ------------------------------------------PRRVIANLPYNVATPLLI
RSMA_GLUOX      ------------------------------------------PRQIIANLPYNVATPLLV
RSMA_CAUVC      -----------------------------------------GPAHVVSNLPYNVGTQLLI
RSMA_PHEZH      -----------------------------------------RPAHLVSNLPYNVGTPLLI
RSMA_MARMM      -----------------------------------------GDKVILSNLPYNVGTQLLI
RSMA_ANAMF      -----------------------------------------APSKMIANLPYNISVILLL
RSMA_ANAMM      -----------------------------------------APSKMIANLPYNISVILLL
RSMA_ANAPZ      -----------------------------------------SPLKMISNLPYNISVILLL
RSMA_EHRCJ      -----------------------------------------PPVKIIANLPYHIATPLLM
RSMA_EHRCR      -----------------------------------------PPVKVIANLPYHIATTLLI
RSMA_EHRRG      -----------------------------------------PPVKVIANLPYSIATLLLI
RSMA_EHRRW      -----------------------------------------PPVKVIANLPYSIATLLLI
RSMA_WOLPM      -----------------------------------------RPVKVIANLPYNISVALFL
RSMA_WOLWR      -----------------------------------------RPVKVIANLPYNISVVLFL
RSMA_WOLTR      -----------------------------------------RPVKVIANLPYNISLALFL
RSMA_WOLPP      -----------------------------------------CPVKVIANLPYNISVALFL
RSMA_NEOSM      -----------------------------------------EKVTIIANLPYNIATHLLL
RSMA_RICPU      NRR---------------------------ANDIGESKAIDYKVTIISNLPYHIGTELVI
RSMA_RICRS      NRR---------------------------ANDIGESKLIDYKVTIISNLPYHIGTELVI
RSMA_RICAE      NRR---------------------------ANDIGESKSIDYKVTIISNLPYHIGTELVI
RSMA_RICFE      ------------------------------------------KVTIISNLPYHIGTELVI
RSMA_RICAH      ------------------------------------------KVTIISNLPYHIGTELVI
RSMA_RICCK      ------------------------------------------KVTIISNLPYHIGTELVI
RSMA_RICPR      ------------------------------------------KVTVISNLPYHIGTELVI
RSMA_RICTY      ------------------------------------------KVTVISNLPYHIGTELVI
RSMA_RICB8      ------------------------------------------KITIISNLPYHIGTELVI
RSMA_RICBR      ------------------------------------------KITIISNLPYHIGTELVI
RSMA_PELUB      ------------------------------------------KLSVFGNLPYNISTEILS
RSMA_PERMH      -----------------------------------------GKIKLTGNLPYNVASHILV
RSMA_SULSY      -----------------------------------------EKIKLVGNLPYNVASLMII
RSMA_AQUAE      -----------------------------------------KELKVVGNLPYNVASLIIE
RSMA_HYDS0      ------------------------------------------NLKIIGNLPYNMYASILI
RSMA_DESVH      -----------------------------------------HPWKVIGNLPYNVASPLMW
RSMA_DESVV      -----------------------------------------HPWKVIGNLPYNVASPLMW
RSMA_DESAG      -----------------------------------------RSWKLIGNLPYNVASPLMW
RSMA_DESAD      -----------------------------------------RNWKIVGNLPYNVASKIMW
RSMA_LAWIP      ------------------------------------------SWKVISNLPYNVGSALIW
RSMA_HALMA      ------------------------------------------FTASISNLPYGASSEIAF
RSMA_NATPD      ------------------------------------------FTASVSNLPYGVSSEIAF
RSMA_HALWD      ------------------------------------------FTTCISNLPYGISSEILF
RSMA_HALSA      ------------------------------------------FTCAVSNLPYGVASEVTF
RSMA_HALS3      ------------------------------------------FTCAVSNLPYGVASEVTF
RSMA_METHJ      ------------------------------------------FEIVMANLPYSISSPITF
RSMA_METAC      ------------------------------------------FDKVVSNLPYSISSEITF
RSMA_METMA      ------------------------------------------FDKVVSNLPYSISSEITF
RSMA_METBF      ------------------------------------------FDKIVSNLPYSISSEITF
RSMA_METBU      ------------------------------------------FNKVVANLPYSISSPITF
RSMA_ARCFU      ------------------------------------------FTKFVANIPYKISSPLTF
RSMA_METTH      ------------------------------------------FNKVVSNLPYQISSPITF
RSMA_METST      ------------------------------------------FDKVVSNLPYQISSPVTF
RSMA_PYRAB      ------------------------------------------FNKVVSNIPYQISSPFTF
RSMA_PYRHO      ------------------------------------------FNKVVSNIPYKISSPFTF
RSMA_PYRFU      ------------------------------------------FNKVVSNIPYQISSPFTF
RSMA_THEKO      ------------------------------------------FNKMVSNLPYQISSPVTF
RSMA_THEGJ      ------------------------------------------FNKMVSNLPYQISSPVTF
RSMA_THEON      ------------------------------------------FNKIVSNLPYQISSPITF
RSMA_THESM      ------------------------------------------FNKVVSNLPYQISSPITF
RSMA_METKA      ------------------------------------------VNKVVANIPYNISSPITF
RSMA_METM6      ------------------------------------------FNKIVANLPYQISSPITF
RSMA_METM7      ------------------------------------------FNKIVANLPYQISSPITF
RSMA_METMP      ------------------------------------------FNKIVANLPYQISSPITF
RSMA_METM5      ------------------------------------------FNKIVANLPYQISSPITF
RSMA_METVS      ------------------------------------------FNKIVANLPYQISSPITF
RSMA_META3      ------------------------------------------FNKVVANLPYQISSPITF
RSMA_METJA      ------------------------------------------FNKVVANLPYQISSPITF
RSMA_PYRAE      ------------------------------------------ADFFVSNVPYSITSPLLF
RSMA_PYRIL      ------------------------------------------ADFFVSNIPYSITSPLLL
RSMA_RUBXD      ----------------------------------------PPPNRLAANLPYNIASPLVL
RSMA_NATTJ      ---------------------------------------NPKNLKAVSNLPYYIASPLVL
RSMA_RHOBA      ---------------------------------------DDSKFMLVANLPYNVATPIVS
RSMA_PAEAT      ----------------------------------------LPPTALVANLPYNVAVPVVL
RSMA_ARTS2      ----------------------------------------VEPTALVANLPYNVAVPVVL
RSMA_STRAW      ----------------------------------------PPPTALVANLPYNVAVPVLL
RSMA_STRCO      ----------------------------------------PAPTALVANLPYNVAVPVLL
RSMA_STRGG      ----------------------------------------PAPTALVANLPYNVAVPVLL
RSMA_THEFY      ----------------------------------------PQPTALVANLPYNVAVPVVL
RSMA_KINRD      ----------------------------------------PPPTALVANLPYNVAVPVLL
RSMA_LEIXX      ----------------------------------------ERPGRLVANLPYNVSVPVLL
RSMA_CUTAK      ----------------------------------------AEPTALVANLPYNVAVPVLL
RSMA_CORGL      -----------------------------------------QPTALVANLPYNVSVPVLL
RSMA_CORGB      -----------------------------------------QPTALVANLPYNVSVPVLL
RSMA_COREF      -----------------------------------------QPTALVANLPYNVSVPVLL
RSMA_CORDI      -----------------------------------------HPTALVANLPYNVSVPVLL
RSMA_CORJK      ---------------------------------------RPLPTALVANLPYNVSVPVLL
RSMA_MYCA1      -----------------------------------------PPTAVVANLPYNVAVPALL
RSMA_MYCPA      -----------------------------------------PPTAVVANLPYNVAVPALL
RSMA_MYCLE      -----------------------------------------EPTALVANLPYNVAVPALL
RSMA_MYCLB      -----------------------------------------EPTALVANLPYNVAVPALL
RSMA_MYCTU      -----------------------------------------APTAVVANLPYNVAVPALL
RSMA_MYCTA      -----------------------------------------APTAVVANLPYNVAVPALL
RSMA_MYCBT      -----------------------------------------APTAVVANLPYNVAVPALL
RSMA_MYCBO      -----------------------------------------APTAVVANLPYNVAVPALL
RSMA_MYCBP      -----------------------------------------APTAVVANLPYNVAVPALL
RSMA_MYCGI      -----------------------------------------MPTALVANLPYNVAVPALL
RSMA_MYCVP      -----------------------------------------MPTALVANLPYNVAVPALL
RSMA_MYCSJ      -----------------------------------------QPTALVANLPYNVAVPALL
RSMA_MYCSS      -----------------------------------------QPTALVANLPYNVAVPALL
RSMA_MYCSK      -----------------------------------------QPTALVANLPYNVAVPALL
RSMA_RHOOB      -----------------------------------------EPTALVANLPYNVAVPVLL
RSMA_RHOJR      -----------------------------------------EPTALVANLPYNVAVPVLL
RSMA_RHOE4      -----------------------------------------EPTALVANLPYNVAVPVLL
RSMA_NOCFA      -----------------------------------------SPTALVANLPYNVAVPVLL
RSMA_BIFLD      ---------------------------------------DDASFTLVANLPYNVATPILL
RSMA_BIFLS      ---------------------------------------DDASFTLVANLPYNVATPILL
RSMA_BIFLO      ---------------------------------------DDASFTLVANLPYNVATPILL
RSMA_BIFAA      ---------------------------------------DDDSFTLVANLPYNVATPILL
RSMA_ACIC1      -----------------------------------------DPTVLVANLPYNVAVPAVL
RSMA_OPITP      ---------------------------------------HAAAFKIVANLPYAIATPWLD
RSMA_DEIGD      ------------------------------------------GTRVIANLPYYITGPLLA
RSMA_DEIRA      ------------------------------------------GTRVIANLPYYITGLLLT
RSMA_THET2      ------------------------------------------GSLLVANLPYHIATPLVT
RSMA_THET8      ------------------------------------------GSLLVANLPYHIATPLVT
RSMA_CHLTR      ------------------------------------------KGRIVANLPYHITTPLLT
RSMA_CHLTA      ------------------------------------------KGRIVANLPYHITTPLLT
RSMA_CHLT2      ------------------------------------------KGRIVANLPYHITTPLLT
RSMA_CHLTB      ------------------------------------------KGRIVANLPYHITTPLLT
RSMA_CHLMU      ------------------------------------------KGRIVANLPYHITTPLLT
RSMA_CHLCV      ------------------------------------------KGRVVANLPYHITTPLLT
RSMA_CHLFF      ------------------------------------------KGRVVANLPYHITTPLLT
RSMA_CHLAB      ------------------------------------------KGRVVANLPYHITTPLLR
RSMA_CHLPN      ------------------------------------------KGRVVANLPYHITTPLLT
RSMA_PARUW      -----------------------------------------QKAKVIANLPYHLTTPILA
RSMA_ALKMQ      -----------------------------------------KPVKVIANLPYYVTTPIVM
RSMA_ALKOO      -----------------------------------------RNVKVIANLPYYVTTPIIM
RSMA_CLOD6      -----------------------------------------GPVKLVANLPYYITTPIVM
RSMA_LACP7      -----------------------------------------KPIKVVANLPYYITTPIIM
RSMA_CLOPE      -----------------------------------------KSVKLVANLPYYVTTPIIV
RSMA_CLOP1      -----------------------------------------KSVKLVANLPYYVTTPIIV
RSMA_CLOPS      -----------------------------------------KSVKLVANLPYYVTTPIIV
RSMA_CLOAB      -----------------------------------------QSVKLVANLPYYVTTPIIS
RSMA_CLOB6      -----------------------------------------DSIKLVANLPYYVTTPIIS
RSMA_CLOBJ      -----------------------------------------DSIKLVANLPYYVTTPIIS
RSMA_CLOB1      -----------------------------------------DSIKLVANLPYYVTTPIIS
RSMA_CLOBL      -----------------------------------------ESIKLVANLPYYVTTPIIS
RSMA_CLOBK      -----------------------------------------DSIKLVANLPYYVTTPIIS
RSMA_CLOBM      -----------------------------------------DSIKLVANLPYYVTTPIIS
RSMA_HALOH      -----------------------------------------RSVKVLANLPYYITTPVIM
RSMA_MOOTA      ----------------------------------------LPTYKVVANLPYYITTPILM
RSMA_PELTS      ---------------------------------------GGKKYKLLANLPYYLTGPLLL
RSMA_SYMTH      ----------------------------------------GQKAKVVANLPYYITTPLVM
RSMA_CALS4      -----------------------------------------NSFKVVANLPYYITSPIIM
RSMA_DEHMB      -----------------------------------------VPYKLVANLPYYITSAVLR
RSMA_DEHMC      -----------------------------------------VPYKLVANLPYYITSAVLR
RSMA_DEHM1      -----------------------------------------IPYKLVANLPYYITSAVLR
RSMA_DESHD      -----------------------------------------KGV-LVGNLPYYITSPLLM
RSMA_DESHY      -----------------------------------------KGV-LVGNLPYYITSPLLM
RSMA_GEOKA      ----------------------------------------VSDRMVVANLPYYVTTPIIM
RSMA_GEOTN      ----------------------------------------VSDRMVVANLPYYVTTPIIM
RSMA_GEOSW      ----------------------------------------MTDIMVVANLPYYVTTPIIM
RSMA_ANOFW      ----------------------------------------VDDIMVVANLPYYVTTPIIM
RSMA_BACLD      ----------------------------------------CDEVMVVANLPYYVTTPIIM
RSMA_BACSU      ----------------------------------------CDEIMVVANLPYYVTTPIIM
RSMA_BACP2      ----------------------------------------CKEVMVVANLPYYVTTPIIM
RSMA_BACAN      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACAA      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACHK      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACCZ      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACAC      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACC7      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACC0      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACC1      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACCQ      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACCR      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACC4      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACC2      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACC3      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACAH      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACMK      ----------------------------------------GQDVMVVANLPYYITTPILF
RSMA_BACCN      ----------------------------------------GQDVMVVANLPYYVTTPILF
RSMA_BACHD      ----------------------------------------GQDLMVVANLPYYVTTPILM
RSMA_LYSSC      ----------------------------------------IEDIMVVANLPYYVTTPILM
RSMA_BACSK      ----------------------------------------GQAIHVVANLPYYVTTPILM
RSMA_OCEIH      ----------------------------------------GQEVHVVANLPYYITTPILM
RSMA_LISMC      ----------------------------------------DLPLKIVANLPYYVTTPIIL
RSMA_LISMF      ----------------------------------------DLPLKIVANLPYYVTTPIIL
RSMA_LISMO      ----------------------------------------ELPLKIVANLPYYVTTPIIL
RSMA_LISMH      ----------------------------------------ELPLKIVANLPYYVTTPIIL
RSMA_LISIN      ----------------------------------------ELPLKIVANLPYYVTTPIIL
RSMA_LISW6      ----------------------------------------ELPLKIVANLPYYVTTPIIL
RSMA_STAAT      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAA3      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAC      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAA2      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAA9      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAS      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAA1      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAM      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAW      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAN      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAA8      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAB      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAE      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAAR      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_STAES      ----------------------------------------CDKIMVVANLPYYITTPILL
RSMA_STAEQ      ----------------------------------------CDKIMVVANLPYYITTPILL
RSMA_STAHJ      ----------------------------------------CDKIMVVANLPYYITTPILL
RSMA_STACT      ----------------------------------------CDKIMVVANLPYYITTPILL
RSMA_STAS1      ----------------------------------------CEKIMVVANLPYYITTPILL
RSMA_MACCJ      ----------------------------------------CDEIFVVANLPYYITTPILM
RSMA_STRA1      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRA5      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRA3      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRMU      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRS7      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STREM      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRE4      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPB      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPC      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRP1      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPF      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPD      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPM      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRP8      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPG      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRP6      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRP3      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRU0      ----------------------------------------DLPLKVVANLPYYITTPILM
RSMA_STRT2      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRTD      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRT1      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRGC      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRSV      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPN      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRZT      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRPJ      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRP7      ----------------------------------------NLPIKVVANLPYYITTPILM
RSMA_STRZJ      ----------------------------------------NLPIKVVANLPYYITTPILM
RSMA_STRPI      ----------------------------------------NLPIKVVANLPYYITTPILM
RSMA_STRP4      ----------------------------------------NLPIKVVANLPYYITTPILM
RSMA_STRR6      ----------------------------------------NLPIKVVANLPYYITTPILM
RSMA_STRP2      ----------------------------------------NLPIKVVANLPYYITTPILM
RSMA_STRPS      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_STRZP      ----------------------------------------DLPIKVVANLPYYITTPILM
RSMA_LACLA      ----------------------------------------NLPIKVVANLPYYITTPILM
RSMA_ENTFA      ----------------------------------------KYPIKVVANLPYYITTPIMM
RSMA_LACSS      ----------------------------------------QHNLKIVANLPYYITTPIML
RSMA_LACPL      ----------------------------------------ERPLKLVANLPYYITTPILM
RSMA_LACS1      ----------------------------------------GHKLKLVANLPYYITTPILM
RSMA_LACBA      ----------------------------------------DRPLKLVANLPYYITTPILM
RSMA_PEDPA      ----------------------------------------KRRLKLVANLPYYITTPILK
RSMA_LACRD      ----------------------------------------SRPIKVVANLPYYITSPILM
RSMA_LACRJ      ----------------------------------------SRPIKVVANLPYYITSPILM
RSMA_LEUCK      ----------------------------------------GAHVKIVANLPYYITTPILM
RSMA_LEUMM      ----------------------------------------NAHVKIVANLPYYITTPILI
RSMA_OENOB      ----------------------------------------NQSLKIVANLPYYITTPILF
RSMA_LACAC      ----------------------------------------KQPIKVVANLPYYITTPIIF
RSMA_LACH4      ----------------------------------------SKPIKVVANLPYYITTPIIF
RSMA_LACJO      ----------------------------------------SKSVKIVANLPYYITTPIIF
RSMA_LACDA      ----------------------------------------SKPVKVVANLPYYITTPIIF
RSMA_LACDB      ----------------------------------------SKPVKVVANLPYYITTPIIF
RSMA_CARHZ      ---------------------------------------EGKPYLIVANLPYYATSPLIF
RSMA_ACIF2      -----------------------------------------NALRIVGNLPYNVATPLIF
RSMA_ACIF5      -----------------------------------------NALRIVGNLPYNVATPLIF
RSMA_HALHL      -----------------------------------------GRLRVVGNLPYNVSTPILF
RSMA_ACISJ      ---------------------------------------NASKIRVVGNLPYNISTPILF
RSMA_ACIET      ---------------------------------------NAPKIRVVGNLPYNISTPILF
RSMA_ACIAC      ---------------------------------------GAPRIRIVGNLPYNISTPILF
RSMA_POLSJ      KGLEPAGSSSQQGPRDWLRQTAGAAAPSRGSAVHEVTSVGAHKLRVVGNLPYNISTPILF
RSMA_POLNA      -------------------------------------TPSPCKLRVVGNLPYNISTPILF
RSMA_RHOFT      ---------------------------------------TTTKLRVVGNLPYNISTPILF
RSMA_VARPS      ----------------------------------------AAPLRVVGNLPYNISTPILF
RSMA_VEREI      -------------------------------------PTPPTRLRVVGNLPYNISTPILF
RSMA_LEPCP      ----------------------------------------GRPVRVIGNLPYNISSPILF
RSMA_METPP      ----------------------------------------AGRLRIVGNLPYNISTPILF
RSMA_BURCM      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURA4      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURCA      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURCH      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURCC      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURCJ      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURL3      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURM1      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURVG      -----------------------------------------PSLRIVGNLPYNISSPLLF
RSMA_BURMA      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURPS      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURM9      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURM7      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURMS      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURP1      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURP0      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURP6      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_BURTA      -----------------------------------------PSLRIIGNLPYNISSPLLF
RSMA_PARPJ      -----------------------------------------ASLRIVGNLPYNISSPLLF
RSMA_PARXL      -----------------------------------------ASLRIVGNLPYNISSPLLF
RSMA_PARP8      -----------------------------------------PTLRIVGNLPYNISSPLLF
RSMA_CUPTR      ------------------------------------------PLRIVGNLPYNISSPLLF
RSMA_CUPNH      ------------------------------------------PLRIVGNLPYNISSPLLF
RSMA_CUPPJ      ------------------------------------------PLRIVGNLPYNISSPLLF
RSMA_CUPMC      ------------------------------------------ALRIVGNLPYNISSPLLF
RSMA_RALSO      ------------------------------------------SLRIVGNLPYNISSPLLF
RSMA_BURSP      -----------------------------------------ARLRIVGNLPYNISSPLLF
RSMA_BORBR      -----------------------------------------QGLRVVGNLPYNISSPLLF
RSMA_BORPE      -----------------------------------------QGLRVVGNLPYNISSPLLF
RSMA_BORPA      -----------------------------------------QGLRVVGNLPYNISSPLLF
RSMA_BORA1      -----------------------------------------AGMRVVGNLPYNISSPLLF
RSMA_BORPD      -----------------------------------------ERLRVVGNLPYNISSPLLF
RSMA_HERAR      ------------------------------------------KLRVVGNLPYNISSPLLF
RSMA_JANMA      ------------------------------------------KLRVVGNLPYNISSPLLF
RSMA_AROAE      -----------------------------------------APLRVVGNLPYNISTPLLF
RSMA_THIDA      -----------------------------------------DDLRIVGNLPYNISTPLLF
RSMA_METFK      -----------------------------------------DRLRVVGNLPYNISTPILF
RSMA_CHRVO      ----------------------------------------EAPLKIVGNLPYNISTPLLF
RSMA_LARHH      ----------------------------------------EQPLKLVGNLPYNISTPLLF
RSMA_NEIG1      -----------------------------------------GKKKIVGNLPYNISTPLLF
RSMA_NEIG2      -----------------------------------------GKKKIVGNLPYNISTPLLF
RSMA_NEIMA      -----------------------------------------GKKKIVGNLPYNISTPLLF
RSMA_NEIM0      -----------------------------------------GKKKIVGNLPYNISTPLLF
RSMA_NEIMB      -----------------------------------------GKKKIVGNLPYNISTPLLF
RSMA_NEIMF      -----------------------------------------GKKKIVGNLPYNISTPLLF
RSMA_DECAR      -----------------------------------------KNLRLVGNLPYNISTPLLF
RSMA_NITEU      -----------------------------------------EGLRIIGNLPYNISTPLLF
RSMA_NITEC      -----------------------------------------EGLRIVGNLPYNISTPLLF
RSMA_NITMU      -----------------------------------------ESLRVVGNLPYNISTPLLF
RSMA_PSYA2      ---------------------------------------ERGKLRVVGNLPYNISTPILF
RSMA_PSYCK      ---------------------------------------ERGKLRVVGNLPYNISTPILF
RSMA_ACIAD      ---------------------------------------E-SPLRVVGNLPYNISTPLLF
RSMA_COXBU      ---------------------------------------TDKPLRVVGNLPYNISTPLLF
RSMA_COXB2      ---------------------------------------TDKPLRVVGNLPYNISTPLLF
RSMA_COXBR      ---------------------------------------TDKPLRVVGNLPYNISTPLLF
RSMA_COXBN      ---------------------------------------TDKPLRVVGNLPYNISTPLLF
RSMA_COXB1      ---------------------------------------TDKPLRVVGNLPYNISTPLLF
RSMA_ALCBS      ---------------------------------------ADKPLRVIGNLPYNISTPLIF
RSMA_HAHCH      ----------------------------------------ERPMRLIGNLPYNISTPLIF
RSMA_MARHV      ----------------------------------------DRPLRIVGNLPYNISTPLIF
RSMA_MARMS      ----------------------------------------EQAIRVVGNLPYNISTPLIF
RSMA_PSEF5      ----------------------------------------PGSLRVVGNLPYNISTPLIF
RSMA_PSEPF      ----------------------------------------PNSLRVVGNLPYNISTPLIF
RSMA_PSE14      ----------------------------------------PRSLRVVGNLPYNISTPLIF
RSMA_PSESM      ----------------------------------------PRSLRVVGNLPYNISTPLIF
RSMA_PSEU2      ----------------------------------------PRSLRVVGNLPYNISTPLIF
RSMA_PSEPK      ----------------------------------------PRSLKVVGNLPYNISTPLIF
RSMA_PSEAE      ----------------------------------------GEKLRVVGNLPYNISTPLIF
RSMA_CHRSD      ---------------------------------------PGKPLRVIGNLPYNISTPLIF
RSMA_SACD2      ----------------------------------------ERPLRVVGNLPYNISTPLIF
RSMA_METCA      -----------------------------------------ERLRVVGNLPYNISTPLLF
RSMA_LEGPC      ------------------------------------------HLRVVGNLPYNISTPLLI
RSMA_LEGPA      ------------------------------------------HLRVVGNLPYNISTPLLI
RSMA_LEGPL      ------------------------------------------HLRVVGNLPYNISTPLLI
RSMA_LEGPH      ------------------------------------------HLRVVGNLPYNISTPLLI
RSMA_NITOC      ----------------------------------------NRRLRVVGNLPYNISTPLLF
RSMA_HYDCU      ---------------------------------------ETPSLRIVGNLPYNISSPLLF
RSMA_XANAC      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XANC5      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XANOR      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XANOM      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XANOP      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XANCP      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XANC8      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XANCB      ----------------------------------------GTPIRLVGNLPYNISSPILF
RSMA_XYLFA      ----------------------------------------NKKLRLVGNLPYNISSPILF
RSMA_XYLFT      ----------------------------------------NKKLRLVGNLPYNISSPILF
RSMA_DICNV      -----------------------------------------APIRIIGNLPYNLSSPILF
RSMA_ACTP2      ----------------------------------------GEGVRVFGNLPYNISTPLMF
RSMA_ACTP7      ----------------------------------------GEGVRVFGNLPYNISTPLMF
RSMA_ACTPJ      ----------------------------------------GEGVRVFGNLPYNISTPLMF
RSMA_HAEDU      ----------------------------------------HQAIRIFGNLPYNISTPLMF
RSMA_HAEIE      ----------------------------------------GQKLRVFGNLPYNISTPLMF
RSMA_HAEIG      ----------------------------------------GQKLRVFGNLPYNISTPLMF
RSMA_HAEIN      ----------------------------------------GQKLRVFGNLPYNISTPLMF
RSMA_HAEI8      ----------------------------------------GQKLRVFGNLPYNISTPLMF
RSMA_PASMU      ----------------------------------------KQKMRVFGNLPYNISTPLMF
RSMA_MANSM      ----------------------------------------GQKLRVFGNLPYNISTPLIF
RSMA_HAES1      ----------------------------------------NQKLRVFGNLPYNISTPLMF
RSMA_HISS2      ----------------------------------------NQKLRVFGNLPYNISTPLMF
RSMA_PSYIN      -----------------------------------------RPLRVFGNLPYNISTPLMF
RSMA_AERHH      ------------------------------------------PLRIFGNLPYNISTPLIF
RSMA_TOLAT      ------------------------------------------PLRIFGNLPYNISTPLIF
RSMA_ALIF1      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_ALIFM      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_ALISL      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_VIBA3      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_VIBCH      ------------------------------------------KLRVFGNLPYNISTPLMF
RSMA_VIBC3      ------------------------------------------KLRVFGNLPYNISTPLMF
RSMA_VIBCB      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_VIBPA      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_VIBVU      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_VIBVY      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_PHOPR      ------------------------------------------KLRIFGNLPYNISTPLMF
RSMA_SHEB5      ------------------------------------------KMKVFGNLPYNISTPLMF
RSMA_SHEB2      ------------------------------------------KMKVFGNLPYNISTPLMF
RSMA_SHEB8      ------------------------------------------KMKVFGNLPYNISTPLMF
RSMA_SHEB9      ------------------------------------------KMKVFGNLPYNISTPLMF
RSMA_SHEPC      ------------------------------------------KLKVFGNLPYNISTPLMF
RSMA_SHESW      ------------------------------------------KLKVFGNLPYNISTPLMF
RSMA_SHESM      ------------------------------------------KLKVFGNLPYNISTPLMF
RSMA_SHESR      ------------------------------------------KLKVFGNLPYNISTPLMF
RSMA_SHESA      ------------------------------------------KLKVFGNLPYNISTPLMF
RSMA_SHEON      ------------------------------------------KLKVFGNLPYNISTPLMF
RSMA_SHEDO      ------------------------------------------KMKVFGNLPYNISTPLMF
RSMA_SHEFN      ------------------------------------------KMKVFGNLPYNISTPLMF
RSMA_SHEHH      ------------------------------------------QMKVFGNLPYNISTPLMF
RSMA_SHEPA      ------------------------------------------QMKVFGNLPYNISTPLMF
RSMA_SHEPW      ------------------------------------------QMKVFGNLPYNISTPLMF
RSMA_SHESH      ------------------------------------------QMKVFGNLPYNISTPLMF
RSMA_SHEWM      ------------------------------------------QMKVFGNLPYNISTPLMF
RSMA_SHELP      ------------------------------------------QMKVFGNLPYNISTPLMF
RSMA_SHEAM      ------------------------------------------KLKVFGNLPYNISTPLMF
RSMA_PSET1      ------------------------------------------KLKVFGNLPYNISTPLLF
RSMA_COLP3      ------------------------------------------PLRIFGNLPYNISTPLIF
RSMA_IDILO      -------------------------------------------ARVFGNLPYNISTPLIF
RSMA_SALA4      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALDC      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALEP      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALG2      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALHS      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALPA      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALPK      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALPB      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALPC      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALTI      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALTY      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALAR      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALNS      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALCH      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SALSV      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_CITK8      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_KLEP3      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_KLEP7      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOUT      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO27      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOK1      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO45      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOL6      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOL5      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO81      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO55      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOLC      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOHS      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SHIBS      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOBW      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECODH      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOLI      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOSM      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO7I      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO8A      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SHIF8      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SHISS      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SHIB3      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOSE      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO57      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECO5E      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SHIFL      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ESCF3      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SHIDS      -----------------------------------------QPLHVFGNLPYNISTPLMF
RSMA_ECO24      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ECOLU      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_CROS8      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_ENT38      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_PECAS      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_PECCP      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPE      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPP      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPN      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPG      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPA      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPS      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPB      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERP3      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERPY      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_YERE8      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SERP5      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_PHOLL      -----------------------------------------KPLRVFGNLPYNISTPLMF
RSMA_ERWT9      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_SODGM      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_PROMH      -----------------------------------------QPLRVFGNLPYNISTPLMF
RSMA_HAMD5      -----------------------------------------QPLRILGNLPYNISTPLLF
RSMA_BAUCH      -----------------------------------------QPLRIFGNLPYNISIALMF
RSMA_BLOFL      -----------------------------------------QKIRLIGNLPYNISTKLII
RSMA_BLOPB      -----------------------------------------QKLRLIGNLPYNIATELIV
RSMA_BUCAI      -----------------------------------------QLIRIFGNLPYNISTSLII
RSMA_BUCAP      -----------------------------------------KLIRIFGNLPYHISTSLLF
RSMA_BUCBP      -----------------------------------------KSVRIIGNLPYNISIPILF
RSMA_WIGBR      -----------------------------------------DPVRIFGSLPYNISVSLMF
RSMA_FRATF      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRATH      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRATO      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRATM      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRATW      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRATT      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRAT1      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRATN      -----------------------------------------QKIKLIGNLPYNISSPILF
RSMA_FRAP2      -----------------------------------------QKLKLIGNLPYNISSPILF
RSMA_BACFR      ----------------------------------------GHPFVLTGNYPYNISSQIFF
RSMA_BACFN      ----------------------------------------GHPFVLTGNYPYNISSQIFF
RSMA_BACTN      ----------------------------------------GKPFVLTGNYPYNISSQIFF
RSMA_BACV8      ----------------------------------------GKPFVLTGNYPYNISSQIFF
RSMA_PARD8      ----------------------------------------GQ-FCVIGNYPYNISSQIFF
RSMA_PORGI      ----------------------------------------GRQYCLIGNYPYNISSQIFF
RSMA_PORG3      ----------------------------------------GRQYCLIGNYPYNISSQIFF
RSMA_FLAJ1      ----------------------------------------NKQFAIIGNFPYNISSQIVF
RSMA_FLAPJ      ----------------------------------------GKQFAIIGNFPYNISTQIVF
RSMA_CYTH3      ----------------------------------------DK-FAIIGNFPYNISTEILF
RSMA_CHLP8      -----------------------------------------GKLAVLGNIPYSITSPILF
RSMA_CHLTE      -----------------------------------------GKLSVLGNIPYSITSPILF
RSMA_CHLPB      -----------------------------------------GRLRIMGNIPYSITTPILF
RSMA_PROA2      -----------------------------------------GPVKVMGNIPYSITSPILF
RSMA_CHLL2      -----------------------------------------RKLRILGNIPYSITSPILF
RSMA_CHLPD      -----------------------------------------KPLRVLGNIPYAITSPILF
RSMA_PELLD      -----------------------------------------GPLRVLGNIPYSITTPILF
RSMA_CHLCH      -----------------------------------------KPLQILGNIPYSITSPILF
RSMA_SALRD      -----------------------------------------GPLRVISNTPYYLTSPILF
RSMA_ANAD2      ----------------------------------------GPRLAVVGNLPYHLTSPILF
RSMA_ANASK      ----------------------------------------GPRLAVVGNLPYHLTSPILF
RSMA_ANADE      ----------------------------------------GARLAVVGNLPYHLTSPILF
RSMA_MYXXD      ----------------------------------------APDVAVAGNLPYHLTSPILF
RSMA_GEOMG      -----------------------------------------ERWKVAANLPYNISTPVLF
RSMA_GEOSL      -----------------------------------------PPWKVAANLPYNISTPVLF
RSMA_PELCD      -----------------------------------------PPYKLIANLPYNISSQIVF
RSMA_MAGMM      -----------------------------------------GPLKLAANLPYNISTPLMV
RSMA_DESAH      ----------------------------------------GEKIIVIGNLPYNISSQVLF
RSMA_DESOH      ----------------------------------------GRKLVVLGNLPYYISSQILM
RSMA_DESPS      ----------------------------------------GGKLKILANLPYSISHPLIF
RSMA_SYNAS      ----------------------------------------VKKIKIIGNIPYSISSPILF
RSMA_MYCCT      -------------------------------------KYDYKNISIISNTPYYITSEILF
RSMA_MYCMS      -------------------------------------KYDYEKISIISNTPYYITSEILF
RSMA_MESFL      -------------------------------------QHENQKVSIISNMPYYITSEILF
RSMA_FUSNN      -----------------------------------------QGTKVVANIPYYITSPIIN
RSMA_AYWBP      -------------------------------------FSPNSQLSLIGNLPYYITSPILF
RSMA_ONYPE      -------------------------------------FSPNSQLSLIGNLPYYITSPILF
RSMA_PHYAS      -------------------------------------FSINCQLSLISNLPYYITTTILF
RSMA_MYCH7      --------------------------------------------TIIANLPYYITSKILF
RSMA_MYCHJ      --------------------------------------------TIIANLPYYITSKILF
RSMA_MYCH2      --------------------------------------------TIIANLPYYITSKILF
RSMA_MYCMO      --------------------------------------------IIIANIPYFITSDILF
RSMA_MYCS5      -------------------------------------Y------YVVANIPYYITSDILL
RSMA_MYCPU      -------------------------------------Y------NIVANIPYYITSDIIF
RSMA_MYCA5      -------------------------------------W------VVIGNIPYNITSEILF
RSMA_KORVE      ------------------------------------RPTKPEKVRIIGNLPYYITSDILL
RSMA_ACIC5      ------------------------------------RPG--EKLLVVGNLPYYMTSEILL
RSMA_THEMA      --------------------------------------NVPEGAICVSNIPYNITGPLME
RSMA_THESQ      --------------------------------------DVPEGAICVSNIPYNITGPLME
RSMA_THEP1      --------------------------------------DIPEGAICVSNIPYSITGPIME
RSMA_THENN      --------------------------------------DVPEEAICVSNIPYSVTGPIME
RSMA_NOSS1      ----------------------------------------QKPNKVVANIPYNITGPIIE
RSMA_TRIV2      ----------------------------------------QKPNKVVANIPYNITGPIIE
RSMA_NOSP7      ----------------------------------------QKPNKVVANIPYNITGPIIE
RSMA_CROS5      ----------------------------------------LPINKVVANIPYNITSPILD
RSMA_RIPO1      ----------------------------------------QPINKVVANIPYNITSPILE
RSMA_SYNY3      ----------------------------------------SPLNKVVANIPYNITSPILE
RSMA_ACAM1      ----------------------------------------PLPNKVVANIPYNITSPILS
RSMA_SYNE7      ----------------------------------------ANPSKVVANIPYNITGPILQ
RSMA_SYNP6      ----------------------------------------ANPSKVVANIPYNITGPILQ
RSMA_SYNP2      ----------------------------------------QNPRKVVANIPYNITGPILE
RSMA_THEEB      ----------------------------------------LGCNKVVANIPYNITGPLLG
RSMA_SYNJB      -----------------------------------------QPRLLVANIPYNLTGSILE
RSMA_SYNJA      -----------------------------------------QPRLLVANIPYNLTGPILE
RSMA_GLOVI      -----------------------------------------PANVVVANIPYNISGPILA
RSMA_PROMA      ----------------------------------------IAANKVVANIPYNITGPLLE
RSMA_PROM4      ----------------------------------------IEVNKVVANIPYNITSPLLE
RSMA_PROM3      ----------------------------------------RAANKVVANIPYNITGPLLE
RSMA_PROMM      ----------------------------------------RAATKVVANIPYNITGPLLE
RSMA_SYNS3      ----------------------------------------VPANKVVANIPYNITGPLLD
RSMA_SYNPW      ----------------------------------------QRATKVVANIPYNITGPLLE
RSMA_SYNSC      ----------------------------------------RIADKVVANIPYNITGPLLE
RSMA_SYNPX      ----------------------------------------VAASKVVANIPYNITGPLLD
RSMA_SYNS9      ----------------------------------------GFANKVVANIPYNITGPLLA
RSMA_SYNR3      ----------------------------------------RRPTKVVANIPYNITGPLLE
RSMA_PROM1      ----------------------------------------VTINKVVANIPYNITGPLLK
RSMA_PROMT      ----------------------------------------LTINKVVANIPYNITGPLLK
RSMA_PROM0      ----------------------------------------KKITKVIANIPYNITGPILD
RSMA_PROM9      ----------------------------------------KKITKVIANIPYNITGPILD
RSMA_PROMS      ----------------------------------------KKITKVIANIPYNITGPILD
RSMA_PROM2      ----------------------------------------KKITKVIANIPYNITGPILD
RSMA_PROM5      ----------------------------------------KKITKVIANIPYNITGPILD
RSMA_PROMP      ----------------------------------------KKITKVIANIPYNITGPILD
RSMA_TREPA      -----------------------------------------QPACVLGNLPYNIAARFIG
RSMA_TREPS      -----------------------------------------QPACVLGNLPYNIAARFIG
RSMA_TREDE      -----------------------------------------KPNVFFGNLPYNIASDLIA
RSMA_BORAP      ------------------------------------------IDKIFSNLPYNIASKVIS
RSMA_BORBP      ------------------------------------------IDKIFSNLPYNIASKVIS
RSMA_BORBU      ------------------------------------------IDKIFSNLPYNIASKVIS
RSMA_BORBZ      ------------------------------------------IDKIFSNLPYNIASKVIS
RSMA_UREPA      ------------------------------------------KIKVVANLPYAISSKIVL
RSMA_UREP2      ------------------------------------------KIKVVANLPYAISSKIVL
RSMA_UREU1      ------------------------------------------KIKVVANLPYAISSKIVL
RSMA_MYCPE      ------------------------------------------QYKIISNLPYSISSKIIF
RSMA_MYCGE      ------------------------------------------SPLLCGNIPYSITSPIIN
RSMA_MYCPN      ------------------------------------------IPLLCGNIPYSISSPLIA
RSMA_MYCGA      -----------------------------------------DNPTMVGNLPYNISSKLIK
RSMA_ARCB4      ----------------------------------------DGKYDLIANLPYYIATNIIL
RSMA_SULDN      ----------------------------------------EESYDLVANLPYYIATNIIL
RSMA_HELHP      ----------------------------------------THEYKVVSNLPYYIATHIIL
RSMA_CAMC1      ----------------------------------------SENYFLVANLPYYVATKMIL
RSMA_CAMC5      ----------------------------------------EQGYFLVANLPYYVATKMIL
RSMA_CAMHC      ----------------------------------------NKNYFLVANLPYYVATNMIL
RSMA_CAMFF      ----------------------------------------ASEYFLVANLPYYVATNMIL
RSMA_CAMJE      ----------------------------------------EKPYFLVANLPYYVASHIIL
RSMA_CAMJR      ----------------------------------------EKPYFLVANLPYYVASHIIL
RSMA_HELPY      ----------------------------------------EEPYFLISNLPYYIATRLVL
RSMA_HELPH      ----------------------------------------EEPYFLISNLPYYIATRLVL
RSMA_HELPG      ----------------------------------------EEPYFLISNLPYYIATRLVL
RSMA_HELP2      ----------------------------------------EEPYFLISNLPYYIATRLVL
RSMA_HELPS      ----------------------------------------EEPYFLISNLPYYIATRLVL
RSMA_HELPJ      ----------------------------------------EEPYFLISNLPYYIATRLVL
RSMA_HELAH      ----------------------------------------EEPYFLISNLPYYIATRLVL
RSMA_BDEBA      -----------------------------------------KRVVFVSNLPYQISSSIVI
                                                               .. **        

RSMA_RHIEC      NWLLPKAWPP--FWQSLTLMFQKEVGERIVAGEDDDH-YGRLGVLCGWRT-DARMAFDVP
RSMA_RHIE6      NWLLPKAWPP--FWQSLTLMFQKEVGERIVATEDDDH-YGRLGVLCGWRT-EARMAFDVP
RSMA_RHILW      NWLLPKAWPP--FWQSLTLMFQKEVGERIVASEDDDH-YGRLGVLCGWRT-QTRMAFDVP
RSMA_RHIL3      NWLLPKAWPP--FWQSLTLMFQKEVGERIVANEDDDH-YGRLGVLCGWRT-EARMAFDVP
RSMA_AGRVS      NWLMPRQWPP--FWDSLTLMFQKEVGQRIVAEADDDH-YGRLGVLCGWRT-EAHMAFDLS
RSMA_RHIME      NWLLPGLWPP--FWQSMTLMFQREVGLRIVAGADDDH-YGRLGVLCGWRT-KARLAFDVP
RSMA_SINMW      NWLLPGRWPP--FWQSMTLMFQREVGLRIVASPDDDH-YGRLGVLCGWRT-KASLAFDVP
RSMA_SINFN      NWLLPERWPP--FWQSMTLMIQREVGLRIVAGADDDH-YGRLGVLCGWRT-KARLAFDVP
RSMA_AGRFC      NWLLPREWPP--FWLSMTLMFQKEVGQRIVAEEGDNH-YGRLGVLAGWRT-VSEMAFDVP
RSMA_CHESB      RWLTPQTWPP--FYESMTLMFQREVAERIVAKPGSSH-YGRLGVLAGWRT-EARIAFDVP
RSMA_RHILO      RWLTVVDWPP--FYASMTLMFQREVAQRIVAEPGSDA-YGRLGVLAGWRT-KARIAFDVP
RSMA_BARHE      NWLLAEPWPP--FYESMTLMFQREVAQRITAKPQSAH-YGRLSVLTGWRT-IAKIAFDVP
RSMA_BARQU      NWLLVEPWPP--FYESMTLMFQREVAKRITAKPQSAY-YGRLSVLTGWRT-TAKIAFDVP
RSMA_BART1      NWLLVEPWPP--FYESMTLMFQREVAKRITAKPQSSH-YGRLSVLTGWRT-IAKIAFDVP
RSMA_BARBK      NWLLTTSWPP--FYESMTLMFQREVAKRITATPQSPH-YSRLSVLAGWRT-IAKIAFDVP
RSMA_BRUA2      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUA1      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUC2      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUMB      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUO2      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUSU      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUME      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKLDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUSI      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_BRUAB      NWLLVEPWPP--FYSSMTLMFQREVAERIVAKPDSDH-YGRLGVLAGWRT-QAKIAFDVP
RSMA_OCHA4      NWLLVEPWPP--FYSSMTLMFQREVAERIVATPDSDH-YGRLGVLAGWRT-VSKISFDVP
RSMA_AZOC5      GWLSTDPWPP--WFSSLTLMFQREVAERIVAGPDSKA-YGRLAVLTGWRA-QARILFDVA
RSMA_XANP2      GWLSTDPWPP--WFSSLTLMFQKEVAERIVAAPGSKA-YGRLAVLAGWRT-TARIAFDVA
RSMA_METRJ      GWLDGEAWPP--WWDQAVLMFQREVAERIVAGPEERADYGRLGVLCGWRT-EAEILFDVS
RSMA_BRASB      GWLSAEPWPP--WYDMMVLMFQREVAERIVARENEEA-YGRLGVLANWRC-ETKILFDIS
RSMA_BRASO      GWLSAEPWPP--WYEMMVLMFQREVAERIVATENEEA-YGRLGVLANWRC-ETKILFDIS
RSMA_BRADU      NWLTTEPWPP--WYDMMVLMFQREVGERIVAREDEEA-YGRLGVLANWRC-ETKILFDIA
RSMA_NITHX      DWLSVEPWPP--WYDTMVLMFQREVAERIVARENEEA-YGRLAVLSNWRA-ETKILFDIS
RSMA_NITWN      RWLSIEPWPP--WYDVMVLMFQREVAERIVARENEDA-YGRLGVLSNWRA-ETKILFDIS
RSMA_RHOPA      GWLCAEPWPP--WYEMMVLMFQREVAQRIVAHHDDDA-YGRLAVLANWRA-ETQMLFDIS
RSMA_RHOPT      GWLCAEPWPP--WYEMMVLMFQREVAQRIVAHHDDDA-YGRLAVLANWRA-ETQMLFDIS
RSMA_RHOPS      GWLCTEPWPP--WYDMMVLMFQREVAQRIVAREDDDA-YGRLAVLSNWRC-ETNMLFDIA
RSMA_RHOP2      GWLCAEPWPP--WYDMMVLMFQREVAQRIVACEDDDA-YGRLAVLSNWRC-DTGMLFDIA
RSMA_RHOP5      GWLETDPWPP--WYDCLVLMFQREVAERIVATEDDEA-YGRLGVLANWRA-QTKMLFDIS
RSMA_RHOPB      GWLSIEPWPP--WYDTMVLMFQREVAERIVAREDDEA-YGRLAVLANWRA-ETKLLFDIS
RSMA_OLICO      GWLSVEPWPP--WFDMMVLMFQREVAERIVATENDEA-YGRLGVLANWRA-ETKILFDIA
RSMA_RUEPO      RWLTPRDWPP--FWQSLTLMFQREVAERIVAKPGSKA-YGRLALLAQWRA-EARIVMSLP
RSMA_RUEST      RWLTPKEWPP--FWQSLTLMFQREVAERIVAQPGSKA-YGRLAILAQWRA-EARIALSLP
RSMA_ROSDO      RWLTPQIWPP--YWQSLTLMFQREVAERIVARPGSKA-YGRLAILAQWRA-DARIVMQLP
RSMA_PARDP      RWLTPAAWPP--FWQSLTLMFQKEVAERIVAQPGGKA-YGRLAVLAQWRT-EARIVMTLP
RSMA_DINSH      RWLTPPDWPP--FWRTLTLMFQREVAERIVAKPGSKA-YGRLAILAQWRA-EAEIALTLP
RSMA_RHOS4      RWLS-SDWPP--FWESLTLMFQKEVAERIVAKPGSKA-YGRLALLSQWRT-DPKIVLTLP
RSMA_RHOS1      RWLS-SDWPP--FWESLTLMFQKEVAERIVAKPGSKA-YGRLALLSQWRT-DPKIVLTLP
RSMA_RHOSK      RWLS-SDWPP--FWESLTLMFQKEVAERIVAKPGSKA-YGRLALLSQWRT-DPKIVLTLP
RSMA_RHOS5      RWLS-SGWPP--FWESLTLMFQKEVAERIVARPGSKA-YGRLALLSQWRT-EPKIVLTLP
RSMA_JANSC      RWLTPASWPP--PWESLTLMFQREVAERIVAQPGSKT-YGRLAILSQWRA-DPRIVMGLP
RSMA_ERYLH      RWLGGETWPP--QWTSLTLMFQQEVAQRIVSTPGTSA-YGRLAVLAQWRS-AASMPMKVH
RSMA_NOVAD      GWLSGQDWPP--QWKSLTLMFQLEVAERIVAQPGTDA-YGRLAVLAQWRA-TPRIATRVH
RSMA_SPHAL      RWLEPAAWPP--RWLSLTLMFQLEVAERIVAPVGTSA-YGRLAVLAQWRA-RARIAMKVH
RSMA_ZYMMO      RWLTAKTWQP--WWSSLTLMFQKEVAERITAKVGTPH-YGRLSVLAQWRS-EAKLSFPVH
RSMA_MAGSA      GWLR---RAD--AFERLVLMFQKEVVDRLAAPPRSEH-YGRLSVITQWRC-EVRPLFNVD
RSMA_RHORT      GWLR---HAS--AFERFVLMFQKEVVDRLAARPGTKD-YGRLSVITQWLC-EVRPLFDVN
RSMA_GLUOX      GWLR---QAS--QWERLSLMFQLEVAERICAAPGSSA-YGRLAVLSQWCA-SCSVALRIP
RSMA_CAUVC      NWLTG---PF--RPLSMTLMFQKEVADRIVAQPGDDA-YGRLAVIAQTLC-EARTVMDLP
RSMA_PHEZH      KWLTG---PW--TPASLTLMFQKEVADRITAAPGEDA-YGRLAVIAQATA-DARPVMDVP
RSMA_MARMM      KWLQAE--PI--WWRRAVLMFQREVADRVVAQPGDKA-YGRLAVISQSRC-QAHLALKIP
RSMA_ANAMF      RMLKYIH-----NFEKLTLMFQKEVAERLVAKPGTKS-YSILSVLVQLLC-DVEKVKDLQ
RSMA_ANAMM      RMLKYIH-----NFEKLTLMFQKEVAERLVAKPGTKS-YSILSVLVQLLC-DVEKVKDLQ
RSMA_ANAPZ      KLLPYIH-----RFEKLILMFQKEVADRIVAQPNTKS-YSILSILVQLLC-DVRKVEDFP
RSMA_EHRCJ      KWINYID-----FFTSFTLMFQKEVADRIVAQPNNKN-YSILSVLIQLLS-NVYKMEDFG
RSMA_EHRCR      KWMDYIN-----FFTSFTLMFQKEVADRIVAQPNNKN-YGTLSILIQLLS-NVYKMEDFG
RSMA_EHRRG      KWINYIN-----FFHSFTLMFQKEVADRIIAQPNNKN-YGTLSILTQLFA-DVYKMQDFG
RSMA_EHRRW      KWINYIN-----FFHSFTLMFQKEVADRIIAQPNNKN-YGTLSILTQLFA-DVYKMQDFG
RSMA_WOLPM      KWLDSIK-----FFTSLTLMFQKEVADRITARPNSKD-YGPLSVLSQLLC-DIKKEFDIE
RSMA_WOLWR      KWLNNIK-----FFTNLTLMFQKEVADRITARPNSKD-YGSLSVLSQLLC-DIKKEFDIE
RSMA_WOLTR      KWLNKIK-----LFTTFTLMFQKEVADRIIARPNSKD-YGSLSVLSQLLC-DIRREFDIE
RSMA_WOLPP      KWLNNIK-----FFTNLTLMFQKEVAERITAEPNSKD-YGSLSVLSQLLC-DIKKEFDIE
RSMA_NEOSM      GWMNELE-----QVREMVLMFQKEVADRICAQPKSKN-YGALSVLVQLEC-KAESQFALA
RSMA_RICPU      RWLKEAR-----LITSMTLMLQKEVVERICAIPSTKA-YGRLSVICQLIA-KVEKCFDVA
RSMA_RICRS      RWLKEAR-----LITSMTLMLQKEVVERICAIPSTKA-YGRLSVICQLIA-KVEKCFDVA
RSMA_RICAE      RWLKEAQ-----LITSMTLMLQKEVVERICAIPSTKA-YGRLSVICQLIV-KVEKCFDVA
RSMA_RICFE      RWLKEAR-----LITNMTLMLQKEVVERICAMPSTKA-YGRLSVICQLIT-KVEKCFDVA
RSMA_RICAH      RWLKEAR-----LITDMTLMLQKEVVERICAMPSTKA-YGRLSVICQLIA-KVEKCFDVS
RSMA_RICCK      RWLKEAR-----LITSMTLMLQKELVERICAMPSTKA-YGRLSVICQLIA-KVEKCFEVA
RSMA_RICPR      RLLKEVK-----LITNMTLMLQKEVVERICAIPSTKA-YGRLSVICQILA-KVEKCFNVA
RSMA_RICTY      RLLKEAK-----LITNMILMLQKEVVERICAMPSTKA-YGRLSVICQIVA-KVEKCFDVA
RSMA_RICB8      RWLKESS-----LVASMTLMLQKEVVERICAKPSTKA-YGRLSVICSLIA-TVEKCFDVA
RSMA_RICBR      RWLKESS-----LVASMTLMLQKEVVERICAKPSTKA-YGRLSVICSLIA-TVEKCFDVA
RSMA_PELUB      KWILNIGSNF--WFDSLVLMFQKEVADRIISEFNNSN-YGRLSILSSWKL-NVKKILDIK
RSMA_PERMH      NTAFYIDIL-----QLAVFMIQKEVAQKLVGKPKTKD-YTFMSVFLQTFF-DIDYVMSVP
RSMA_SULSY      DCAFKLDIL-----EFCVFMIQKEVAEKLIAKPKTKD-YTFLSVFIQTFF-DIKYVMSVP
RSMA_AQUAE      NTVYNKDCV-----PLAVFMVQKEVAEKLQGK---KD-TGWLSVFVRTFY-DVNYVMTVP
RSMA_HYDS0      NMINQEKHI-----SKMVFMLQKEVGERLITD--SKD-KSWLWAYANTYF-NIHYAFSVP
RSMA_DESVH      DICSRAPGL-----LRASFMIQKEVGERIVAAPGSRQ-YGALSVWLQCFT-KPEWCFVVP
RSMA_DESVV      DICSRAPGL-----VRASFMIQKEVGERIVAAPGSRQ-YGALSVWLQCFT-KPEWCFVVP
RSMA_DESAG      D-CLSLAAF-----SRAVFMIQKEVGDRIVAAPRSRQ-YGALSVWLQSHT-VPRKELIVP
RSMA_DESAD      DIAAQCNA-------TCVFMVQHEVAQRVTSGPGSKK-YGAISVWIQSFC-RTDYLFKVP
RSMA_LAWIP      DIVSRVQSM-----SRAVFMVQKEVADRLCACPGTKS-YGVLSVWVQSFA-KVEWGFIVK
RSMA_HALMA      RLLPEQ-------RPLL-LMFQQEFAERMAADPATDD-YGRLSVTAGHYA-DVEVVETVP
RSMA_NATPD      RLLPEK-------RPLV-LMFQQEFAERMAAEPGTDE-YGRLSVTAGHYA-DVEVVEPVP
RSMA_HALWD      ELLPAD-------CPLI-VMVQREFGERMAADPGTDA-YGRLSVSAQHYA-TVEVVETVP
RSMA_HALSA      RLLPAG-------KPMV-LMYQLEFAERMAADPGTSE-YGRLSVATQHYA-DVSIVETVP
RSMA_HALS3      RLLPAG-------KPMV-LMYQLEFAERMAADPGTSE-YGRLSVATQHYA-DVSIVETVP
RSMA_METHJ      RLLDIGF------EAAI-LMYQKEFADRMMAHPGTRD-CGRLSIMLQTYA-RANRCFDLP
RSMA_METAC      KLLRYKF------KLGI-LMYQYEFAARMVSPPGRKD-YSRLTVDTYYFA-DASILMKVP
RSMA_METMA      KLLRHKF------KLGV-LMYQYEFAVRMVSPPGCKD-YSRLTIDTCYFA-DASIVMKVP
RSMA_METBF      KLLRHKF------KLGI-LMYQYEFAARMVSQPNCKD-YSRLTVDTCYFA-DASILMKVP
RSMA_METBU      KLFKHEF------ELGI-LMYQYEFAQRMVAKANTEN-YSRLSVNTHYFA-DADIIMKIP
RSMA_ARCFU      KLLKTDF------RLAV-VMYQREFAERLCGEDN------RLGVISKTYC-KAEILEIVK
RSMA_METTH      RLLEHDF------ELAV-LMYQKEFARRMVAEPGTRE-YSRLSVMVHFLA-EVEIVDYLK
RSMA_METST      KLLEYPF------KKAI-LMYQLEFAKRMQAKPDTHE-YSRLSVALSYRA-DTKIIDTLP
RSMA_PYRAB      KLLKMEF------ERAV-VMYQLEFALRMTAKPGDRN-YSRLSLMTQALA-DVEIVMRIG
RSMA_PYRHO      KLLKTDF------ERAV-VMYQLEFALRMVAKPGSRN-YSRLSLMAQALG-NVEIVMKIG
RSMA_PYRFU      KLLKHDF------EKAV-VMYQLEFAKRMVAKPGDRN-YSRLSLMVNALA-NAKIVMKIG
RSMA_THEKO      KLLSREF------ERAV-LIFQLEFAERMVAKPGDKN-YSRLSLMVRAKA-RAELVERIG
RSMA_THEGJ      KLLKHEF------ERAV-LIYQLEFAERMIAKPGDRN-YSRLSLMVQAKA-NVELVERIG
RSMA_THEON      RFLGYGF------ERAV-LIYQLEFAQRMVARPGDRN-YSRLSLMVQAKS-YVELVERIG
RSMA_THESM      KLLKYDF------ERAV-LIYQLEFAQRMVAKPGDKN-YSRLSVMVQAKV-NVDLVERIG
RSMA_METKA      KLLELDI------DVAV-LTYQREFAERMVAEPGSKK-YSRLTVMVNLLA-DVELLRGVP
RSMA_METM6      KFLEEDF------ETAV-LMYQYEFAKRMAGKPDTKE-YSRLSVAVQYNA-DVEFICKVP
RSMA_METM7      KFLEEDF------EVAV-LMYQYEFAKRMAGKPDTKE-YSRLSVAVQYNA-DVEFICKVP
RSMA_METMP      KFLEEDF------ETAV-LMYQYEFAKRMAGKPDTKE-YSRLSVAVQYNA-DVEFICKVP
RSMA_METM5      KFLDVDF------ETAV-LMYQYEFAKRMAGKPDTKE-YSRLSVAVQYNA-DVEFICKVP
RSMA_METVS      KFLENDF------DVAV-LMYQYEFAKRMIGKPDTDE-YSRLSVSIQYNS-DVEFICKVP
RSMA_META3      KLLDCDF------EVAV-LMYQYEFAKRMGAPSGTKE-YSRLSVSVQYRA-VVDYVCKVS
RSMA_METJA      KLIKRGF------DLAV-LMYQYEFAKRMVAKEGTKD-YGRLSVAVQSRA-DVEIVAKVP
RSMA_PYRAE      KLIRHR-------LPAV-LTIQREVAERLVARPGSED-YGRLTVAVQCFY-DVEILRVLP
RSMA_PYRIL      KLAKYR-------LPAV-VTIQKEVAERLVAAPGTEN-YGRLTVAIRCHY-DVEVLRILP
RSMA_RUBXD      RLLEEVPS----LERMR-FMVQLEVALRMTARPGSKD-YGAYAVLIQLLS-RPEVAHRVS
RSMA_NATTJ      KLAKEKVP----LSVMV-LMVQREVADRFTASPGSKN-YGAVTVLLDCFY-EVEGVFNVP
RSMA_RHOBA      NLLHQDPP----PDRIV-VTIQKELGERMVAGPGSKD-YGALSIWIQATC-RAEIVRILP
RSMA_PAEAT      HLLQHFPS----LQHGL-VMVQDEVADRLAATPGSKI-YGVPSVKAAWYG-HMRKAGVIG
RSMA_ARTS2      HLLQHFPS----LRHGL-VMVQDEVADRLAAGPGSKT-YGVPSVKAAWYS-SMRKAGVIG
RSMA_STRAW      HMLDTFPS----IERTL-VMVQAEVADRLAADPGSRV-YGVPSVKANWHA-EVKRAGSIG
RSMA_STRCO      HMLDTFPG----IERTL-VMVQAEVADRLAAGPGSKV-YGVPSVKANWYA-EVKRAGSIG
RSMA_STRGG      TMLERFPS----IERTL-VMVQSEVADRLAARPGNKV-YGVPSVKANWYA-DVKRAGAIG
RSMA_THEFY      HLLNLLPS----LEHGL-VMVQAEVAERLAARPGDRA-YGAPSAKIAWYA-DVRRAGAIG
RSMA_KINRD      TMLARFPS----LRQGL-VMVQSEVADRLVAPPGSRT-YGVPSVKTAWYA-SAKRAGSVP
RSMA_LEIXX      HLLERVPS----LRSGV-VMVQAEVGQRIAAGPGSKV-YGAPSVKAAWYG-VWRTAGTVS
RSMA_CUTAK      HMLAICPQ----WSTGV-VMVQSEVADRLVAAPGSKI-YGVPSAKLAWYA-EAIRVGNVP
RSMA_CORGL      HMMEEFPT----INKVL-VMVQAEVADRLAADPGSKI-YGVPSVKASFYG-PVTRAGSIG
RSMA_CORGB      HMLEEFPT----INKVL-VMVQAEVADRLAADPGSKI-YGVPSVKASFYG-PVTRAGSIG
RSMA_COREF      HMLAEFPS----ITKVL-VMVQLEVADRLAAVPGSKI-YGVPSVKASFYG-EVSKAGTIG
RSMA_CORDI      HLLQIFPT----IRRVL-VMVQAEVADRLAADPGNKV-YGVPSVKASFYG-NVRRAGSIG
RSMA_CORJK      HMLEEFPS----IDRVL-VMVQLEVADRLAAAPGSKI-YGVPSVKAGFYG-SVARAATIG
RSMA_MYCA1      HLLAEFPS----IRTVT-VMVQAEVAERLAAEPGGKE-YGVPSVKVRFFG-RVRRCGMVS
RSMA_MYCPA      HLLAEFPS----IRTVT-VMVQAEVAERLAAEPGGKE-YGVPSVKVRFFG-RVRRCGMVS
RSMA_MYCLE      HLLAEFPS----IRTVT-VMVQAEVAERLAAEPGGKD-YGVPSVKLSFFG-RVRRCGMVS
RSMA_MYCLB      HLLAEFPS----IRTVT-VMVQAEVAERLAAEPGGKD-YGVPSVKLSFFG-RVRRCGMVS
RSMA_MYCTU      HLLVEFPS----IRVVT-VMVQAEVAERLAAEPGSKE-YGVPSVKLRFFG-RVRRCGMVS
RSMA_MYCTA      HLLVEFPS----IRVVT-VMVQAEVAERLAAEPGSKE-YGVPSVKLRFFG-RVRRCGMVS
RSMA_MYCBT      HLLVEFPS----IRVVT-VMVQAEVAERLAAEPGSKE-YGVPSVKLRFFG-RVRRCGMVS
RSMA_MYCBO      HLLVEFPS----IRVVT-VMVQAEVAERLAAEPGSKE-YGVPSVKLRFFG-RVRRCGMVS
RSMA_MYCBP      HLLVEFPS----IRVVT-VMVQAEVAERLAAEPGSKE-YGVPSVKLRFFG-RVRRCGMVS
RSMA_MYCGI      HLLAEFPS----IRTVM-VMVQAEVAERLAAEPGGKD-YGVPSAKVRFFG-NVRRYGMVS
RSMA_MYCVP      HLLAEFPS----IRTVM-VMVQAEVAERLAAEPGGKD-YGVPSAKVRFFG-NVRRYGMVS
RSMA_MYCSJ      HLLAEFPT----IRSVM-VMVQAEVAERLAADPGGKD-YGVPSAKVRFYG-NVRRYGMVS
RSMA_MYCSS      HLLAEFPT----IRSVM-VMVQAEVAERLAADPGGKD-YGVPSAKVRFYG-NVRRYGMVS
RSMA_MYCSK      HLLAEFPT----IRSVM-VMVQAEVAERLAADPGGKD-YGVPSAKVRFYG-NVRRYGMVS
RSMA_RHOOB      HLFSELPS----LRTAL-VMVQAEVADRLAASPGSKI-YGVPSVKANFFG-AVRRAGAVG
RSMA_RHOJR      HLFSELPS----LRTAL-VMVQAEVADRLAASPGSKI-YGVPSVKANFFG-AVRRAGAVG
RSMA_RHOE4      HLFASLPS----LRTAL-VMVQAEVADRLAADPGSKI-YGVPSVKANFFG-EVRRAGAVG
RSMA_NOCFA      HLLAELPG----LRTAL-VMVQAEVADRLAAEPGSRV-YGVPSVKAGFFG-TVRRAGAVG
RSMA_BIFLD      TLLERFDN----LGSFL-VMVQKEVADRLAAKPGSKI-YGTPSVKLAWYG-TAERVGTIG
RSMA_BIFLS      TLLERFDN----LGSFL-VMVQKEVADRLAAKPGSKI-YGTPSVKLAWYG-TAERVGTIG
RSMA_BIFLO      TLLERFDN----LGSFL-VMVQKEVADRLAAKPGSKI-YGTPSVKLAWYG-TAERVGTIG
RSMA_BIFAA      TLLERFDN----LGTFL-VMVQKEVADRLSEKPGSKI-YGTPSVKLAWYG-TAERVGVIG
RSMA_ACIC1      RVFERFST----VTRTV-IMVQREVAERLCADPGSPA-YGAPSIKLRWYG-RARIVGSVS
RSMA_OPITP      AVLGG-PL----PERMV-LMLQQEAAQRYVAMPGSKS-FGAISVFLQSAY-EVAPGHRVE
RSMA_DEIGD      RFMQA-PG----IISAT-VLVQKEVAGRLAARPGEDN-YGFLSALAALYG-TVQHVRDVP
RSMA_DEIRA      RFMQA-PG----VVSAT-VLVQKEVAQRLVAQPGQDN-YGFLSAVAALYG-SVKHVRDVP
RSMA_THET2      RLLKT-GR----FARLV-FLVQKEVAERMTARPKTPA-YGVLTLRVAHHA-VAERLFDLP
RSMA_THET8      RLLKT-GR----FARLV-FLVQKEVAERMTARPKTPA-YGVLTLRVAHHA-VAERLFDLP
RSMA_CHLTR      KFFLECPY----RWKTVTVMIQDEVARRITAKPGDKD-YGSLTVFLSFFA-DVQYAFKVS
RSMA_CHLTA      KFFLECPY----RWKTVTVMIQDEVARRITAKPGDKD-YGSLTVFLSFFA-DVQYAFKVS
RSMA_CHLT2      KFFLECPY----RWKTVTVMIQDEVARRITAKPGDKD-YGSLTVFLSFFA-DVQYAFKVS
RSMA_CHLTB      KFFLECPY----RWKTVTVMIQDEVARRITAKPGDKD-YGSLTVFLSFFA-DVQYAFKVS
RSMA_CHLMU      KFFLECPN----RWKTVTVMIQDEVARRITANPGDKD-YSSLTVFLRFFA-DVQYAFKVS
RSMA_CHLCV      KLFLEVPN----QWKTVTVMMQDEVARRITAQPGGKE-YGSLTIFLQFFA-DVRYAFKVS
RSMA_CHLFF      KLFLEVPN----QWKTITVMMQDEVARRITAQPGGKE-YGSLTIFLQFFA-DVRYAFKVS
RSMA_CHLAB      KLFLEAPN----QWKTVTVMIQDEVARRITAQPGGKE-YGSLTIFLQFFV-DVHYAFKVS
RSMA_CHLPN      KLFLEAPD----FWKTVTVMVQDEVARRIVAQPGGRD-YGSLTIFLQFFA-DIHYAFKVS
RSMA_PARUW      EMVVR-RK----LFSSLTVMVQEEVARRMTALPGQSD-YSSFTIFLNFYS-KPRYGFTVS
RSMA_ALKMQ      RFLEEKVP----VDSLV-IMIQKEVAVRMQAGPGTKD-YGALSIAVQYYC-NPEILLKVP
RSMA_ALKOO      KFLEEKVP----VKSLT-IMIQKEVADRMQAGPGTKD-YGALSIAVQYYS-NPKILLKVP
RSMA_CLOD6      KFLEEDIP----VTDIV-VMVQKEVADRMNAIPGTKD-YGALSIAVQYYC-DTEIVAKAP
RSMA_LACP7      GLFEAHVP----IDNIT-VMVQKEVADRMQSGPGSKD-YGALSLAVQYYA-DPYIVANVP
RSMA_CLOPE      NLLKGGYN----FKSLT-IMIQKEVAERMNAEPNCKD-YGALSILVQYYC-NTKIVRKVP
RSMA_CLOP1      NLLKGGYN----FKSLT-IMIQKEVAERMNAEPNCKD-YGALSILVQYYC-NTKIVRKVP
RSMA_CLOPS      NLLKGGYN----FKSLT-IMIQKEVAERMNAEPNCKD-YGALSILVQYYC-NTKIVRKVP
RSMA_CLOAB      KLLNEGYN----FKSLT-IMIQKEVGDRIAAKPSTKD-YGALTLLVQYYC-DVKVVRVVK
RSMA_CLOB6      RLLTEKCD----FKSLT-IMIQKEVAERINAEPNCKE-YGSLTVLVQYYC-DTKIIRKVS
RSMA_CLOBJ      RLLTEKCN----FKSLT-IMIQKEVAERINAEPNCKE-YGSLTVLVQYYC-NTKIIRKVS
RSMA_CLOB1      RLLTEKCD----FKSLT-IMIQKEVAERINAEPNCKE-YGSLTVLVQYYC-NTKIIRKVS
RSMA_CLOBL      RLLTEKCD----FKSLT-IMIQKEVAERINAEPNCKE-YGSLTVLVQYYC-NTKIIRKVS
RSMA_CLOBK      RLLTEKCD----FKSLT-IMIQKEVAERINAEPNCKE-YGSLTVLVQYYC-NTKIIRKVS
RSMA_CLOBM      RLLKEKCD----FKSLT-IMIQKEVAERIDAEPNCKE-YGSLTVLVQYYC-NTEIIRKVS
RSMA_HALOH      GLLESNIT----FSLMV-LMVQKEVADRMAAAPGSKD-YGALSVAVQYYG-EVEIFHKVP
RSMA_MOOTA      HLLTSRFR----IAELV-LMVQAEVGYRMLARPGGKD-YGALSVVVQYYT-EPAVVLKVP
RSMA_PELTS      RLLLERFN----FALMV-VMVQLEVAFRLTASPGTAD-YGALSVAVQYFT-EPKVLFRVP
RSMA_SYMTH      RLLEEELP----LSHVV-VMVQKEVADRMVSPPGSKA-YGALSVAVQYYT-EPRIVLRVS
RSMA_CALS4      KMLDCKL-----VKEMT-VLVQKEVAERICALPGTKD-YGMLTVFVNFKA-KPEILFNLP
RSMA_DEHMB      QFLEAKLK----PESMV-VMVQKEVAKNIVAKTG--D-MGLLTLSIRFYG-NPSLVSVVP
RSMA_DEHMC      QFLEAKLK----PESMV-VMVQKEVAKNIVAKTG--D-MGLLTLSVRFYG-NPSLVSVVP
RSMA_DEHM1      QFLEAEAK----PELMV-VMVQKEVAKNMVAQTG--D-MGLLTLSVRFYG-NPSLVSVVP
RSMA_DESHD      HFLEQKDS----LASMV-VMVQKEVADRLVAKPGGKD-YGILSIAAQVSA-QGEKLFEVP
RSMA_DESHY      HFLEQKDS----LASMV-VMVQKEVADRLVAKPGGKD-YGILSIAAQVSA-QGEKLFEVP
RSMA_GEOKA      KLLTERLP----IRGMV-VMLQKEVADRLAAKPGTKD-YGSLTIAVQYYT-EAEVIMTVP
RSMA_GEOTN      KLLTERLP----IRGMV-VMMQKEVADRLAAKPGTKD-YGSLTIAVQYYT-EAEVVMTVP
RSMA_GEOSW      KLLTDRLP----IRGMV-VMLQKEVADRLAAKPGTKD-YGSLSIAIQYYT-EAETVMTVP
RSMA_ANOFW      KLLTDRLP----IRGMV-VMLQKEVADRMAAKPGTKD-YGSLTIAVQYYT-HAETVMHVP
RSMA_BACLD      KLLEENLP----LKGIV-VMLQKEVADRMAAKPSSKE-YGSLSIAVQFYT-EAKTVMNVP
RSMA_BACSU      KLLEEHLP----LKGIV-VMLQKEVAERMAADPSSKE-YGSLSIAVQFYT-EAKTVMIVP
RSMA_BACP2      KLLEENLP----LKGIV-VMLQKEVADRMAAIPSSKE-YNSLSIAVQYYT-EAKTVMVVP
RSMA_BACAN      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACAA      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACHK      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACCZ      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACAC      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACC7      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACC0      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACC1      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACCQ      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACCR      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACC4      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACC2      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACC3      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACAH      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACMK      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKE-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACCN      KLLEEKLP----VRGFV-VMMQKEVGDRLAAKPGTKD-YGSLSIAIQYYT-EVETVMTVP
RSMA_BACHD      KLLEAKLP----VRGIV-VMIQAEVADRIAAKPGTKE-YGSLSIAAQYYA-TAELAVKVP
RSMA_LYSSC      KLLNDRLP----IRGFV-VMMQKEVADRITAKPGTKE-YGSLSIAIQYYV-KADIAMTVP
RSMA_BACSK      KLLEDRLP----FKSIT-VMIQAEVAERIAAKPGSKE-YGALSIAAQYYA-EAKPMVVVP
RSMA_OCEIH      KLIRDRLP----VTSLT-VMIQKEVADRMSGEPNSKS-YGSLSLAVQYYS-EAKVVMNVP
RSMA_LISMC      KLLHDNIP----ADSMT-FMLQKEVADRISAVPSTKS-YGSLTIAIQFYM-EAELAFIVP
RSMA_LISMF      KLLHDNIP----ADSMT-FMLQKEVADRISAVPSTKS-YGSLTIAIQFYM-EAELAFIVP
RSMA_LISMO      KLLHDNIP----ADSMT-FMLQKEVADRISAVPSTKS-YGSLTIAIQFYM-EAELAFIVP
RSMA_LISMH      KLLHDNIP----ADSMT-FMLQKEVADRISAVPSTKS-YGSLTIAIQFYM-EAELAFIVP
RSMA_LISIN      KLLHDNIP----ADSMT-FMLQKEVADRISAVPSTKS-YGSLTIAIQFYM-EAELAFIVP
RSMA_LISW6      KLLHDNIP----ADSMT-FMLQKEVADRISAVPSTKS-YGSLTIAIQFYM-EAELAFIVP
RSMA_STAAT      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAA3      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAC      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAA2      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAA9      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAS      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAA1      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAM      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAW      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAN      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAA8      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAB      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAE      NLMQQDIP----IDGYV-VMMQKEVGERLNAEVGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAAR      NLMQQDIP----IDGYV-VMMQKEVGERLNAEIGSKA-YGSLSIVVQYYT-ETSKVLTVP
RSMA_STAES      NLMQQDVP----IDGFV-VMMQKEVGERLNAQVGTKA-YGSLSIVAQYYT-ETSKVLTVP
RSMA_STAEQ      NLMQQDVP----IDGFV-VMMQKEVGERLNAQVGTKA-YGSLSIVAQYYT-ETSKVLTVP
RSMA_STAHJ      NLMQQDIP----IDGYV-VMMQKEVGERLNAQVGTKA-YGSLSIVTQYYT-ETSKVLTVP
RSMA_STACT      NLMSKSLP----IDGYV-VMMQKEVGERLNAEIGTKA-YGSLSIVAQYYT-ETSKVLTVP
RSMA_STAS1      NLMQQKLP----IDGYV-VMMQKEVGERLNAQVGTKA-YGSLSIVAQYYT-ETSKVLTVP
RSMA_MACCJ      GLLEKNLN----INSYV-VMMQKEVGERLSAIPSTKA-YGSLSIAVQYYT-DVKRIMVVP
RSMA_STRA1      HLIESKIP----FAEFV-VMMQKEVADRISAMPNTKA-YGSLSIAVQYYM-TAKVSFIVP
RSMA_STRA5      HLIESKIP----FAEFV-VMIQKEVADRISAMPNTKA-YGSLSIAVQYYM-TAKVSFIVP
RSMA_STRA3      HLIEGKIP----FAEFV-VMMQREVADRISAMPNTKA-YGSLSIAVQYYM-TAKVSFIVP
RSMA_STRMU      HLIESKIP----FAEFV-VMMQKEVADRISAQPSTKA-YGSLSIAVQYYM-TAKIAFIVP
RSMA_STRS7      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKIAFVVP
RSMA_STREM      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKIAFVVP
RSMA_STRE4      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKIAFVVP
RSMA_STRPB      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPC      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRP1      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPF      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPD      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPM      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRP8      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPG      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRP6      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRP3      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRU0      HLIESKIP----FQEFV-VMMQREVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRT2      HLIESKIP----FSEFV-VMMQKEVADRISAEPNTKA-YGSLSIAVQYYM-TTKMAFAVP
RSMA_STRTD      HLIESKIP----FSEFV-VMMQKEVADRISAEPNTKA-YGSLSIAVQYYM-TTKVAFAVP
RSMA_STRT1      HLIESKIP----FSEFV-VMMQKEVADRISAEPNTKA-YGSLSIAVQYYM-TAKVAFAVP
RSMA_STRGC      HLIESGIP----FSEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRSV      HLIESGIP----FSEFV-VMMQREVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPN      HLIESGIP----FCEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRZT      HLIESGIP----FCEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPJ      HLIESGIP----FCEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRP7      HLIESGIP----FCEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRZJ      HLIESGIP----FCEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPI      HLIESGIP----FCEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRP4      HLIESGIP----FCEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRR6      HLIESGIP----FSEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRP2      HLIESGIP----FSEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRPS      HLIESGIP----FSEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_STRZP      HLIESGIP----FSEFV-VMMQKEVADRISAQPNTKA-YGSLSIAVQYYM-TAKVAFIVP
RSMA_LACLA      HLIESKIP----FSEFV-VMMQKEVADRIAASPKTKA-YGSLSIAVQYYM-EASVAFIVP
RSMA_ENTFA      HFLESSLD----VAEMV-VMMQKEVADRIAAKPGTKA-YGSLSIAVQYFM-EASVAFIVP
RSMA_LACSS      HLLEAGLP----IDRMV-LMMQKEVAERIDAAPGSKA-YGSLSIAVQLHS-EVKLAFIVP
RSMA_LACPL      NILAGDVA----FENIV-VMMQKEVADRLAAEPGTKA-YGALTIAVQYRM-AAEMAMVVP
RSMA_LACS1      HLLDSGIE----FETIV-VMMQKEVAERLAANPGTKA-YGSLSVAVQYEM-DSEIAFIVP
RSMA_LACBA      GVLQSTVR----FEAIV-VMMQAEVAERLVAEPGTKA-YGSLSVIMQYRA-HVEIAFNVP
RSMA_PEDPA      TFMASTLP----IDKMV-VMMQKEVAERLTAQPGDKE-YGSLSVVVQYRM-NTQIEFDVS
RSMA_LACRD      NLLASPVE----WATIC-VMMQKEVAQRLTAKPGTKQ-YGALTLAIEYQM-QAKIAFDVS
RSMA_LACRJ      NLLASPVE----WATIC-VMMQKEVAQRLTAKPGTKQ-YGALTLAIEYQM-QAKIAFDVS
RSMA_LEUCK      QLLRAKIS----WDNIV-VMMQREVADRLNAEIGTKA-YGVLTLTIQYYA-QAQLAIKVP
RSMA_LEUMM      QLLRSNIN----WDNIV-VMMQREVADRLNAAVGTKS-YGVLTLTIQYFA-QATLAIKVP
RSMA_OENOB      YLLNSSLN----FKSVT-VMMQKEVAARLQAGVGSKD-YGELSLAIQYRV-NVEIILPVT
RSMA_LACAC      ALSESDLH----FSSLT-LMMQKEVAERLEAKPGNKE-YGPLTISVQTEM-NVKIALEVK
RSMA_LACH4      ALAESDLH----FASLT-LMMQKEVAERLEAKPGSKE-YGPLTISVQTEM-DVKVALEVN
RSMA_LACJO      NLIKSDLD----FSSLT-LMMQKEVAERLVAKPKTKE-YGPLSIAVQSRM-NVRLAEEVK
RSMA_LACDA      NLLESSLD----FTSLT-LMMQKEVAERLAAQPGSKA-YGPLSIAVQTQM-SVDLALEVG
RSMA_LACDB      NLLESSLD----FTSLT-LMMQKEVAERLAAQPGSKA-YGPLSIAVQTQM-SVDLALEVG
RSMA_CARHZ      KVFEEGYK----VSSMT-LMMQKEVAERITAKPGSKI-YGSLSVACQYFS-EPRIVLKVP
RSMA_ACIF2      HILEHAE-----QVRDMHFMLQKEVVDRVVAMPGSKA-YGRLSVMIQAYC-AVESLFTVA
RSMA_ACIF5      HILEHAE-----QVRDMHFMLQKEVVDRVVAMPGSKA-YGRLSVMIQAYC-AVESLFTVA
RSMA_HALHL      HLLAAAD-----VIEDLHLLLQREVVDRMVAPPGGKT-RGRLSVMVQYRC-RVERCFNVP
RSMA_ACISJ      HLLAHVR-----VIADQHFMLQKEVIDRMVAAPATSA-YGRLSVMLQWRY-AMENVLFVP
RSMA_ACIET      HLLAHVR-----VIADQHFMLQKEVIDRMVAAPATSA-YGRLSVMLQWRY-AMENVLFVP
RSMA_ACIAC      HLLEHVG-----VVEDQHFMLQKEVIDRMVAQPATSD-YGRLSVMLQWRY-AMEDVLFVP
RSMA_POLSJ      HLLDAVD-----VIEDQHFMLQKEVIDRMVAAPSTSD-YGRLSVMLQWRY-AMENVLFVP
RSMA_POLNA      HLLDAVE-----VIEDQHFMLQKEVIDRMVAMPSTSD-YGRLSVMLQWRY-AMENVLYVP
RSMA_RHOFT      HLLNFID-----VIEDQHFMLQKEVIDRMVAGPCTAA-YGRLSVMLQWRY-AMENVLLVP
RSMA_VARPS      HLLGFAH-----LIADQHFMLQKEVIDRMVARPATSD-YSRLSVMLQWRY-RMENVLFVP
RSMA_VEREI      HLLAHGS-----AIEDQHFMLQKQVVERMVAKPGGSD-YGRLSVMLQWRY-AMEKLLHVP
RSMA_LEPCP      HLLEQVA-----SVQDQHFMLQKEVVDRMASAPGSKD-YGRLSVMLQWRY-QIESLLDVP
RSMA_METPP      HLLPAAA-----QVEDQHFMLQKEVVERMAAAPCSKD-YGRLSVMLQWRY-DIESVLDVP
RSMA_BURCM      HLMTFAD-----AVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMEKMLDVP
RSMA_BURA4      HLMTFAD-----AVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMEKMLDVP
RSMA_BURCA      HLMTFAD-----AVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMEKMLDVP
RSMA_BURCH      HLMTFAD-----AVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMEKMLDVP
RSMA_BURCC      HLMTFAD-----AVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMEKMLDVP
RSMA_BURCJ      HLMTFAD-----AVVDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMEKMLDVP
RSMA_BURL3      HLMTFAD-----AVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMEKMLDVP
RSMA_BURM1      HLMTFAD-----VVVDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURVG      HLMTFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKMLDVP
RSMA_BURMA      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURPS      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURM9      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURM7      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURMS      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURP1      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURP0      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURP6      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_BURTA      HLMSFAP-----VVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VMDKLIDVP
RSMA_PARPJ      HLTSFAH-----RVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VIDKQLDVP
RSMA_PARXL      HLTAFAH-----CVIDQHFMLQNEVVERMVAEPGTKA-FSRLSVMLQYRY-VIDKQLDVP
RSMA_PARP8      HLATFAE-----RVIDQHFMLQNEVVERMVAEPGSKA-FSRLSVMLQYRY-VIDKLLDVP
RSMA_CUPTR      HLMEFAD-----HVHDQHFMLQKEVVERMVAEPGSKA-FGRLSIMLQVRY-YMEHVLDVP
RSMA_CUPNH      HLMDFAD-----HVRDQHFMLQKEVVERMVAEPGSKA-FGRLSIMLQVRY-YMEHVLDVP
RSMA_CUPPJ      HLMDYAD-----HVHDQHFMLQKEVVDRMVAEPGSKA-FGRLSIMLQVRY-HMEHVLDVP
RSMA_CUPMC      HLVDFAD-----DVRDQHFMLQKEVVERMVADPGSKS-YGRLSIMLQVRY-HMEHVLDVP
RSMA_RALSO      HLSAFAD-----RVRDQHFMLQKEVVDRMVAAPGSKA-FSRLSVMLQVRY-YMELVLEVP
RSMA_BURSP      HLLDEMN-----EVVDQHFMLQREVAARIAAAPGSAH-YGRLSVMLQSRY-AVERLFDVP
RSMA_BORBR      HLMGAAE-----QVRDQHFMLQREVIDRMVAEPGSGD-YSRLSVMLQARY-RMEKLFDVA
RSMA_BORPE      HLMGAAE-----QVRDQHFMLQREVIDRMVAEPGSGD-YSRLSVMLQARY-RMEKLFDVA
RSMA_BORPA      HLMGAAE-----QVRDQHFMLQREVIDRMVAEPGSGD-YSRLSVMLQARY-RMEMLFDVA
RSMA_BORA1      HLMGAAD-----LVRDQHFMLQREVIDRMVAEPRSAD-YGRLSVMLQSRY-RMEKLFDVP
RSMA_BORPD      HLMAAAD-----TVRDQHFMLQREVIDRMVAAPGSAD-YGRLSVMLQSRY-RMDKLFDVP
RSMA_HERAR      HLAEMAP-----HVQDQHFMLQKEVVERMVAEPGSKT-YGRLSVMLQWRY-HMELMFIVP
RSMA_JANMA      HLAEMAP-----HVQDQHFMLQKEVVERMVAEPGSKV-YGRLSVMLQWRY-HMELMFVVP
RSMA_AROAE      HLAEFAA-----RVRDMTFMLQKEVVMRMVAEPGTED-YGRLSVMLQYRF-RMGRLFDVP
RSMA_THIDA      HLLEFAP-----RIRDMHFMLQKEVVERMVASPATAD-YGRLSIMLQRRF-HMEWLLDVP
RSMA_METFK      HLLDNVP-----HIIDMHFMLQKEVVERMVAAPSSAA-YGRLSVMLQYRL-HMEYLLTVP
RSMA_CHRVO      HLASYGN-----RVTDMHFMLQKEVIERMVAEPSTAD-YGRLTVMLQYRF-YMENILFVP
RSMA_LARHH      HLATYAD-----RVTDMHFMLQKEVVDRMVADPGCAD-YGRLTVMLQYRF-AMERLIDVP
RSMA_NEIG1      KLAEVAD-----DVADMHFMLQKEVVERMVAAPKSND-YGRLGVMLQYFF-DMELLIDVP
RSMA_NEIG2      KLAEVAD-----DVADMHFMLQKEVVERMVAAPKSND-YGRLGVMLQYFF-DMELLIDVP
RSMA_NEIMA      KLAEVAD-----DVVDMHFMLQKEVVDRMVAAPKSND-YGRLGVMLQYFF-DMEMLIDVP
RSMA_NEIM0      KLAEVAD-----DVVDMHFMLQKEVVDRMVAAPKSND-YGRLGVMLQYFF-DMELLIDVP
RSMA_NEIMB      KLAEVAD-----DVVDMHFMLQKEVVERMVAAPKSND-YGRLGVMLQYFF-DMEMLIDVP
RSMA_NEIMF      KLAEVAD-----DVVDMHFMLQKEVVERMVAAPKSND-YGRLGVMLQYFF-DMEMLIDVP
RSMA_DECAR      HLAEYVD-----VVHDMHFMLQKEVVERMVAEPGNAD-FGRMSVMLQYRF-YLEWLIDVP
RSMA_NITEU      HLSRFSS-----LITDMYFMLQLEVVERMVALPSTPD-YGRLSIMLQNRF-EMEQMLVVP
RSMA_NITEC      HLSRFSN-----LIIDMHFMLQLEVVERMVAQPSTPD-YGRLSLMLQNRF-EMEQMLIVP
RSMA_NITMU      HLSRFTD-----HLRDMHFMLQKEVVARMVAKPSTSD-YGRLSVMLQCRF-EMEQLFIVP
RSMA_PSYA2      HLLSYAD-----VIEDMHFMLQKEVVERITADVGSKT-YGRLSVIMQYHC-HTDYLLTVP
RSMA_PSYCK      HLLSYAD-----VIEDMHFMLQKEVVERITADVGSKT-YGRLSVIMQYHC-HTDYLLTVP
RSMA_ACIAD      HLLEFGD-----KVKDMHFMLQKEVVDRITAEPNTKE-YGRLSVMIQYFC-QPTFLFEVP
RSMA_COXBU      HLFSQIH-----CIEDMHFMLQKEVVRRITAEVGSHD-YGRLSVMAQYFC-DNTYLFTVS
RSMA_COXB2      HLFSQIH-----CIEDMHFMLQKEVVRRITAEVGSHD-YGRLSVMAQYFC-DNTYLFTVS
RSMA_COXBR      HLFSQIH-----CIEDMHFMLQKEVVRRITAEVGSHD-YGRLSVMAKYFC-DNTYLFTVS
RSMA_COXBN      HLFSQIH-----CIEDMHFMLQKEVVRRITAEVGSHD-YGRLSVMAQYFC-DNTYLFTVS
RSMA_COXB1      HLFSQIH-----CIEDMHFMLQKEVVRRITAEVGSHD-YGRLSVMAQYFC-DNTYLFTVS
RSMA_ALCBS      HLLAQAD-----AISDMTFMLQKEVVERLTASPGTRD-WGRLSIMVQYHC-QADYLFFVP
RSMA_HAHCH      HLLTFRG-----LVQDMYFMLQKEVVDRLAAKPGEDA-YGRLGVMAQYYC-KVESLFNVG
RSMA_MARHV      HLLSQSG-----VVQDMHFMLQKEVVQRLAAVPGDNN-YGRLGIMAQYFC-KVQPLFEVG
RSMA_MARMS      HLLSQAQ-----AIEDMHFMLQKEVVDRLAARPGDSL-YGRLSVMAQYYC-AVESLFIVG
RSMA_PSEF5      HLLQNAG-----LIRDMHFMLQKEVVERLAAGPGGGD-WGRLSIMVQYHC-RVEHLFNVG
RSMA_PSEPF      HLLNNAG-----IIRDMHFMLQKEVVERLAAGPGGGD-WGRLSIMVQYHC-RVEHLFNVG
RSMA_PSE14      HLLQNAS-----LIRDMHFMLQKEVVERMAAGPGGGD-WGRLSIMVQYHC-RVEHLFNVG
RSMA_PSESM      HLLQNAS-----LIRDMHFMLQKEVVERMAAGPGGGD-WGRLSIMVQYHC-RVEHLFNVG
RSMA_PSEU2      HLLQNAS-----LIRDMHFMLQKEVVERMAAGPGGGD-WGRLSIMVQYHC-RVEHLFNVG
RSMA_PSEPK      HLLSHAG-----LIRDMHFMLQKEVVERMAAGPGGGD-WGRLSIMVQYHC-RVEHLFNVG
RSMA_PSEAE      HLLEHAP-----VIEDMHFMLQKEVVERLAATPGGGD-WGRLSIMVQYHC-RVEHLFNVG
RSMA_CHRSD      HLLTARG-----AIADMHFMLQREVVERLAATPGSAA-WGRLSVMTQYHC-RVDNLFVVP
RSMA_SACD2      HLLSFGE-----LIADMHFMLQKEVVLRLAAGPGDKN-YGRLSVMTQYVC-QVENLFEVP
RSMA_METCA      HLFDQID-----VIEDMHFMLQKEVVDRLCAGAGDDH-YGRLSVMAALYC-QAQHLFDVG
RSMA_LEGPC      YLLKFIT-----CIDDMHFMLQKEVVERIAATHGTKA-YGRLSVMLQYHC-EVEYLFDVP
RSMA_LEGPA      YLLKFIT-----CIDDMHFMLQKEVVERIAATHGTKA-YGRLSVMLQYHC-EVEYLFDVP
RSMA_LEGPL      YLLKFIT-----CIDDMHFMLQKEVVERIAAAHGTKA-YGRLSVMLQYHC-EVEYLFDVP
RSMA_LEGPH      YLLKFIT-----CIDDMHFMLQKEVVERIAAAHGTKA-YGRLSVMLQYHC-EVEYLFDVP
RSMA_NITOC      HLLGQIG-----ILEDMHFMLQREVVTRLAAKPGGKD-YGRLSVMVQFYC-EVEPLFTVK
RSMA_HYDCU      HLLKYAR-----YIQDMHFMLQKEVVERITAQPGVKA-YGRLSVMIQYTC-ETEYLLTVG
RSMA_XANAC      HALDHAA-----AVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-EVTALFVVP
RSMA_XANC5      HALDHAA-----AVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-EVTALFVVP
RSMA_XANOR      HALDHAA-----VVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-DVTALFVVP
RSMA_XANOM      HALDHAA-----VVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-DVTALFVVP
RSMA_XANOP      HALDHAA-----VVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-DVTALFVVP
RSMA_XANCP      HALDHAG-----AVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-EVTALFVVP
RSMA_XANC8      HALDHAG-----AVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-EVTALFVVP
RSMA_XANCB      HALDHAS-----AVADMHFMLQKEVVDRMAAGPGSKV-YGRLSVMLQAYC-EVTALFVVP
RSMA_XYLFA      HVLQQAA-----IIADMHFMLQKEVVDRMAAPPGSKV-YGRLSVMLQAWC-EVTTMFVVP
RSMA_XYLFT      HVLQQAA-----IIADMHFMLQKEVVDRMAAPPGSKV-YGRLSVMLQAWC-EVTTMFVVP
RSMA_DICNV      HCVAQRS-----DIVDMHFMLQKEVVDRITAPVDTPA-YGRLSVMIQLYC-QVEALFDVP
RSMA_ACTP2      HLFKFHD-----LIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYYC-QVMPVLEVP
RSMA_ACTP7      HLFKFHD-----LIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYYC-QVMPVLEVP
RSMA_ACTPJ      HLFKFHD-----LIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYYC-QVVPVLEVP
RSMA_HAEDU      HLFKFHD-----LIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYYC-QVIPVLEVP
RSMA_HAEIE      HLFKYHD-----VIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYFC-QVMPVLEVP
RSMA_HAEIG      HLFKYHD-----VIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYFC-QVMPVLEVP
RSMA_HAEIN      HLFKYHD-----VIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYFC-QVMPVLEVP
RSMA_HAEI8      HLFKYHD-----VIQDMHFMLQKEVVKRLCAGPNSKA-YGRLTIMAQYFC-QVMPVLEVP
RSMA_PASMU      HLFKYHD-----CIQDMHFMLQKEVVKRLCAGPNSKA-YGRLTIMAQYFC-QVMPVLEVP
RSMA_MANSM      HLLKFYD-----KIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMTQYFC-QVMPVLEVP
RSMA_HAES1      HLFKYHA-----IIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYFC-QVLPVLEVP
RSMA_HISS2      HLFKYHA-----IIQDMHFMLQKEVVKRLCAAPNSKA-YGRLTIMAQYFC-QVLPVLEVP
RSMA_PSYIN      HLFEYAD-----KISDMHFMLQKEVVNRLCAGPNCKA-YGRLTVMAQYYC-RIIPVLEVP
RSMA_AERHH      HLCEFAD-----RVEDMHFMLQKEVVLRLAAGPGSKA-YGRLSVMTQYYC-QVVPVLEVG
RSMA_TOLAT      HLLEKSQ-----YITDMYFMLQKEVVERLAAGPNSKD-YGRLTVMTQYYC-QVMPVLEVG
RSMA_ALIF1      HLFEFHK-----DVQDMHFMLQKEVVNRLAAGPGTKA-YGRLTVMAQYFC-KVMPVLEVP
RSMA_ALIFM      HLFEFHK-----DVQDMHFMLQKEVVNRLAAGPGTKA-YGRLTVMAQYFC-KVMPVLEVP
RSMA_ALISL      HLFEFHK-----DIQDMHFMLQKEVVNRLAAGPGTKA-YGRLTVMAQYYC-KVMPVLEVP
RSMA_VIBA3      HLFEFHK-----DVQDMHFMLQKEVVNRLAAGPGTKA-YGRLTVMAQYYC-KVTPVLEVP
RSMA_VIBCH      HLFEFHR-----DIQDMHFMLQKEVVNRLAAGPGTKA-YGRLTVMAQYYC-KVVPVLEVP
RSMA_VIBC3      HLFEFHR-----DIQDMHFMLQKEVVNRLAAGPGTKA-YGRLTVMAQYYC-KVVPVLEVP
RSMA_VIBCB      HLFEFHK-----DIQDMHFMLQKEVVNRLAAGPGSKA-YGRLTVMAQYYC-KVVPVLEVP
RSMA_VIBPA      HLFEFHK-----DIQDMHFMLQKEVVNRLAAGPGSKA-YGRLTVMAQYYC-KVVPVLEVP
RSMA_VIBVU      HLFEFHK-----DIQDMHFMLQKEVVNRLAAGPGSKA-YGRLTVMAQYYC-KVVPVLEVP
RSMA_VIBVY      HLFEFHK-----DIQDMHFMLQKEVVNRLAAGPGSKA-YGRLTVMAQYYC-KVVPVLEVP
RSMA_PHOPR      HLFTFHE-----HVEDMHFMLQKEVVNRLAAGPGCKA-YGRLTVMAQYYS-RVTPVLEVP
RSMA_SHEB5      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGCKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHEB2      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGCKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHEB8      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGCKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHEB9      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGCKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHEPC      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGCKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHESW      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGCKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHESM      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGNKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHESR      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGNKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHESA      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGNKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHEON      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGTKA-YGRLTVMAQYFC-QVVPVLEVP
RSMA_SHEDO      HLFEFAE-----IIETMHFMLQKEVVLRLSASPGCKA-YGRLTVMAQYYC-QVVPVLEVP
RSMA_SHEFN      HLFEFAE-----QIETMHFMLQKEVVLRLSASPGTKA-YGRLTVMAQYYC-QVVPVLEVP
RSMA_SHEHH      HLFEFAQ-----HIENMHFMLQKEVVLRLSASPGTKA-YGRLTVMAQYHC-QVMPVLEVP
RSMA_SHEPA      HLFEFAQ-----HIENMHFMLQKEVVLRLSASPGTKA-YGRLTVMAQYHC-QVMPVLEVP
RSMA_SHEPW      HLFEFAQ-----YIENMHFMLQKEVVLRLSASPGTKA-YGRLTVMAQYHC-QVMPVLEVP
RSMA_SHESH      HLFEFAE-----QIENMHFMLQKEVVLRLSASPGTKA-YGRLTVMAQYHC-QVMPVLEVP
RSMA_SHEWM      HLFEFAE-----QIENMHFMLQKEVVLRLSASPGTKA-YGRLTVMAQYHC-QVMPVLEVP
RSMA_SHELP      HLFEFAE-----HIENMHFMLQKEVVLRLSAAPGTKA-YGRLTVMAQYFC-QVMPVLEVP
RSMA_SHEAM      HLFEFAE-----HIENMHFMLQKEVVLRLSASPGTKA-YGKLTVMAQYYC-QVVPVLEVP
RSMA_PSET1      HLFEFAD-----NIEHMHFMLQKEVVKRMVAGPGSKT-FGRLSVMTQYYC-NAMPVIEVP
RSMA_COLP3      HLLTFKD-----KVKDMHFMLQKEVVERMAAGPHCKA-YGRLSIMTQYQC-QVFPVMEIG
RSMA_IDILO      HLLKFAD-----DVKDMHFMLQKEVVDRLAAEPGSKS-YGRISVGVQQAC-KVTPVVAVP
RSMA_SALA4      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALDC      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALEP      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALG2      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALHS      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALPA      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALPK      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALPB      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALPC      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALTI      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALTY      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKE-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALAR      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLGVP
RSMA_SALNS      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALCH      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_SALSV      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_CITK8      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_KLEP3      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_KLEP7      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QVIPVLEVP
RSMA_ECOUT      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO27      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOK1      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO45      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOL6      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOL5      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO81      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO55      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOLC      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOHS      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_SHIBS      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOBW      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECODH      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOLI      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOSM      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO7I      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO8A      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_SHIF8      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_SHISS      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_SHIB3      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOSE      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO57      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO5E      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_SHIFL      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ESCF3      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_SHIDS      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKV-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECO24      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_ECOLU      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-NVIPVLEVP
RSMA_CROS8      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYFC-QVIPVLEVP
RSMA_ENT38      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPNSKA-YGRLSVMAQYYC-QIIPVLEVP
RSMA_PECAS      HLFTYTQ-----SIRDMHFMLQKEVVNRLVAGPNSKT-FGRLSVMAQYYC-QIIPVLEVP
RSMA_PECCP      HLFSYTQ-----SIRDMHFMLQKEVVNRLVAGPNSKA-FGRLSVMAQYYC-QVIPVLEVP
RSMA_YERPE      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKT-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERPP      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKT-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERPN      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKT-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERPG      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKT-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERPA      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKT-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERPS      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKA-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERPB      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKA-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERP3      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKA-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERPY      HLFSYTD-----AIRDMHFMLQKEVVNRLVAGPNSKA-YGRLTVMAQYYC-NVIPVLEVP
RSMA_YERE8      HLFSYTS-----AIRDMHFMLQKEVVNRLVAGPNSKA-YGRLTVMAQYYC-NVIPVLEVP
RSMA_SERP5      HLFSYTQ-----AIRDMHFMLQKEVVNRLVAGPNSKA-YGRLTVMAQYYC-NVIPVLEVP
RSMA_PHOLL      HLFSYTD-----AIADMHFMLQKEVVNRLVAGPGSKT-FGRLSVMAQYYC-QVIPVLEVP
RSMA_ERWT9      HLFSYVG-----AIKDMHFMLQKEVVNRLVAGPGSKA-YGRLTVMAQYYC-QVIPVLEVP
RSMA_SODGM      HLFSYTH-----AIRDMHFMLQKEVVNRLVDGPNGKA-YGRLSVMAQYYC-QIIPVLEVP
RSMA_PROMH      HLFSFAD-----AISDMTFMLQKEVVNRLVASHGSKT-YGRLSVMAQYHC-QVIPIIEVP
RSMA_HAMD5      HLFKDIH-----RIDDMHFMLQREVVNRLLAAPNTKA-YGRLSVMVQYHC-KVIPILEVP
RSMA_BAUCH      NLFRHIH-----MIRDMHFMLQKEVVSRLLAKPNNKN-YGKLSVIAQHYC-QIDLVLDVP
RSMA_BLOFL      HLYKYIN-----IIHDMHFMLQKEVAQRIVAQPNNKA-YGRLSIFAQYYC-KVQALLEVP
RSMA_BLOPB      YLFQYTN-----VIYDMHFMFQKEVATRLYANPNKKE-YGRLSIITQYHC-KVVPLLTIP
RSMA_BUCAI      FLFKQIK-----VIQDMNFMLQKEVAERLISTPGNKS-YGRLSIISQYYC-DIKILLNVS
RSMA_BUCAP      CFFEKNK-----IIQDMNFMLQKEVAERLIAFPGTKS-YGRLSIIAQYYC-NIKIIFNVA
RSMA_BUCBP      YLFKFHN-----NIIDMNFMFQKEVASKLLAIPGTKS-YSRLSIIAQYYC-DIDFLFDVV
RSMA_WIGBR      NFIENYN-----KIIDMHFVIQKEVAQRILARPNNKH-YGYISVIMQYYF-YVEKLIDIS
RSMA_FRATF      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-YGRLSVILQYHF-DCSMILKIP
RSMA_FRATH      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-YGRLSVILQYHF-DCSMILKIP
RSMA_FRATO      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-YGRLSVILQYHF-DCSMILKIP
RSMA_FRATM      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-YGRLSVILQYHF-DCSMILKIP
RSMA_FRATW      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-YGRLSVILQYHF-DCSMILKIP
RSMA_FRATT      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-SGRLSVILQYHF-DCSMILKIP
RSMA_FRAT1      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-SGRLSVILQYHF-DCSMILKIP
RSMA_FRATN      KVIKDSD-----KIVDAHFMLQKEVVERIVSLPNSKS-YGRLSVILQYHF-DCSMILKIP
RSMA_FRAP2      KVIEQSD-----KIIDAHFMLQKEVVERIISQPNSKT-YGRLSVILQYHF-DCSMILNIP
RSMA_BACFR      KMLDNKD-----LIPCCTGMIQKEVAERIAAGPGSKT-YGILSVLIQAWY-RVEYLFTVN
RSMA_BACFN      KMLDNKD-----LIPCCTGMIQKEVAERIAAGPGSKT-YGILSVLIQAWY-RVEYLFTVN
RSMA_BACTN      KMLENKD-----IIPCCTGMIQKEVAERIAAGPGSKT-YGILSVLIQAWY-KVEYLFTVS
RSMA_BACV8      KMLDYKD-----LIPCCTGMIQKEVAERIAAGPGSKT-YGILSILIQAWY-KVEYLFTVH
RSMA_PARD8      KVLDYKD-----QIPCCSGMLQKEVAERLAAGPGSKT-YGILSVLLQAWY-DVEYLFTVS
RSMA_PORGI      RLLDVRE-----QIPCCSGMLQREVAMRLASPPGKKD-YGILSVLLQLWY-NIEYLFTVD
RSMA_PORG3      RLLDVRE-----QIPCCSGMLQREVAMRLASPPGKKD-YGILSVLLQLWY-NIEYLFTVD
RSMA_FLAJ1      RTLEFRD-----QIPEFSGMFQKEVAERICEKKGSKT-YGILSVLAQAFY-DTEYLFTVS
RSMA_FLAPJ      RALEYRN-----QIPEFAGMFQKEVAQRICEKKGTKA-YGILSVLVQAFY-DAEYLFTVD
RSMA_CYTH3      KVLDYRE-----QIPEVVGMFQKEVAERFAAKNGNKT-YGITSVLLQAFY-DIEYLFTVP
RSMA_CHLP8      RLLDNRH-----LIESATLMMQHEVAQRITAVPGTKE-YGILAVQMQAFC-DVKYLFKVG
RSMA_CHLTE      RLLDNRH-----LIASATLMIQHEVAQRIAAVPGTKE-YGILAVQMQAFC-DVKYLFKVG
RSMA_CHLPB      KLLDNRR-----NIFSETLMMQHEVARRLVASPGSKE-YGILAVQLQTFC-DVTYLFKVN
RSMA_PROA2      KLLENRS-----HIISETLMMQHEVALRLAANPGTKE-YGILAVQLQTFC-DVRYLFKVG
RSMA_CHLL2      RLLEYRR-----CFMHATLMMQHEVAMRIVAVPSTKE-YGILAVQLQAFF-DVSYGFRVG
RSMA_CHLPD      KLLENRH-----ILLSATLMMQHEVALRITAKPRTKD-YGILAVQMQAFC-ETKYLFRVG
RSMA_PELLD      KLLENRR-----SITSATLMMQHEVAARLVATPSTKE-YGILAVQLQTFC-DVRYLFKVG
RSMA_CHLCH      HLLEHRR-----AFRSATLMMQHEVALRLAAKPATKE-YGILAVQMQAFC-KVEYLFKVS
RSMA_SALRD      ALLGQRD-----CLAEAVLTMQKEVAERIVAEPSTKA-YGILSVLLQLFA-EPTLCFTVP
RSMA_ANAD2      SILDQVA-----HVSRAVFLLQREVAERLAAPPASRD-WGVLSVLLQREA-DVSVERIVP
RSMA_ANASK      SILDQVA-----HVSRAVFLLQREVAERLAAPPASRD-WGVLSVLLQREA-DVSVERIVP
RSMA_ANADE      SILDQVA-----HVSRAVFLLQREVAERLAAPPASRD-WGLLSVLLQREA-EVSVERIVP
RSMA_MYXXD      RVLEQRA-----HVSRAVFTLQKEVVERLAAEPGNRD-YGLLTVLLGMHY-DAENVLTLE
RSMA_GEOMG      AFLDNRD-----LFSRLVLMLQKEVGDRLAASPGTKD-YGILSVFFQLHF-DVTREMIVR
RSMA_GEOSL      RLLDARD-----LFSRLVLMLQKEVGNRLAAGPGSKE-YGVLSVLFQLHF-DVTREILVR
RSMA_PELCD      KILDHRH-----LFSRLVLMFQQEVGERLCAGPGSKN-YGILSVLCQVWF-DIRRVLRVP
RSMA_MAGMM      HLLDHHA-----AFECMALMFQKEVAQRLAAEPGSKA-YGALTVQCALWA-EIRHGFDVP
RSMA_DESAH      MLVENRH-----LIKRAVLMFQKELTERISASPGGRD-YGRLSVVMQYCS-TVKKIADLP
RSMA_DESOH      DLVEKRE-----AVDRAVLMFQQELARRIAAPPGNRE-YGRISVALRYCA-ELSTVARLK
RSMA_DESPS      KLIEHRD-----IIPTATIMLQEEVADRLLAKPGTKE-YGIPTILLGCCA-SIKKKMVLK
RSMA_SYNAS      HILDHRK-----QISTAVLMMQKEVADRLCAVPGTKA-YGIPTVLFGLYA-RISRELTVA
RSMA_MYCCT      KTLQISD-----LLTKAVFMLQKEVALRICSNKNENN-YNNLSIACQFYS-QRNFEFVVN
RSMA_MYCMS      KTLQISD-----LLTKAVFMLQKEVALRICSNKNENN-YNNLSIACQFYS-QRNFEFVVN
RSMA_MESFL      RTLNVSD-----KLTKAVFMMQKEVAIRVCSYKGENN-YNNLSVACEFYA-DKKYEFTVP
RSMA_FUSNN      KIIENKD-----LIDEAYIMVQKEVGERICAKSGKE--RGILTLAVEYYG-ESEYLFTIP
RSMA_AYWBP      KIIDTPQ-----IND-ATIMIQKEVGMRLLAQPNNKN-YNALSVIIQFLF-SIEKIQEVK
RSMA_ONYPE      KIIDTPQ-----IND-ATIMIQKEVGMRLLAQPNNKN-YNALSVIIQFLF-SIEKIQEVK
RSMA_PHYAS      KIIQTPQ-----IVD-ATLMMQKEVGMRLMAQPNSKN-YNALSVITQYFF-NIEKIQEVK
RSMA_MYCH7      KIFANFE-----KFDKIILMVQNEVADRIVAKPKTPT-YSKLSLASQYIA-DVKKLFVVG
RSMA_MYCHJ      KIFANFE-----KFDKIILMVQNEVADRIVAKPKTPT-YSKLSLASQYIA-HVKKLFVVG
RSMA_MYCH2      KIFANFE-----KFDKIILMVQNEVADRIVAKPKTPT-YSKLSLASQYIA-KVRKLFVVG
RSMA_MYCMO      KIFENHK-----FFTKALIMVQKEIADKLIAKANDSN-YGKLSVSSQFFA-NIKKVINVP
RSMA_MYCS5      KIYRSFW-----NFKGIVLMVQKEVAQRIVAQKNSKN-YSKLSISSQYLA-DVKIEFIVN
RSMA_MYCPU      KIIENHQ-----IFDQATLMVQKEVALRILAKQNDSE-FSKLSLSVQFFF-DVFLICDVS
RSMA_MYCA5      KLIENHS-----ILKKATLMVQDEVANRLVAMPKTKE-YSKLTVSVNFVG-NVKKHFVVK
RSMA_KORVE      RLFEAHA-----LIDFAVIMVQKEVADRIAAKPGTRD-YGLLSATSQLYT-HVEKLFTLP
RSMA_ACIC5      HLIRHEA-----AIERAVVMVQREVADRVAAGPGSRD-YGLLSVTAQLHA-RVEKLLTLP
RSMA_THEMA      KIIEWK-------FKRAIVMIQKEVGERILAKPGKKT-YGYLSVVVQTFY-EVKKLFDVS
RSMA_THESQ      KIIEWK-------FKRAIVMVQKEVGERILAKPGKKT-YGYLSVVVQTFY-EVKKLFDVS
RSMA_THEP1      KIIEWK-------FKRAIVMVQKEVGERILAKPGKKT-YGYLSVVVQTFY-EVKKLFDVS
RSMA_THENN      KIIEWR-------FKKAIVMVQKEVGERILSKPGRKS-YGYLSVVVQTFY-EVRKLFDVS
RSMA_NOSS1      KLLGTISNPNLEPFDSIVLLIQKEVAERLYAKSGSRT-FGALSVRVQYLA-DCEFICDVP
RSMA_TRIV2      KLLGTIANPNPEPFDSIVLLIQKEVAERLYAKAGSRT-FGALSVRVQYLA-DCEFICDVP
RSMA_NOSP7      KLLGTIANPNPEPFDSIVLLVQKEVAERLYAKPGSKT-FGALSVRVQYLA-ECELICTVP
RSMA_CROS5      KLLGRISSPKQPSYDLIVLLIQKEVAQRIIAYPGSKN-YGALSIKMQYLA-DCNYICDVP
RSMA_RIPO1      KLLGSIAHPQHPSYELIVLLMQKEVAQRIVASPQSKA-YGALSVRTQYLA-QCDYICEVP
RSMA_SYNY3      LLLGTIQKPRVPGFETIVLLVQKEIAERLTAQPSTKA-YGALSVRMQYLA-RVDWIVDVP
RSMA_ACAM1      KLLGRIDAPAQPVYETVVLLIQKEVADRLVAEPGSKI-FNGLSVRSQYLA-DCELICPVP
RSMA_SYNE7      SLLGTIAQPRRPAFERLVLLVQQEVADRLCATPGQRA-YGALSVRVQYLA-SCERVCAVP
RSMA_SYNP6      SLLGTIAQPRRPAFERLVLLVQQEVADRLCATPGQRA-YGALSVRVQYLA-SCERVCAVP
RSMA_SYNP2      KLLGTIDRPNSNPFESIVLLIQKEVGDRLVAHPCTKA-FGALTLRVQYLA-DCETVCVVP
RSMA_THEEB      HLLGSIARPRRPAFERLILLVQKEIGDRLMASPGSKA-YGALSVRVQFLA-TCEKVCAVP
RSMA_SYNJB      KVLGSPAQPVRQ-FERIVLLVQKELAERLQAGPGSKA-YGALSLRTQYLA-DCELICRVP
RSMA_SYNJA      KVLGSPAQPVRQ-FERIVLMVQKELAERLQAGPGSKA-YGALSVRVRYLA-ECELICRVP
RSMA_GLOVI      KLTGSLAQPIRR-FRTIVLLVQKELGQRIAAPPGSRT-YGALSVRLQYLA-ECELLFEVP
RSMA_PROMA      RLIGRLGRSSEVKYQRLVLLVQKEVAKRILALPGQSS-FSAMSVRLQLLA-KCQSVCEVH
RSMA_PROM4      RLIGKLGFFPETRYERLVLLLQKEVADRILAMPGQSS-FSAMSVRVQLLC-KSRSVCDVS
RSMA_PROM3      RLLGRLDRPVDHPYQRLVLLLQKEVAQRIRALPGQSC-FSALSVRLQLLA-HCTTVCPVP
RSMA_PROMM      RLLGRLDRPVDHPYQRLVLLLQKEVAQRIRALPGQSC-FSALSVRLQLLA-RCTTVCPVP
RSMA_SYNS3      RLIGRLDRPVDFSYQRLVLLVQHEVAQRIRARPGHSN-FSALSVRMQLLG-RCSHVCPVP
RSMA_SYNPW      RLIGRLDQPVDPPYQRLVLLVQKEVAERIRARPGASS-FSALSVRMQLLA-KCSSVCPVP
RSMA_SYNSC      RLVGRLDRPVDPPYQRLVLLVQKEVAERIRARPGHSS-FSALSVRMQLLA-RCHSVCPVP
RSMA_SYNPX      RLVGRLDRPVEPPYQRLVLLVQKQVAERIRARPGHSS-FSALSVRMQLLA-RCTTVCPVP
RSMA_SYNS9      RLIGRLDRPVEPTYDCLVLLLQKEVAERIRAKPGRSS-FSALSVRMQLLA-DCSLVCPVP
RSMA_SYNR3      RLVGRLDRPVEPPYQRLVLLVQQEVARRISARAGQSS-FSALSVRMQLLA-HCRSVCPVP
RSMA_PROM1      RLIGELRKAPENSFETLVLLMQKEVAQRLLARPGNSN-FSALSVRVQLLA-KCQDVCDVP
RSMA_PROMT      RLIGELRKAPDNCFETLVLLMQKEVAQRLLARPGTSN-FSALSVRIQLLA-KCQDVCDVP
RSMA_PROM0      IFIGRLGIIRKYNYEKIIFLMQKDVVDRILSKEGSPN-AGALSIRMQLLS-KIKRICDVP
RSMA_PROM9      IFIGRLGIIRNYNYEKIIFLMQKDVVDRILSKEGSPN-AGALSIRIQLLS-KIKRICDVP
RSMA_PROMS      IFIGRLGITRNYNYEKIIFLMQKDVVDRILSKEGSPN-AGALSVRMQLLS-KIKKICDVP
RSMA_PROM2      IFIGRLGIIRNCNYEKIIFLMQKDVVDRILSKEGSPN-AGALSIRMQLLS-KIKKICDVP
RSMA_PROM5      IFIGRLGIVSKNNYKKIIFLMQKDVVDRILSKESSKN-AGAMSVRMQLIS-NIKRICDVP
RSMA_PROMP      IFVGRLGIISKNNYNKIIFLMQKDVVDRILAKDGNTN-AGAMSVRMQLIS-NIRRICDVP
RSMA_TREPA      NTIESGYI-----FKRMVVTVQKEIGLRMTALPAQKW-YSYFSVLCQWQY-EVRVIRNVA
RSMA_TREPS      NTIESGYI-----FKRMVVTVQKEIGLRMTALPAQKW-YSYFSVLCQWQY-EVRVIRNVA
RSMA_TREDE      STVEAGVV-----FDTMLFTVQKEAAERITARPGNKN-YTAFSVLCSLFY-ECKIVKTIP
RSMA_BORAP      KLIEENF------LKEMVFTVQKELADRITAKINSKN-YSSFTVLVQSHF-TVIKIIDIG
RSMA_BORBP      KLIEENF------LKEMVLTVQKELADRITAKTNSKN-YSSFTVLVQSHF-TAIKIIDIG
RSMA_BORBU      KLIEENF------LKEMVFTVQKELADRITAKINSKN-YSSFTVLVQSHF-KVIKILDIG
RSMA_BORBZ      KLIEENF------LKEMVFTVQKELADRITAKINSKN-YSSFTVLVQSHF-KVIKILDIG
RSMA_UREPA      KIIQSKL------INDAYIMVQKEMAERIGAKVNTRG-YNAFTVLVQLFC-KTKILFEVN
RSMA_UREP2      KIIQSKL------INDAYIMVQKEMAERIGAKVNTRG-YNAFTVLVQLFC-KTKILFEVN
RSMA_UREU1      KIIQSKL------INDAYIMVQKEMAERIGAKVNTRG-YNAFTVLVQLFC-KTKILFQVN
RSMA_MYCPE      KILKYAN------FSQSVLMVQKEMADRITAKVGTKK-YNNFTVLLRITS-EIKKLFDVS
RSMA_MYCGE      KFLESK-------LRSFVLMTQKEFANRLLAKVNSSD-YSAFGAFCQYYL-TITTVFKID
RSMA_MYCPN      NFLASK-------LQQFVLVCQWEFGQRLVAPVNSPN-YSAFGVFCQYHL-QIKSVFKID
RSMA_MYCGA      KFILST-------YRCAIIMVQKEMGLRLLAKINSKD-YSAFSALCQYSL-SVSKIIEIN
RSMA_ARCB4      RAFEDEL------CEHIIVMVQKEVAEKFTAKTNDKE-YSSLGIITELISINSKILFDVP
RSMA_SULDN      KALADPK------CKNILVMVQLEVAEKFCANDGDKV-FGSLSIITQSVG-EAHIVVNVP
RSMA_HELHP      RLLRDRF------CRAFLVMTQKEVAQKFCATTGQKE-FCALSVLVESFG-KAKMLFEVP
RSMA_CAMC1      NAIDDEK------CLGLIVMIQKEVALKFSAKSKDKE-FSALSILASLQG-RCELLFDVD
RSMA_CAMC5      SAIDDEK------CRGLVVMIQREVALKFSAKSGESE-FSSLAILANLQG-SCELLFDVS
RSMA_CAMHC      KAIDDEL------CDGFVAMVQKEVAEKFCAESGDSE-FGGISVLADIFG-KCEFLFSVP
RSMA_CAMFF      KAIDDKN------CKGLVVMIQREVAIKFSSEAGDKE-FSSLAILTWLKG-KCELLFDVP
RSMA_CAMJE      KALEDKN------CLGLIVMAQREMAEKFCAKEGNSE-FSSLGVLSAMIC-ERKILFDVD
RSMA_CAMJR      KALEDKN------CLGLIVMVQREMAEKFCAKEGNSE-FSSLGVLSAMIC-ERKILFDVD
RSMA_HELPY      NAFKDPK------CRGLLVMTQKEVALKFCAKDSQN----ALSVLAHTIG-NATLLFDVP
RSMA_HELPH      NALKDPK------CRGLLVMTQKEVALKFCAKDSQN----ALSVLAHAIG-NATLLFDVP
RSMA_HELPG      NALKDPK------CRGLLVMTQKEVALKFCTKDSQN----ALSVLVHTIG-NATLLFDVP
RSMA_HELP2      NALKDPK------CRGLLVMTQKEVALKFCTKDSQN----ALSVLVHTIG-NATLLFDVP
RSMA_HELPS      NALKDPK------CRGLLVMAQKEVALKFCAKDSQN----ALSVLTQAIG-NATLLFDVP
RSMA_HELPJ      NALKDPK------CRGLLVMTQKEVALKFCAKDSQN----ALSVLAHTIG-NATLLFDVP
RSMA_HELAH      NAFKDPK------CRGLLVMTQKEVALKFCTKDSQN----ALSVLAHAIG-NVTLLFDVP
RSMA_BDEBA      ERSLENEG-----VAAMVLMFQKEVAQKIRGTVDSDL-YGLLSVYAQAFW-KIETVTDAG
                                     * :   .                                

RSMA_RHIEC      PQAFTPPPKVTSTVVHLLPRENP-----------------------VQCAV-ANLEKVTQ
RSMA_RHIE6      PQAFTPPPKVTSTVVHLTPRKNP-----------------------IPCSV-ANLEKVTQ
RSMA_RHILW      PQAFTPPPKVTSTVVHLTPRENP-----------------------IPCAV-GDLEKVTQ
RSMA_RHIL3      PQAFTPPPKVTSTVVQLTPRENP-----------------------IPCAV-SNLEKVTQ
RSMA_AGRVS      PQAFTPPPKVTSTVVHLTPRPAP-----------------------IPCEI-AKLEKLTQ
RSMA_RHIME      PQAFTPPPKVTSTVVHLEPVEAP-----------------------IPCSP-AVLEKVTQ
RSMA_SINMW      PQAFTPPPKVTSTVVHLEPIEVP-----------------------IPCSP-AVLEKVTQ
RSMA_SINFN      PQAFTPPPKVTSTVVHLEPIDNP-----------------------IPCAV-SALEKVTQ
RSMA_AGRFC      PQAFSPPPKVTSTVVHLLPKDKP-----------------------LPCDV-AKLERVTE
RSMA_CHESB      PQAFTPPPKVISSVVKIVPRADP-----------------------LTVEV-GRLARTTE
RSMA_RHILO      PQAFTPPPKVTSSVVHLEPRATP-----------------------LPADV-KKLGRVTE
RSMA_BARHE      PQAFIPAPKITSSVVHIIPRTQP-----------------------LTCSA-QKLSFVTK
RSMA_BARQU      PQAFIPAPKITSSVVHIIPRIQP-----------------------LTCSA-QKLSFVTK
RSMA_BART1      PQAFIPAPKVTSSVVHIIPRAQP-----------------------LVCSA-QKLSLITK
RSMA_BARBK      PQAFIPAPKVTSSVINIIPRPQP-----------------------LACSV-QKLSLVTK
RSMA_BRUA2      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUA1      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUC2      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUMB      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUO2      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUSU      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUME      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUSI      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_BRUAB      PQAFTPPPKVMSSVVHIVPRETP-----------------------LPCRA-EALGQITQ
RSMA_OCHA4      PQAFTPPPKVMSSVVHIIPRENP-----------------------LPCNA-NALGQITQ
RSMA_AZOC5      PSAFVPPPKVTSSVIHVVPRAEP-----------------------VPCAL-RDLERVTE
RSMA_XANP2      PSAFVPPPKVTSSVVHLVPRSEP-----------------------LPCAL-SALEKVTE
RSMA_METRJ      PSAFVPPPKVTSSVVRLVPRAQP-----------------------LPCRA-GALEAVTR
RSMA_BRASB      PSAFVPPPKVTSSVVRLVPRTAP-----------------------EPCDR-RALEQVAA
RSMA_BRASO      PSAFVPPPKVTSSVVRLVPRPAP-----------------------EPCDR-RALEQVAA
RSMA_BRADU      PSAFVPPPKVTSSVVRLVPRAEP-----------------------LPCDR-KMLEQVAA
RSMA_NITHX      PAAFVPQPKITSSVVRLVPRDKP-----------------------ETCER-RLLEQVAA
RSMA_NITWN      PAAFVPQPQVTSSVVRLIPRYNP-----------------------EPCDR-RSLEQVAA
RSMA_RHOPA      PSAFVPPPKVTSSVVRLVPRAQP-----------------------EPCDR-AALEQVAA
RSMA_RHOPT      PSAFVPPPKVTSSVVRLVPRAQP-----------------------EPCDR-AALEQVAA
RSMA_RHOPS      PSAFVPQPKVTSSVVRLAPRAAP-----------------------EPCNR-AALEQVAA
RSMA_RHOP2      PSAFVPQPKVTSSVVRLVPRSAP-----------------------EPCNR-AALEQVAA
RSMA_RHOP5      PAAFVPPPKVTSSVVRLIPRDEP-----------------------EPCNR-RMLEQVTA
RSMA_RHOPB      PAAFVPQPKVTSSVVRLVPRETP-----------------------EPCDR-RMLEQVAA
RSMA_OLICO      PGAFVPPPKVMSSVVRLAPRAAP-----------------------LACSR-RALEQVTA
RSMA_RUEPO      PEAFTPPPKVSSAVVHLTALPEPR----------------------FPADA-AILSRVVA
RSMA_RUEST      PGAFTPPPKVSSAVVHLTALPEPR----------------------YPADA-AILSRVVA
RSMA_ROSDO      PDAFTPPPKVSSSVVQITALPAPR----------------------YPADP-YVLSKVVA
RSMA_PARDP      PEAFVPAPKVHSAVVHLTALPGPR----------------------YPADP-AVLNRVVA
RSMA_DINSH      PQAFIPAPKVHSAVVHLRARTEPR----------------------YPADA-AVLSRVVA
RSMA_RHOS4      PDAFTPPPSIHSAVVHFTRLEAPR----------------------HPADP-KVLARVTA
RSMA_RHOS1      PDAFTPPPSIHSAVVHFTRLEAPR----------------------HPADP-KVLARVTA
RSMA_RHOSK      PEAFTPPPSIHSAVVHFTRLEAPR----------------------HPADP-KVLARVTA
RSMA_RHOS5      PEAFTPPPAIHSAVVHFTRLAGPR----------------------YPADA-AVLSRVTA
RSMA_JANSC      PEAFTPPPKVHSAVVHFTALPAPR----------------------FPADA-RVLTRVVA
RSMA_ERYLH      RSAFTPPPKVMSAIVHVTPDEMP-----------------------EGVSA-RTLERLTE
RSMA_NOVAD      RSAFTPPPKVMSAIIHVEPAAMP-----------------------EGVSA-RMLERVTE
RSMA_SPHAL      RSAFTPPPKVMSAIVQLTPADQP-----------------------PGVDP-RILSRLTE
RSMA_ZYMMO      RSAFVPPPKVMSAVVHLTPKDQP-----------------------EGLSL-GTLEKITA
RSMA_MAGSA      RRAFTPPPAVTSTVVDLIPRAEPL----------------------APARF-ETLERVTA
RSMA_RHORT      PRAFTPPPKVVSTVVRIDPRPQPL----------------------APARM-ETLERVTA
RSMA_GLUOX      PAAFSPPPKVHSAVAVIIPHAEQP----------------------SPQLF-RAMEQVTA
RSMA_CAUVC      AKAFTPPPKVASAVVRLVPKAEPP----------------------PAEVV-AALERVTA
RSMA_PHEZH      ARAFTPPPKVESAVVRLEPRAARP----------------------SPERL-DALQKVTA
RSMA_MARMM      ARAFTPPPKVESAVVVLDPLPEAQ----------------------QFKDV-VALERITA
RSMA_ANAMF      PGAFSPPPKVCSSVVNITPLGNLR----------------------FPVDY-SYMLKMLK
RSMA_ANAMM      PGAFSPPPKVCSSVVNITPLGNLR----------------------FPVDY-SYMLKMLK
RSMA_ANAPZ      PEIFSPSPKVYSSVIEITPLLSPR----------------------FSVDN-SYFAQVLK
RSMA_EHRCJ      PEIFSPQPKVMSSVINIIVLPKPR----------------------FNVNH-NKLSQVLK
RSMA_EHRCR      PEIFSPQPKVMSSVINIIALPEPR----------------------FHVNY-RKLSQVLK
RSMA_EHRRG      PEIFSPKPKVFSSVINIVVLPQPR----------------------FDVNY-DKLRKIVK
RSMA_EHRRW      PEIFSPKPKVFSSVINIVVLPQPR----------------------FDVNY-DKLRKIVK
RSMA_WOLPM      PKEFFPRPKIHSSVITVNPLPTPK----------------------FVVNL-ETLIKLIR
RSMA_WOLWR      PKEFFPRPKIHSSVITVNPLPIPK----------------------FAVNL-ETLTRLTR
RSMA_WOLTR      PKEFFPRPKVYSSVITVKPLPTQR----------------------FAVNL-EALTKLTR
RSMA_WOLPP      PKEFFPRPKVYSSVITVKPLPTPR----------------------FAVNL-ETLTKLTR
RSMA_NEOSM      PEVFTPPPRVTSTVLKLTPLKN-K----------------------WPRNK-PVLEKILT
RSMA_RICPU      PTAFYPPPKVYSAIVKLIPLENPL----------------------SIALI-NKVEQITK
RSMA_RICRS      PTAFYPPPKVYSAIVKLIPLENPL----------------------SIALI-NKVEQITK
RSMA_RICAE      PTAFYPPPKVYSAIVKLIPLENSP----------------------SIALI-NKVEQITK
RSMA_RICFE      PTAFYPPPKVYSAIVKLIPLENPP----------------------SIALI-NKVEQITK
RSMA_RICAH      PTAFYPPPKVYSAIVKLIPLANPP----------------------SIALI-NRVEKITT
RSMA_RICCK      PTAFYPPPKVYSAIVKLTPLENLP----------------------SIALI-TKVEQITK
RSMA_RICPR      PTAFYPHPKVYSAIVKIIPLENPP----------------------SIALI-NKVEQITK
RSMA_RICTY      PTAFYPHPKVYSAIVKIIPLENPP----------------------SIALI-NKVEQITK
RSMA_RICB8      PTAFYPPPKVYSAIVKLTPLENIP----------------------NSDLI-SKVELITK
RSMA_RICBR      PTAFYPPPKVYSAIVKLTPLENIP----------------------NSDLI-SKVELITK
RSMA_PELUB      PQSFSPRPKIDSSLLLFTPKENFF----------------------KLKDP-KNLEKITR
RSMA_PERMH      ARFFSPPPKVTSAVIRMIPKEKLP----------------------VSLDHMKKYKNFVS
RSMA_SULSY      ARFFNPPPKVTSAVVKLTPKQ--N----------------------IAINNVKKYKNFIS
RSMA_AQUAE      PRFFVPPPKVQSAVIKLVKNE--K----------------------FPVKDLKNYKKFLT
RSMA_HYDS0      GRFFEPVPKVTSCVLVFDKKE--D----------------------TPSFEKQNYMDFLK
RSMA_DESVH      PHVFTPRPKVDSAVLAFTPRTD-R----------------------PDAVQSKRLARVLR
RSMA_DESVV      PHVFTPRPKVDSAVLAFTPRTD-R----------------------PDAVQSKRLAHVLR
RSMA_DESAG      PTVFKPRPKVDSAVLSFAPLPL-S----------------------ARNFSPGALSVLLK
RSMA_DESAD      PTVFKPKPKVDSAVIKFFPLPE-E----------------------EKPSDIEGLAKLVK
RSMA_LAWIP      PHSFYPQPKVDSAIVTLYPKPR-E----------------------EQPKNSKTFAWIIK
RSMA_HALMA      PEAFDPQPRVTSALVRTMPRT----------------------PDYTVP-SDDFFMDFLK
RSMA_NATPD      KEAFSPPPAVESAVVRTTPRE----------------------PPYEVP-DDELFMRLVR
RSMA_HALWD      PTAFAPEPAVDSALIRAEPRD----------------------PDYTVT-DETFFLRFVK
RSMA_HALSA      AAAFDPQPRVESAVVRVTPRD----------------------PDYVVA-DEAFFLSFVK
RSMA_HALS3      AAAFDPQPRVESAVVRVTPRD----------------------PDYVVA-DEAFFLSFVK
RSMA_METHJ      PGAFSPPPAVRSTVMWIEPRE----------------------PLFPIH-DRKIYEDLVR
RSMA_METAC      KGAFQPAPEVDSAVVKLVPRP----------------------SPFEVR-DEAFFLEFVA
RSMA_METMA      KGAFQPAPEVDSAVIKLIPRP----------------------APFEVR-DETFFLQFVA
RSMA_METBF      KSAFQPAPEVDSAVIKLVPRP----------------------VPFEVK-DQAFFMNFVS
RSMA_METBU      PSAFSPPPEVWSAVVKVVPRP----------------------SSFHTE-DPQFFLDLVT
RSMA_ARCFU      PSSFNPPPKVESAIVRIVP-E----------------------PEVFVE-NRELFEKFVT
RSMA_METTH      PGCFFPRPRVESAVVTLKPTG----------------------FR-----APAFLEDVCR
RSMA_METST      PEAFIPKPKIKSAVIELIPKN----------------------NKP----IDKLLDNTIR
RSMA_PYRAB      KGAFYPKPKVDSALVLITPK-----------------------KD-----RIELNESLVK
RSMA_PYRHO      KGAFYPRPKVDSALVLIEPR-----------------------KD-----KIVLNENLVK
RSMA_PYRFU      RGAFYPKPKVDSALVLIVPKP----------------------KDE----RIELNENLVK
RSMA_THEKO      KGAFWPRPKVDSAVVVLEPKP----------------------PEE----RIDLNENLVK
RSMA_THEGJ      RGAFWPRPKVDSAVVVLEPKP----------------------EKE----RIELNENLVK
RSMA_THEON      RGAFYPRPKVDSAVIVLEPKP----------------------KSE----VIELNEDLVR
RSMA_THESM      RGAFYPKPKVDSAVIVMEPKP----------------------KDE----QIELNENLVK
RSMA_METKA      RRAFIPPPRVGSSVVRLTPKS----------------------EEERPDVDPDTLESVCR
RSMA_METM6      PSAFSPKPDVNSAIVKLTKR-----------------------KPKYSVKDEKFFKKVLK
RSMA_METM7      PSAFSPKPDVNSAIVKLTKR-----------------------EPKYHVKDEEFFKKVLK
RSMA_METMP      PSAFSPKPDVNSAIVKLTKR-----------------------EPKYHVKDEEFFKKVLK
RSMA_METM5      PSAFSPKPDVNSAIVKLTKR-----------------------EPKYFVKDEKFFKKVLK
RSMA_METVS      PTAFSPKPDVNSAIVKLTKR-----------------------EPLFHIENEEFFRNVLN
RSMA_META3      PSAFSPKPKVDSAIVKITKKN----------------------EPIHNIDNWEFFDGFNR
RSMA_METJA      PSAFYPKPKVYSAIVKIKPN-----------------------KGKYHIENENFFDDFLR
RSMA_PYRAE      PYVFDPPPKVYSAVVRLMPKA----------------------PCVD---NFDEFEKFSA
RSMA_PYRIL      PHVFSPPPKVYSAVVRLTPRR----------------------PCVE---DFENFQRFTA
RSMA_RUBXD      PRVFDPPPRVRSAVVELERRR----------------------DAP--EDYR-GVKELVA
RSMA_NATTJ      KTVFYPQPRVESQVVKLTKRS----------------------EAKINDDYQEDFIKFVN
RSMA_RHOBA      PTVFWPRPKVDSAIVRLDVDH----------------------ERGNAIPDLKYFHQTVR
RSMA_PAEAT      MNVFWPAPKIHSGLVAFTRH---DPP--------------------ETHATREQVFAVID
RSMA_ARTS2      MNVFWPAPKIHSGLVAFTRR---EPP--------------------VTSATREQVFAVID
RSMA_STRAW      RNVFWPAPNVDSGLVSLVRR---TEPI-------------------KTTASKTEVFAVVD
RSMA_STRCO      RNVFWPAPNVDSGLVSLVRR---SEPL-------------------RTTASKAEVFAVVD
RSMA_STRGG      RNVFWPAPNVDSGLVSLVRR---TEPI-------------------ATTASRAEVFAVVD
RSMA_THEFY      RTVFWPVPNVDSGLVALRRR---PAP--------------------PTKASREDVFAVVD
RSMA_KINRD      PPVFWPVPRVDSGLVSFTRR---PAP--------------------ETTAGREEVFALVD
RSMA_LEIXX      RQIFWPVPNVDSILVGFERH---ATEP-------------------GDDELRKRTFALVD
RSMA_CUTAK      PTVFWPVPNVDSGLVRITRR---RPPHVDGR---------------DPRVTRSQVFRVVD
RSMA_CORGL      KNVFWPAPKIESGLVKIV---REDTAWK------------------QDDETRKKVWPIID
RSMA_CORGB      KNVFWPAPKIESGLVKIV---REDTAWK------------------QDDETRKKVWPIID
RSMA_COREF      KHVFWPAPQIESGLVKII---RTHTPWP------------------QDDATRAKVWPVID
RSMA_CORDI      KNVFWPAPKIESGLVRIDVFDPEHQPWP------------------VTDDMRKAVFPLID
RSMA_CORJK      KNVFWPAPKIDSGLVRIDRYAEGAEPWAGGQSGAEQFDADQGIEQLDAQKLRREVFDLAD
RSMA_MYCA1      PTVFWPIPRVYSGLVRIDRY--PTSPWP------------------TDPAFRRQVFQLVD
RSMA_MYCPA      PTVFWPIPRVYSGLVRIDRY--PTSPWP------------------TDPAFRRQVFELVD
RSMA_MYCLE      PTVFWPIPRVYSGLVRVDRY--ATSPWP------------------TDDAFRRQVFELVD
RSMA_MYCLB      PTVFWPIPRVYSGLVRVDRY--ATSPWP------------------TDDAFRRQVFELVD
RSMA_MYCTU      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDDAFRRRVFELVD
RSMA_MYCTA      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDDAFRRRVFELVD
RSMA_MYCBT      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDDAFRRRVFELVD
RSMA_MYCBO      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDDAFRRRVFELVD
RSMA_MYCBP      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDDAFRRRVFELVD
RSMA_MYCGI      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDTEFQEQVFELID
RSMA_MYCVP      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDPEFRQQVFELID
RSMA_MYCSJ      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDADFRAQVFDLID
RSMA_MYCSS      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDADFRAQVFDLID
RSMA_MYCSK      PTVFWPIPRVYSGLVRIDRY--ETSPWP------------------TDADFRAQVFDLID
RSMA_RHOOB      RAVFWPVPKVESGLVRIDRY--AEPPWP------------------VDDENRRRVFAVID
RSMA_RHOJR      RAVFWPVPKVESGLVRIDRY--AEPPWP------------------VDDAHRRRVFAVID
RSMA_RHOE4      RNVFWPVPKVESGLVRIDRY--AEPPWP------------------MDEKHRKQVFAAID
RSMA_NOCFA      TQVFWPVPRVESGLVRVERY--VEPPWP------------------MDEQHRRRVFEIID
RSMA_BIFLD      RNVFWPAPNVDSALVKFTRYQADDPAAPGTANST------------DDGTQRELVFRLID
RSMA_BIFLS      RNVFWPAPNVDSALVKFTRYQADDPAAPGTANST------------DDGTQRELVFRLID
RSMA_BIFLO      RNVFWPAPNVDSALVRFTRYQADDPAAPGASNSTA-----------DGGTQRELVFRLID
RSMA_BIFAA      RNVFWPAPNVDSALVLFKRYPGGHTPAADNADGS--------------VVDRETVFRLID
RSMA_ACIC1      ADVFWPRPQVESAVVRIDRQ---PPPVP--------------------GVDRAAVFAVID
RSMA_OPITP      ASCFFPRPDVDSYLLHLVRR-------------------------AEPFVFTPEVKALIR
RSMA_DEIGD      KGAFLPAPDVTSSVVRLDFD-------------------------RARPAPEPAFLKFVE
RSMA_DEIRA      KGAFFPAPDVTSSVVRLDFD-------------------------RTRPQPDPAFVSFVD
RSMA_THET2      PGAFFPPPKVWSSLVRLTPT-------------------------GAPD--DPGLFRLVE
RSMA_THET8      PGAFFPPPKVWSSLVRLTPT-------------------------GALD--DPGLFRLVE
RSMA_CHLTR      PNCFYPKPSVHSAVVHMRVHEQFA----------------------LADSEIEEFFTLTR
RSMA_CHLTA      PNCFYPKPSVHSAVVHMRVHEQFA----------------------LADSEIEEFFTLTR
RSMA_CHLT2      PNCFYPKPSVHSAVVHMRVHEQFA----------------------LADSEIEEFFTLTR
RSMA_CHLTB      PNCFYPKPSVHSAVVHMRVHEQFA----------------------LADSEIEEFFTLTR
RSMA_CHLMU      PNCFYPKPSVSSAVVHMRVHEDFP----------------------LSGSEIDEFFALTR
RSMA_CHLCV      PGCFFPKPQVSSAVVHMTVKETFP----------------------LETSLHQKFFSLTR
RSMA_CHLFF      SGCFFPKPQVSSAVVHMTVKDTFP----------------------LEESLHKKFFSLTR
RSMA_CHLAB      PGCFLPKPQVASAVVHMTVKENFP----------------------LEEPLRTKFFSLTR
RSMA_CHLPN      ASCFYPKPQVQSAVIHMKVKETLP----------------------LSDEEIPVFFTLTR
RSMA_PARUW      RNCFYPAPKVDSAIVVLELKEPPP----------------------NIDA--QVFFKITR
RSMA_ALKMQ      PSVFIPQPKVESIVIKLQVYP----------------------EPKVKVERDDLMFALVK
RSMA_ALKOO      PSVFIPQPKVESTVIRLDILD----------------------TPKVSVEREDLFFSLVK
RSMA_CLOD6      RHMFIPQPNVDSTVIGLHVRD----------------------KRKYDVHNEDIFFKTVK
RSMA_LACP7      PNCFMPRPNVGSAVIRLTLHQ----------------------DAPVKVKNENLLFKLIR
RSMA_CLOPE      PSCFIPRPKVDSIVIRLERLE----------------------EPSVKVKNEKLFFEIVR
RSMA_CLOP1      PSCFIPRPKVDSIVIRLERLE----------------------EPSVKVKNEKLFFEIVR
RSMA_CLOPS      PSCFIPRPKVDSIVIRLERLE----------------------EPSVKVKNEKLFFEIVR
RSMA_CLOAB      PSCFIPQPKVDSLVIRLDKLE----------------------KPRVQVKDEKLFFNVIR
RSMA_CLOB6      PNCFIPRPKVDSIVIKLDRLS----------------------EPRVRVKSEKLFFNVVR
RSMA_CLOBJ      PNSFIPRPKVDSIVIKLDRLS----------------------EPRVRVKSQKLFFNVVR
RSMA_CLOB1      PNSFIPRPKVDSIVIKLDRLS----------------------EPRVRVKSQKLFFNVVR
RSMA_CLOBL      PNSFIPRPKVDSIVIKLDRLS----------------------EPRVRVKSQKLFFNVVR
RSMA_CLOBK      PNSFIPKPKVDSIVIKLDRLS----------------------EPRVRVKSQKLFFNVVR
RSMA_CLOBM      PNCFIPRPKVDSIVIKLDRLS----------------------EPRVRVKSEKLFFNVVR
RSMA_HALOH      PTVFIPRPRVYSSIIKIKPHS----------------------EPVYRVKNEGFFFKMVR
RSMA_MOOTA      RTVFYPRPEVDSLVLKLTCRT----------------------RPVVQVEDEDFFFRVVR
RSMA_PELTS      RTVFYPPPGVDSAVVRLALRP----------------------APAVTVRNEDVFFQVVR
RSMA_SYMTH      RASFMPQPEVDSAVVSLRYRE----------------------RPPVDAPPE-AFFRVVR
RSMA_CALS4      PKVFVPPPKVESSLLKLKVYD----------------------KPLVEVKDEKLFSEVVR
RSMA_DEHMB      GGAFYPPPEVDSAIVKIVIPQ----------------------TTIMEGVSEVDFFKLAR
RSMA_DEHMC      GGAFYPPPEVDSAIVKIVIPQ----------------------TTIMEGVSEVDFFKLAR
RSMA_DEHM1      GGAFYPPPEVDSAIVKVAIPQ----------------------AAIMQGVSEADFFKLAR
RSMA_DESHD      PQAFWPAPKVTSAVVRFELRS----------------------YPGFR-VKEKDFFRVVK
RSMA_DESHY      PQAFWPAPKVTSAVVRFELRS----------------------YPGFR-VKEKDFFRVVK
RSMA_GEOKA      RTVFMPQPNVDSAVIRLVKRQ----------------------HPPVVVDDEGVFFQVVR
RSMA_GEOTN      RTVFMPQPNVDSAVIRLTKRS----------------------HPPVAVEDEEVFFQVVR
RSMA_GEOSW      RTVFIPQPNVDSAVIRLIKRK----------------------QPPVKVEDEAFFFQVVR
RSMA_ANOFW      RTVFVPKPNVDSAVIRLLKRE----------------------QPAVSVSNEDFFFAVVR
RSMA_BACLD      KTVFVPQPNVDSAVIRLTLRK----------------------EPAVAVQDAAFFFQVVK
RSMA_BACSU      KTVFVPQPNVDSAVIRLILRD----------------------GPAVDVENESFFFQLIK
RSMA_BACP2      KTVFVPQPNVDSAVIKLTVRE----------------------TPAVSVENDEFFFQLIR
RSMA_BACAN      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACAA      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACHK      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACCZ      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACAC      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACC7      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACC0      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACC1      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACCQ      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACCR      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACC4      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACC2      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACC3      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDEIFFFEVVR
RSMA_BACAH      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDEIFFFEVVR
RSMA_BACMK      RTVFVPQPNVDSAIIRLLKRP----------------------KPVVEVTDETFFFEVVR
RSMA_BACCN      RTVFVPQPNVDSSVIRLLKRP----------------------KPIVEVIDEKFFFEVVR
RSMA_BACHD      KTVFVPQPNVDSAVLRLTIRE----------------------KPPVTVADEEWLFAIVR
RSMA_LYSSC      KTVFMPQPNVDSAVIRLIKHD----------------------EPPVKVINEDFLFVVTR
RSMA_BACSK      ASVFVPQPRVDSSVLKLTIRE----------------------KPLVEVIDERWFFNVFH
RSMA_OCEIH      KQVFMPQPNVDSSILQLTMRK----------------------QPPVEVTDEDFFFEIIQ
RSMA_LISMC      KTVFMPQPNVDSAVIHLKRRK----------------------EPLAEVNDEEFFFEVTR
RSMA_LISMF      KTVFMPQPNVDSAVIHLKRRK----------------------EPLAEVNDEEFFFEVTR
RSMA_LISMO      KTVFMPQPNVDSAVIHLKRRK----------------------EPLAEVNDEEFFFEVTR
RSMA_LISMH      KTVFMPQPNVDSAVIHLKRRK----------------------EPLAEVNDEEFFFEVTR
RSMA_LISIN      KTVFMPQPNVDSAVIHLKRRK----------------------EPLAKVNDEEFFFEVTR
RSMA_LISW6      KTVFMPQPNVDSAVIHLKRRK----------------------EPLAKVNDEEFFFEVTR
RSMA_STAAT      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAA3      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAC      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAA2      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAA9      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAS      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAA1      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAM      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAW      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAN      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAA8      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAB      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAE      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAAR      KSVFMPPPNVDSIVVKLMQRT----------------------EPLVTVDNEEAFFKLAK
RSMA_STAES      KTVFMPPPNVDSIVVKLMQRQ----------------------EPLVQVDDEEGFFKLAK
RSMA_STAEQ      KTVFMPPPNVDSIVVKLMQRQ----------------------EPLVQVDDEEGFFKLAK
RSMA_STAHJ      KSVFMPPPNVDSIVVKLMQRE----------------------TPLVSVDDEETFFKLAK
RSMA_STACT      KTVFMPPPNVDSIVVKLMKRQ----------------------APIVAVDDEDQFFKMTK
RSMA_STAS1      KSVFLPPPNVDSIVVKLMKRP----------------------TPIVDIDDENKFFKMTK
RSMA_MACCJ      KGVFMPPPNVDSLVVKLTTLE----------------------RPRVDVEDENLFFKLTR
RSMA_STRA1      RTVFVPAPNVDSVILKMVRRD----------------------QPVVSVQDEDFFFRVSK
RSMA_STRA5      RTVFVPAPNVDSAILKMVRRD----------------------QPVVSVQDEDFFFRVSK
RSMA_STRA3      RTVFVPAPNVDSAILKMVRRD----------------------QPVVSVQDEDFFFRVSK
RSMA_STRMU      RTVFVPAPNVDSAILKMTRRE----------------------QPLVQVQDEDFFFCVGK
RSMA_STRS7      RTVFVPAPNVDSAILKMTRRD----------------------QPLIEVQDEDFFFRVSR
RSMA_STREM      RTVFVPAPNVDSAILKMTRRD----------------------QPLIEVQDEDFFFRVSR
RSMA_STRE4      RTVFVPAPNVDSAILKMTRRD----------------------QPLIEVQDEDFFFRVSR
RSMA_STRPB      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEVKDEDFFFRVSR
RSMA_STRPC      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEVKDEDFFFRVSR
RSMA_STRP1      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEVKDEDFFFRVSR
RSMA_STRPF      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEVEDEDFFFRVSR
RSMA_STRPD      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEVKDEDFFFRVSR
RSMA_STRPM      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEVKDEDFFFRVSR
RSMA_STRP8      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEVKDEDFFFRVSR
RSMA_STRPG      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEIKDEDFFFRVSR
RSMA_STRP6      RTVFVPAPNVDSAILKMVRRD----------------------QPLIEIKDEDFFFRVSR
RSMA_STRP3      RTVFVPAPNVDSAILKMMRRD----------------------QPLIEVKDEDFFFRVSR
RSMA_STRU0      KTVFVPAPNVDSAILKMVRRP----------------------EPLIEVTDEDFFFRVAK
RSMA_STRT2      RTVFVPAPNVDSAILKMTRRK----------------------QPLVEVKDEDFFFRVSK
RSMA_STRTD      RTVFVPAPNVDSAILKMTRRK----------------------QPLVEVKDEDFFFRVSK
RSMA_STRT1      RTVFVPAPNVDSAILKMTRRK----------------------QPLVEVKDEDFFFRVSK
RSMA_STRGC      RTVFVPAPNVDSAILKMVRRE----------------------QPAVEVQDEKFFFKVTK
RSMA_STRSV      RKVFVPAPNVDSAILKMVRRE----------------------RPAVEVQDEKFFFKVSK
RSMA_STRPN      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRZT      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRPJ      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRP7      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRZJ      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRPI      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRP4      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRR6      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRP2      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRPS      RTVFVPAPNVDSAILKMVRRP----------------------EPAVAVEDENFFFKVSK
RSMA_STRZP      RTVFVPAPNVDSAILKMVRRP----------------------VPAVAVEDENFFFKVSK
RSMA_LACLA      RTVFIPAPNVDSAILKMVRRE----------------------APLVEVEDEEWFFKTMH
RSMA_ENTFA      KTVFVPQPNVDSAIIKLTRRA----------------------TPAVTVTNEKEFFKLTK
RSMA_LACSS      KTAFVPQPNVDSAIVEFVGRQ----------------------EPLVTVQNQQLFDQLVR
RSMA_LACPL      RTVFVPSPNVDSAIVKLTALP----------------------LRTHVPFDEAAFFKVVK
RSMA_LACS1      KTVFVPQPNVDSAIIVLNKKK----------------------VKPKEPQDEKHFKKLVK
RSMA_LACBA      RTAFIPQPNVDSAIIRLTPRE----------------------ALPVNPYEDKALFSFVK
RSMA_PEDPA      SKVFVPRPKVDSAIVSLTPRA----------------------GWEVMPEDDKDFFKTVH
RSMA_LACRD      RKVFVPAPNVDSAIVVLTPRTN---------------------PLPVQPFDKQKLFGFIR
RSMA_LACRJ      RKVFVPAPNVDSAIVVLTPRTN---------------------PLPVQPFDKQKLFGFIR
RSMA_LEUCK      ASAFNPSPNVDSAVVMLTPIVP---------------------ETVVDNPDK--LFSVVK
RSMA_LEUMM      ASSFNPSPNVDSAVVKLTPLKP---------------------TTVVENVGK--LFGVIK
RSMA_OENOB      RKSFMPSPNVDSAIVQLTPKE-----------------------NFQSFPHEEALFKIIK
RSMA_LACAC      STSFMPRPKVDSSVVVLTPLQ-----------------------ERPKIENRKHFIWVVK
RSMA_LACH4      HNSFMPRPKVDSSVVVLTPLK-----------------------NKPEIENRKHFVWVVK
RSMA_LACJO      STSFMPRPKVDSAVVVLTPLL-----------------------EKPDINDYAFFDHVVK
RSMA_LACDA      HASFMPQPKVDSAVVVLTPLE-----------------------KPADVGDRKQFNRVVK
RSMA_LACDB      HASFMPQPKVDSAVVVLTPLE-----------------------KPADVGDRKQFNRVVK
RSMA_CARHZ      RTVFFPPPEVESAVVRFTLKE-----------------------NSLTSEERLKFFQIVR
RSMA_ACIF2      PGNFFPVPKVDSAFMRLIPHRPG----------------------LLPPHLQAPFARIVA
RSMA_ACIF5      PGNFFPVPKVDSAFMRLIPHRPG----------------------LLPPHLQAPFARIVA
RSMA_HALHL      AGAFFPAPKVMSSFVRLVPHRPL----------------------PARAQDEAWLQEVVT
RSMA_ACISJ      PESFDPPPRVDSAVVRMVPHEAP------------------------EALSMPVLEELVQ
RSMA_ACIET      PESFDPPPRVDSAVVRMVPHEAP------------------------EALSMPVLEELVQ
RSMA_ACIAC      PESFDPPPRVDSAVVRMVPHAAP------------------------APVAPRLLEELVQ
RSMA_POLSJ      PQSFDPPPRVDSAVVRMVPHAHP------------------------AALDVKLLSQLVQ
RSMA_POLNA      PQSFDPPPRVDSAIVRMVPHAEP------------------------ARLDVKLLSELVR
RSMA_RHOFT      PESFEPPPRVNSAVVRMVPHVNP------------------------AAVDGHLLSELVQ
RSMA_VARPS      PESFDPPPRVDSAVVRMVPLAEP------------------------PAVDAARLGEIVQ
RSMA_VEREI      PASFAPPPRVDSAVVRMLPHAQP------------------------AAVSRPMLEELVQ
RSMA_LEPCP      PESFDPPPRVDSAIVRMLPLAQP------------------------PAVDPKLLGELVT
RSMA_METPP      PEAFEPPPRVNSAVVRMLPFPAP------------------------PAVDAALLGELVA
RSMA_BURCM      PESFQPPPKVDSAIVRMIPYEPH----------------------ELPDVDPVLLGELVT
RSMA_BURA4      PESFQPPPKVDSAIVRMIPYEPH----------------------ELPDVDPVLLGEVVT
RSMA_BURCA      PESFQPPPKVDSAIVRMIPYEPH----------------------ELPDVDPVLLGEIVT
RSMA_BURCH      PESFQPPPKVDSAIVRMIPYEPH----------------------ELPDVDPVLLGEIVT
RSMA_BURCC      PESFQPPPKVDSAIVRMIPYEPH----------------------ELPDVDPVLLGEIVT
RSMA_BURCJ      PESFQPPPKVDSAIVRMIPYEPH----------------------ELPDVDPVLLGEIVS
RSMA_BURL3      PESFQPPPKVDSAIVRMIPYEPH----------------------ELPDVDPVLLGEVVT
RSMA_BURM1      PESFQPPPKVDSAIVRMIPYAPH----------------------ELPDVDPVLLGEIVT
RSMA_BURVG      PESFQPPPKVDSAIVRMIPYAPH----------------------ELPDVDPVLLGELVT
RSMA_BURMA      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURPS      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURM9      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURM7      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURMS      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURP1      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURP0      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURP6      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_BURTA      PESFQPPPKVDSAIVRMIPHAPH----------------------ELPAVDPAVLGEVVT
RSMA_PARPJ      PEAFNPPPKVDSAIVRMIPYELH----------------------ELAPVDERVLGEVVT
RSMA_PARXL      PEAFNPPPKVDSAIVRMIPYELH----------------------ELPPVDERVLGELVT
RSMA_PARP8      PESFQPPPKVDSAIVRMIPYAPH----------------------ELPAVDEIKLGEVVT
RSMA_CUPTR      PGAFNPPPKVDSAVVRMIPWPRHGDGRL---------------RSPHADCDITVLGDVVT
RSMA_CUPNH      PGAFNPPPKVDSAVVRMIPWPRHSDGRL---------------RSPHADCDITVLGDVVT
RSMA_CUPPJ      PGSFNPPPKVDSAVVRMIPWPRTESGRL---------------RSPHADCDITVLGDLVT
RSMA_CUPMC      PASFNPPPKVDSAVVRMIPWPRAEDGTL---------------RSPYAACDAGVLGDVVT
RSMA_RALSO      PGSFNPPPKVDSAVVRMIPWPAD--------------------KSPYAPVDMRALGTVVT
RSMA_BURSP      PCAFAPPPAVHSAVLRMAPHASR----------------------ALPQLDWARFAALVR
RSMA_BORBR      PEAFDPPPRVVSAVVRMAPLPAD----------------------RLRPASDAAFETVVA
RSMA_BORPE      PEAFDPPPRVVSAVVRMAPLPAD----------------------RLRPASDAAFETVVA
RSMA_BORPA      PEAFDPPPRVVSAVVRMAPLPAD----------------------RLRPASDAAFETVVA
RSMA_BORA1      PEAFDPPPRVVSAVVRMVPLGPD----------------------RPQPASEAAFEAVVA
RSMA_BORPD      PEAFDPPPRVVSAVVRMVPLPAD----------------------RLRPASEAALQAVVA
RSMA_HERAR      PTAFDPPPRVESAIVRMIPIEKP------------------------LPCDQTKLEQVVL
RSMA_JANMA      PTAFDPPPRVESAIVRMIPLAQP------------------------LPCDQAKLEQVVL
RSMA_AROAE      PGAFRPAPKVTSSIVRMVPLPAE----------------------QRTAKDEALLERVVA
RSMA_THIDA      PTAFDPPPKVESAVVRLIPKSTA----------------------EVPSVDEALFARVVA
RSMA_METFK      PEAFDPAPKVESAFVRAVPYTVL----------------------PHPAKDEALLGRIVT
RSMA_CHRVO      PEAFWPPPKVDSAVVRMIPAPGR----------------------CGTARDEALLEKLVS
RSMA_LARHH      PESFDPPPKVDSAVVRMIPHAEL----------------------PWPADDEENLSALVA
RSMA_NEIG1      PESFDPAPKIDSAVVRMIPVKHR----------------------IGKADDFDHFAKLVK
RSMA_NEIG2      PESFDPAPKIDSAVVRMIPVKHR----------------------IGKADDFEHFAKLVK
RSMA_NEIMA      PESFDPAPKVDSAVVRMIPVKHR----------------------IGKADDFEHFAKLVK
RSMA_NEIM0      PESFDPAPKVDSAVVRMIPVKHR----------------------IGKADDFEHFAKLVK
RSMA_NEIMB      PESFDPAPKVDSAVVRMIPVKHR----------------------IGKADDFEHFAKLVK
RSMA_NEIMF      PESFDPAPKVDSAVVRMIPVKHR----------------------IGKADDFEHFAKLVK
RSMA_DECAR      PESFDPPPKVQSAVVRLIPKPVS----------------------ELNAKSQEKLSQVAL
RSMA_NITEU      AESFDPPPRVQSAIVCMRPKAEP----------------------TIPLKHERLFAELVS
RSMA_NITEC      AEAFNPPPRVQSAIVCMRPRVVP----------------------VIPFGLEKLFGEMVL
RSMA_NITMU      PECFHPPPKVQSAVVRMIPLKKP----------------------LIEASQEKLFAEIVS
RSMA_PSYA2      RGAFNPPPKVTSAVFRLTPHIIK----------------------PVVAEDEEYFALVVR
RSMA_PSYCK      RGAFNPPPKVTSAVFRLTPHIIK----------------------PVVAEDEEYFALVVR
RSMA_ACIAD      AGAFNPPPKVTSAVFRLVPYKEK----------------------PIVAKDEKALSRLVG
RSMA_COXBU      PQAFTPPPRVESAIIRLIPRHNF----------------------TPVAKNLDQLSHVVK
RSMA_COXB2      PQAFTPPPRVESAIIRLIPRHNF----------------------TPVAKNLDQLSHVVK
RSMA_COXBR      PQAFTPPPRVESAIIRLIPRHNF----------------------TPVAKNLDQLSHVVK
RSMA_COXBN      PQAFTPPPRVESAIIRLIPRHNF----------------------TPVAKNLDQLSHVVK
RSMA_COXB1      PQAFTPPPRVESAIIRLIPRHNF----------------------TPVAKNLDQLSHVVK
RSMA_ALCBS      PEAFSPPPRVDSAVVRLIPHDSP----------------------PHPADDEDHLRKLVA
RSMA_HAHCH      PGAFQPAPKVWSAIVRLTPYTEP----------------------PLACKDVATLTTVVR
RSMA_MARHV      PGAFRPAPKVDSAIVRLVPHKEL----------------------PYPAKDLKTLQAVVR
RSMA_MARMS      PESFDPAPKVDSAIVRMTPHKIL----------------------PHPVNNIKMLEDMVR
RSMA_PSEF5      PGAFNPPPKVDSAIVRLVPHAVL----------------------PHPAKDHRLLERIVR
RSMA_PSEPF      PGAFNPPPKVDSAIVRLVPHAVL----------------------PHPAKDHRLLERVVR
RSMA_PSE14      PGAFNPPPKVDSAIVRLVPYETL----------------------PHPAKDHRVLERVVR
RSMA_PSESM      PGAFNPPPKVDSAIVRLVPYETL----------------------PHPAKDHRVLERVVR
RSMA_PSEU2      PGAFNPPPKVDSAIVRLVPYETL----------------------PHPAKDHRVLERIVR
RSMA_PSEPK      PGAFNPPPKVDSAIVRLVPHEVL----------------------PFPAKDHLLLERVVR
RSMA_PSEAE      PGAFNPPPKVDSAIVRLTPFAEP----------------------PHPARDPKLLERVVR
RSMA_CHRSD      AEAFTPRPKVESAIVRLIPHDEP----------------------PHVAHDEALFGDIVR
RSMA_SACD2      PECFNPRPKVDSAIVRLTPYRTQ----------------------PFVAAHPDKLAKLVK
RSMA_METCA      PECFHPQPKVVSAVVRLVPHAVP----------------------PDAGM-VKQVSAVVV
RSMA_LEGPC      PEAFEPKPKVDSAIVRLTPYRVS----------------------PFESVNTEKLENIVA
RSMA_LEGPA      PEAFEPKPKVDSAIVRLTPYRVS----------------------PFESVNTEKLENIVA
RSMA_LEGPL      PEAFEPRPKVDSAIVRLTPHRVS----------------------PFESVNTEKLENIVA
RSMA_LEGPH      PEAFEPRPKVDSAIVRLTPYRVS----------------------PFESVNTEKLENIVA
RSMA_NITOC      SGAFVPPPKVDSMVVRLIPHRPS----------------------LAPNISHGALNRVVS
RSMA_HYDCU      PENFTPPPKVDSAIVRLRPFEKR----------------------PFQAIDDKDFAKLVK
RSMA_XANAC      PGAFRPPPKVDSAVVRLVPRDPA----------------------TVLINDRRRFADVVR
RSMA_XANC5      PGAFRPPPKVDSAVVRLVPRDPA----------------------TVQINDRRRFADVVR
RSMA_XANOR      PGAFRPPPKVDSAVVRLVPRDPA----------------------TVHINDRRRFADVVR
RSMA_XANOM      PGAFRPPPKVDSAVVRLVPRDPA----------------------TVHINDRRRFADVVR
RSMA_XANOP      PGAFRPPPKVDSAVVRLVPRDPA----------------------TVHINDRRRFADVVR
RSMA_XANCP      PGAFRPPPKVDSAVVRLVPRDAA----------------------SVLIKDRKRFADVVR
RSMA_XANC8      PGAFRPPPKVDSAVVRLVPRDAA----------------------SVLIKDRKRFADVVR
RSMA_XANCB      PGAFRPPPKVDSAVVRLVPRDAA----------------------SVLIKDRKRFADVVR
RSMA_XYLFA      PDAFQPPPKVNSAITRLVPRDPT----------------------TIRIADTKRFSDIVR
RSMA_XYLFT      PDAFQPPPKVNSAITRLVPRDPT----------------------TIRIADTKRFSDIVR
RSMA_DICNV      PEAFAPPPKVNSAVVRLIPQTQL----------------------TWNIESIAHFECVVR
RSMA_ACTP2      PTAFKPAPKVDSAVVRLMPHKVL----------------------PHPVKDVYWLNRVTT
RSMA_ACTP7      PTAFKPAPKVDSAVVRLMPHKVL----------------------PHPVKDVYWLNRVTT
RSMA_ACTPJ      PTAFKPAPKVDSAVVRLMPHKVL----------------------PHPVKDVYWLNRVTT
RSMA_HAEDU      PTAFKPAPKVDSAVVRLMPYKTL----------------------PYPVKDVYWLNRVTT
RSMA_HAEIE      PSAFKPAPKVDSAVVRLIPHKEL----------------------PHPVKDLYWLNRVCS
RSMA_HAEIG      PSAFKPAPKVDSAVVRLIPHKEL----------------------PHPVKDLYWLNRVCS
RSMA_HAEIN      PSAFKPAPKVDSAVVRLIPHKEL----------------------PHPVKDLYWLNRVCS
RSMA_HAEI8      PSAFKPAPKVDSAVVRLIPHKEL----------------------PHPVKDLYWLNRVCS
RSMA_PASMU      PTAFKPAPKVDSAVVRLVPHKVL----------------------PHPVKDLYWLNRVCS
RSMA_MANSM      PTAFKPAPKVDSAVVRLIPHKEL----------------------PHPVKDLYWLNRVTS
RSMA_HAES1      PTAFKPAPKVESAVVRLIPHKEL----------------------PYPVKDLYWLNRVTT
RSMA_HISS2      PTAFKPAPKVESAVVRLIPHKEL----------------------PYPVKDLYWLNRVTT
RSMA_PSYIN      PTAFKPAPKVDSAVVRLEPYDTP----------------------PFIAKSLKCLTQVCS
RSMA_AERHH      PGAFKPAPKVDSAVVRLIPHKNP----------------------TIVAKDIRCLNRVCT
RSMA_TOLAT      PHAFKPAPKVNSAVVRLAPWKKR----------------------PYEALNIADLQRVCQ
RSMA_ALIF1      PTAFVPPPKVDSAVVRLVPYETL----------------------PYPATNLKWLDRVCR
RSMA_ALIFM      PTAFVPPPKVDSAVVRLVPYETL----------------------PYPATNLKWLDRVCR
RSMA_ALISL      PTAFVPPPKVDSAVVRLVPYEVL----------------------PFPAKNLKWLDRVCR
RSMA_VIBA3      PTAFVPPPKVDSAVVRLQPYEVL----------------------PYPAKDLKWLDRVCR
RSMA_VIBCH      PSAFVPPPKVDSAVVRLVPYEDL----------------------PHPATSLEWLDRVVR
RSMA_VIBC3      PSAFVPPPKVDSAVVRLVPYEDL----------------------PHPATSLEWLDRVVR
RSMA_VIBCB      PTAFVPPPKVDSAVVRLVPYEEL----------------------PHPAKDLRLLERVCR
RSMA_VIBPA      PTAFVPPPKVDSAVVRLVPYEEL----------------------PCPAKDLRLLDRVCR
RSMA_VIBVU      PTAFVPPPKVDSAVVRLVPYETL----------------------PHPANNLQWLERVCR
RSMA_VIBVY      PTAFVPPPKVDSAVVRLVPYETL----------------------PHPANNLQWLERVCR
RSMA_PHOPR      PESFTPAPKVDSAVVRLTPYEVL----------------------PHPCTNLKWLDRVCR
RSMA_SHEB5      PHSFTPAPKVDSAVVRLLPYAVK----------------------PFPCKDVTVLRHLCT
RSMA_SHEB2      PHSFTPAPKVDSAVVRLLPYAVK----------------------PFPCKDVTVLRHLCT
RSMA_SHEB8      PHSFTPAPKVDSAVVRLLPYAVK----------------------PFPCKDVTVLRHLCT
RSMA_SHEB9      PHSFTPAPKVDSAVVRLLPYAVK----------------------PFPCKDVTVLRHLCT
RSMA_SHEPC      PHSFTPAPKVDSAVVRLLPYAEK----------------------PFPCKDVNVLRQLCT
RSMA_SHESW      PHSFTPAPKVDSAVVRLLPYAEK----------------------PFPCKDVNVLRQLCT
RSMA_SHESM      PHSFAPPPKVDSAVVRLLPYAEK----------------------PFPCKDVNVLRQLCT
RSMA_SHESR      PHSFAPPPKVDSAVVRLLPYAEK----------------------PFPCKDVNVLRQLCT
RSMA_SHESA      PHSFAPPPKVDSAVVRLLPYAEK----------------------PFPCKDVNVLRQLCT
RSMA_SHEON      PHSFAPPPKVDSAVVRLLPYAEK----------------------PFPCKDVNVLRQLCT
RSMA_SHEDO      PHSFTPAPKVDSAVVRLLPYANK----------------------PWPCKDVTVLRHLCT
RSMA_SHEFN      PTSFTPAPKVDSAVIRLLPFEVK----------------------PWPCKNVDVLRHLVT
RSMA_SHEHH      PGCFTPPPKVDSAVVRLVPYKNK----------------------PWPCKDVDLLRNLTT
RSMA_SHEPA      PGCFTPPPKVDSAVVRLVPYKVK----------------------PWPCKDVDLLRNLTT
RSMA_SHEPW      PGCFTPPPKVDSAVVRLVPYKTK----------------------PFPCKDVEVLRHLTT
RSMA_SHESH      PHSFTPAPKVDSAVVRLVPYKTK----------------------PWPCKDVDQLRHLTT
RSMA_SHEWM      PGSFTPPPKVDSAVVRLVPYKVK----------------------PWPCKDVDQLRHLTT
RSMA_SHELP      PGCFTPPPKVDSAVVRLVPYKEK----------------------PYPCKDVDLLRHLCT
RSMA_SHEAM      PGCFTPPPKVDSAVVRLVPYAEK----------------------PWPCHDVEMLRKVCN
RSMA_PSET1      PECFKPAPKVDSAVIRLIPKKPE----------------------QRTAKSVKILNNVCL
RSMA_COLP3      PEAFKPAPKVDSAIVRLIPHAHI----------------------ENPVKDINALNTVCL
RSMA_IDILO      PSAFTPPPKVESSVVRLEPYAES----------------------PHPVKDKAQLHSLCL
RSMA_SALA4      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALDC      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALEP      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALG2      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALHS      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALPA      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALPK      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALPB      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALPC      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALTI      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALTY      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALAR      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALNS      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALCH      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_SALSV      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDIRVLSRITT
RSMA_CITK8      PSAFTPPPKVDSAVVRLVPHTTM----------------------PYPVKDIRVLSRITT
RSMA_KLEP3      PSAFTPPPKVDSAVVRLVPHRTM----------------------PYPVKEVRVLSRITT
RSMA_KLEP7      PSAFTPPPKVDSAVVRLVPHSTM----------------------PYPVKEIRVLSRITT
RSMA_ECOUT      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO27      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOK1      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO45      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOL6      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOL5      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO81      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO55      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOLC      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOHS      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_SHIBS      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOBW      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECODH      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOLI      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOSM      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO7I      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO8A      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_SHIF8      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_SHISS      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_SHIB3      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOSE      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO57      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO5E      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_SHIFL      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDIRVLSRITT
RSMA_ESCF3      PSAFTPPPKVDSAVVRLVPHATM----------------------PYPVKDVRVLSRITT
RSMA_SHIDS      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECO24      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_ECOLU      PSAFTPPPKVDSAVVRLVPHATM----------------------PHPVKDVRVLSRITT
RSMA_CROS8      PTAFTPPPKVDSAVVRLVPHATP----------------------PHPVKELRLLSRLTT
RSMA_ENT38      PTAFTPAPKVESAVVRLVPHAVM----------------------PHPVKELRVLSRITT
RSMA_PECAS      PEAFKPAPKVDSAVVRLVPHAEL----------------------PYPVSDIRMLSRITT
RSMA_PECCP      PEAFKPAPKVDSAVVRLVPHTEI----------------------PYPVSDIRVLSRITT
RSMA_YERPE      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERPP      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERPN      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERPG      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERPA      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERPS      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERPB      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERP3      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERPY      PTAFTPAPKVDSAVVRLIPHVQM----------------------PHPVGDVRMLSRITT
RSMA_YERE8      PTAFTPAPKVDSAVVRLIPHVNT----------------------PNPVGDVRMLSRITT
RSMA_SERP5      PTSFTPAPKVDSAVVRLVPHLVN----------------------PNPVGDVRMLSRITT
RSMA_PHOLL      PTAFTPAPKVDSAVVRLVPHKSI----------------------PHPVKNIRMLSRITT
RSMA_ERWT9      PESFTPAPKVDSAVVRLMPYAQP----------------------PHPVNDIRALSRITT
RSMA_SODGM      PASFRPAPKVDSAVVRLVPYATL----------------------PFPVKDLSKLATLTS
RSMA_PROMH      PSSFKPAPKVDSAVVRLIPYKEK----------------------PYPVTDIAMLSRITS
RSMA_HAMD5      PDAFTPIPKVYSAMIRLLPYRSLSH--------------------PYPVTDIERLNLVTR
RSMA_BAUCH      PESFRPVPQVDSAVVRLVPYVIP----------------------PYPVKDINKLYLLTS
RSMA_BLOFL      KKSFIPIPKVESMIVQFIPYHTNN---------------------PYPTVNISLLSLLTK
RSMA_BLOPB      ATSFFPIPKVESMVMRLLP-HTNT---------------------PYPIVNIGKLSSLTK
RSMA_BUCAI      PEDFRPIPKVHSVFINLKP-HTNS---------------------PYFVYNVNILSAITK
RSMA_BUCAP      SENFRPIPKIDSTFVNLVP-HKKS---------------------PYFTHDIKVLSYITN
RSMA_BUCBP      AQSFYPIPKVTSSFVRLVP-RKVF---------------------NLYVRDINQLSNVTA
RSMA_WIGBR      NCAFKPIPKVQSSLIRMRP-HKVC---------------------PFPFCDIDKMKVLLK
RSMA_FRATF      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRATH      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRATO      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRATM      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRATW      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRATT      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRAT1      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRATN      PEVFYPQPKVDSAILRLKPKNSK-----------------------ELLKNYNFFEEIVK
RSMA_FRAP2      PEVFYPQPKVDSAILRLKPKANK-----------------------LVINDYIFFENIVK
RSMA_BACFR      EQVFNPPPKVKSAVIRMTRNETQ-----------------------ELGCDPKLFKQIVK
RSMA_BACFN      EQVFNPPPKVKSAVIRMTRNETQ-----------------------ELGCDPKLFKQIVK
RSMA_BACTN      EHVFNPPPKVKSAVIRMTRNDTK-----------------------ELGCDEKLFKQVVK
RSMA_BACV8      EHVFNPPPKVKSAVIRMTRNETT-----------------------ELGCNEKLFKLIVK
RSMA_PARD8      EKVFDPPPKVKSAVLKMTRNDRK-----------------------ELGCDEKLFKTVVK
RSMA_PORGI      ASVFDPPPKVQSGVIRLTRNDRK-----------------------ELPCSEKALKTVVK
RSMA_PORG3      ASVFDPPPKVQSGVIRLTRNDRK-----------------------ELPCSEKALKTVVK
RSMA_FLAJ1      ENVFIPPPKVKSGVMKMTRKEDY-----------------------SLPCGEKLFFTVVK
RSMA_FLAPJ      ETVFIPPPKVKSGVLRLRRKKDY-----------------------SLPCGEKLFFTVVK
RSMA_CYTH3      EHVFTPPPKVKSGVIRLKRNNRT-----------------------HLPCDEKEFFKVVK
RSMA_CHLP8      RAVFKPRPEVDSAVIRLV--PKAQN----------------------PVEDSEGFRTFVR
RSMA_CHLTE      RAVFKPRPDVDSAVIKMV--PKAVD----------------------PVKDSEGFRTFVR
RSMA_CHLPB      RTVFKPRPEVDSAVVSII--PKTAI----------------------FDADETGFRNFVR
RSMA_PROA2      KKVFRPRPEVDSAVVRIV--PKKTP----------------------LDDCETEFRRFVR
RSMA_CHLL2      RKVFKPQPGVDSAVITIT--PKEHV----------------------PLSDPEGFSRFVR
RSMA_CHLPD      RKVFRPQPGVDSAVISMK--PKVND----------------------PVSDREGFSRFVR
RSMA_PELLD      RKVFRPQPNVDSAVISMV--PKKNV----------------------AVEDAQAFSRFVR
RSMA_CHLCH      RKVFKPQPKVESAVIKLT--PHATD----------------------PALDADGFRRFVR
RSMA_SALRD      PQVFSPQPDVTSAVVRIRFGPDTEP----------------------EDLHFDDARRYVR
RSMA_ANAD2      PGAFWPPPKVASAVLCALFR-PPADA----------------------VADPARFRRLVK
RSMA_ANASK      PGAFWPPPKVASAVLCALFR-PPADA----------------------VADPARFRRLVK
RSMA_ANADE      PGAFWPPPKVESAVLCALFR-PPADA----------------------VGDPARFRRLVK
RSMA_MYXXD      AWRFHPPPKVDSAVLRLTRRKSPRAP----------------------IIDEARFTRVVK
RSMA_GEOMG      PGSFHPVPKVDSAVLSFVPLEKPRVA----------------------VGDEQYFRRLVK
RSMA_GEOSL      PGSFHPVPKVDSVVLLFVPLAQPRVD----------------------VGDEDYFRRVVK
RSMA_PELCD      PGAFYPPPKVHSAVLCFDALAQPRIV----------------------VEDQQFFRRVVK
RSMA_MAGMM      PAAFLPAPKVTSAVVHVQMMRQPRVA----------------------VEDERHFVRVVK
RSMA_DESAH      PHLFFPKPAVDSRVIEVNFFETTPYS----------------------GERERFLFKVIK
RSMA_DESOH      PNLFFPRPGVDSEVVRIVFRPWPGNR----------------------DCDEALFFAMIK
RSMA_DESPS      PAEFHPRPKIDSAVITVDFTKPPELP----------------------EYNKELLSRVVR
RSMA_SYNAS      PGCFYPKPEVTSTVVKMLIPEEPLYW----------------------VENDALFFRLVK
RSMA_MYCCT      KKMFYPIPKVDSAIISLTFN--NI--------------------YKKQINDDKKFIEFVR
RSMA_MYCMS      KKMFYPIPKVDSAIISLTFN--DI--------------------YKKQINDDKKFIEFVR
RSMA_MESFL      KHMFYPVPKVDSAIISLTFN--NK--------------------YTEQIKDKDKFLTFLR
RSMA_FUSNN      REFFNPIPNVDSAFISIKFYKDDR--------------------YKNKISED-LFFKYVK
RSMA_AYWBP      RHMFFPTPKVDSIVIKLTKN------------------------NNILPTFLKQFIKFVK
RSMA_ONYPE      RHMFFPAPKVDSIVIKLTKN------------------------NNICPTFLQQFIKFVK
RSMA_PHYAS      SHMFFPQPKVDSVVLKLSKHKSDF--------------------NTFSTSSQKNFITFVK
RSMA_MYCH7      PDSFFPKPKVNSAVVLFDFR------------------------ENLEAKKMEEFFWFTK
RSMA_MYCHJ      PDSFFPKPKINSAVVFFDLR------------------------TNLDAKKTEQFFWFTK
RSMA_MYCH2      PDSFFPKPKVNSAVVSFDFR------------------------ANLDAKEMENFFWFTK
RSMA_MYCMO      RTCFYPQPNVDSAVVYFEFK------------------------NDIENIDIEKFLVFIK
RSMA_MYCS5      KNSFIPAPKVDSAVISLKFK------------------------DNIDKENLEKMLKFFL
RSMA_MYCPU      KNSFRPIPKVDSAVIKLVKK------------------------KNKDFSLWKEYFEFLK
RSMA_MYCA5      ASNFNPAPKVDSAIITIDFY------------------------KSLPY-NLKKVLAFIK
RSMA_KORVE      PGSFNPAPQVHSTVLKLQMEPK----------------------LEALGVDEEGFDSFLK
RSMA_ACIC5      PGAFSPPPEVYSTVLRWTMHSR----------------------TDELGVDPTRFTGFLR
RSMA_THEMA      RSCFVPNPEVDSTVVDLKRKP--------------------------VDLDFEKFKKFVS
RSMA_THESQ      RSCFVPNPEVDSTVVDLKRKP--------------------------VDLDFEKFKKFVS
RSMA_THEP1      RSCFVPNPEVDSTVVDLRRKS--------------------------VDLDFEKFRKFVS
RSMA_THENN      RSYFVPNPEVDSVVVEMKRKA--------------------------VEIDFPQFKKFVS
RSMA_NOSS1      ASAFHPPPKVDSAVVRLRPRQIEI---------------------PVN--DPKRLENLVK
RSMA_TRIV2      AGAFHPPPKVDSAVVRLRPRQIQI---------------------PAR--DPKRLENLVK
RSMA_NOSP7      ASAFHPAPKVDSAVVRLRPRKIEI---------------------PAL--NPRQLETFLK
RSMA_CROS5      KKSFYPPPKVDSAVITFRPRSLLN---------------------SAT--NPKYLETLIN
RSMA_RIPO1      SKAFDPPPKVDSAVIRLTPRSLET---------------------PAI--NPQKLDQLVK
RSMA_SYNY3      PKAFTPPPKVDSAVIRLTPYPVEQ---------------------LPG--DRRLLDQLLC
RSMA_ACAM1      ASAFKPAPKVESAVVRLTPRPYPQ---------------------PVQ--NPQWLSTLLK
RSMA_SYNE7      PKSFSPPPKVQSTVICLKPRPWPQ---------------------VCN--NPGRLEKLLN
RSMA_SYNP6      PKSFSPPPKVQSTVICLKPRPWPQ---------------------VCN--NPGRLEKLLN
RSMA_SYNP2      PKAFYPKPKVESVVVRLRPRPLAQ---------------------PAQ--NPKLLATLIK
RSMA_THEEB      PRAFQPPPKVDSVVVCLRPHRTLP---------------------RVG--SPQWLETLLK
RSMA_SYNJB      PTAFKPAPKVESAVIRLTPRPAPT---------------------PVR--DPCWFNHLLR
RSMA_SYNJA      PSAFRPPPQVESAVVRLTPRPAPT---------------------PAR--DPRWFSQLVC
RSMA_GLOVI      SHCFTPPPKVDSAVIRLTPRPFAL---------------------QAD--DPAHLDALVT
RSMA_PROMA      PSSFSPQPKVYSEVIILDPLEKDE---------------------RLDFLVERRVASIVQ
RSMA_PROM4      PKCFKPSPKVHSKVVVIEPFAFSE---------------------RLNVDIEKRVESLLR
RSMA_PROM3      PRSFKPPPKVHSEVILIEPLAPEQ---------------------RLEPLLAKRVESLLR
RSMA_PROMM      PRSFKPPPKVHSEVILIEPLAPEQ---------------------RLEPLLAKRVESLLR
RSMA_SYNS3      PRCFQPPPKVQSEVICIDPFPPER---------------------RPTAALSRGVERLLK
RSMA_SYNPW      PRCFQPPPKVHSEVIRLDPLPLEQ---------------------RPDPVICRRVERLLK
RSMA_SYNSC      PRCFQPPPKVQSEVICLEPLPASE---------------------RVMPDLAARVESLLK
RSMA_SYNPX      PRCFQPPPKVQSEVIQIDPLPADK---------------------RLPSDIARRVESLLR
RSMA_SYNS9      PRCFQPPPKVQSEVILLKPFPPER---------------------RLPIDLASRVEALLK
RSMA_SYNR3      PRCFQPPPKVQSEVISLDPLPADQ---------------------RPPQAVAKQVEHLLR
RSMA_PROM1      SKCFQPAPKVDSKVVMIKPFASID---------------------PDFYEVGNLLEKLLK
RSMA_PROMT      SKCFQPAPKVDSKVVMIKPFASID---------------------PDFYEVGNLLEKLLK
RSMA_PROM0      PSSFSPPPKVFSSLVVFEPIKNDL---------------------RLDISLEKYIDKLLR
RSMA_PROM9      PSSFSPPPKVFSSLVVFEPIKNDL---------------------RLDISLEKYIDKLLR
RSMA_PROMS      PSSFSPPPKVFSSLVVFEPIKNHL---------------------RLDISIEKNIDKLLR
RSMA_PROM2      PSSFSPPPKVFSSLVVFEPINDNL---------------------RLDISLEKYIDKLLR
RSMA_PROM5      PSSFNPPPKVFSSLVVFEPLRPEK---------------------RLDIKLERYIDKLLQ
RSMA_PROMP      PSSFDPPPKVFSTLVVFEPLRPEM---------------------RLDIKLEKYLDKLLR
RSMA_TREPA      PVCFWPRPHVVSQALVLTKRNAV-----------------------PSCVDPALFLHVTK
RSMA_TREPS      PVCFWPRPHVVSQALVLTKRNAV-----------------------PSCVDPALFLHVTK
RSMA_TREDE      ASAFWPQPNVESAAVLFKAKKEF-----------------------AEYKNFKLFIKIVK
RSMA_BORAP      GNNFYPAPKVKSTTLKLIPKK-H------------------------NIKDFKEFNKLIR
RSMA_BORBP      ENNFYPAPKVKSTTLKLIPKK-N------------------------NIKDFKEFNKLIR
RSMA_BORBU      ENNFYPAPKVKSTTLKLIPKK-N------------------------NIKNFKEFNKLVR
RSMA_BORBZ      ENNFYPAPKVKSTTLKLIPKK-N------------------------NIKNFKEFNKLVR
RSMA_UREPA      AKEFHPQPKVQSAVIHLENLHNS------------------------VNFNIEELGKFLR
RSMA_UREP2      AKEFHPQPKVQSAVIHLENLHNS------------------------VNFNIEELGKFLR
RSMA_UREU1      AKEFHPQPKVQSAVIHLENLHNK------------------------VDFDIEQVSKFLR
RSMA_MYCPE      NNCFFPKPEVDSTVISFERKKDF------------------------DFTNFEKLESFLL
RSMA_MYCGE      RHAFKPKPKVDSTLILLEKNK--------------------------SVSYDFKFGLFLK
RSMA_MYCPN      KVAFKPKPQVDSVLMLLKKKP--------------------------QVAYEAHFGRFLK
RSMA_MYCGA      ETAFIPQPKVRSTLLFLEKK---------------------------DIAFNEGYEKFLK
RSMA_ARCB4      AEAFDPPPKVTSSILYIKKDM--------------------------SKSLDKDFNKFLK
RSMA_SULDN      PSAFEPQPKINSAVFLIQKKS--------------------------DRS-DKDFEDMLR
RSMA_HELHP      KEAFSPMPKVTSSVFVIHKYSQQ---------------------NQIEDSFLCDLESFLK
RSMA_CAMC1      AKLFNPPPKVTSSVIKLQKTKKIFGK----------------DGIFKDAKQYEAFKAFLR
RSMA_CAMC5      AQCFNPPPKVVSSVIKIQKSKILLGE----------------SGIFKDKFEYEKFKIFLK
RSMA_CAMHC      ADSFEPAPKVVSAVIRLKKTRKI-------------------DDIFENSVQYENFKNFLK
RSMA_CAMFF      SSAFNPPPKVISSVIRIIKDRDL-----------------------SLNLKYDNFKNFLR
RSMA_CAMJE      PQCFNPPPKVMSAVMSLIKTKDF-----------------------DELCEIENFKNFLK
RSMA_CAMJR      PQCFNPPPKVMSAVMSLIKTKDF-----------------------DELCEIENFKNFLK
RSMA_HELPY      PSAFSPPPKVFSSVFEVIKEPLKEKALASLAQAP--------FFEEALQKGFEMLEDFLK
RSMA_HELPH      PSAFSPPPKVFSSVFEVIKESLKEKALASLAQVP--------FFEEALQKGFETLEDFLK
RSMA_HELPG      PSAFSPPPKVFSSVFEVIKEPLKEKALASLLQAP--------FFEEALQKGFETLEDFLK
RSMA_HELP2      PSAFSPPPKVFSSVFEVIKEPLKEKALASLTQVP--------FFEEALQKGFETLEDFLK
RSMA_HELPS      PSAFSPPPKVFSSVFEVIKEPLKEKALASLLQAP--------FFEEALQKGFETLEDFLK
RSMA_HELPJ      PSAFSPPPKVFSSVFEVIKEPLKEKALASLAQAP--------FFEEALQKGFETLEDFLK
RSMA_HELAH      PSAFSPSPKVFSSMFEVIKEPLKEKALASLIPTL--------SFEEALQKGFETLEDFLK
RSMA_BDEBA      PRDFQPPPKVASRVLSFERIESE-------------------------VKNRKAFLTFVK
                   * * * : *                                                

RSMA_RHIEC      AAFGQRRKMLR-----QSLKPLG-------------------GESLLVKAGIDPARRAET
RSMA_RHIE6      AAFGQRRKMLR-----QSLKPLG-------------------GESLLVKAGIDPARRAET
RSMA_RHILW      AAFGQRRKMLR-----QSLKPLG-------------------GERLLVKAGIDPARRAET
RSMA_RHIL3      AAFGQRRKMLR-----QSLKPLG-------------------GERLLVKAGIDPARRAET
RSMA_AGRVS      AAFGQRRKMLR-----ASLKPLG-------------------GEALLNRAEIDPSRRAET
RSMA_RHIME      AAFGQRRKMLR-----QSLKPLG-------------------GEALLAKAGIDPQRRAET
RSMA_SINMW      AAFGQRRKMLR-----QSLKPLG-------------------GEALLAKAGIDPKRRAET
RSMA_SINFN      AAFGQRRKMLR-----QSLKSIG-------------------GEALLGKAGIDPQRRAET
RSMA_AGRFC      AAFGQRRKMLR-----QSVKSLG-------------------GETLLEKAGIDPTRRAET
RSMA_CHESB      AAFGQRRKMLR-----QSLRSVG-------------------GEALLEKAGIDGTRRAET
RSMA_RHILO      AAFGQRRKMLR-----QSVKSLG-------------------GEALLERAGIDPTRRAET
RSMA_BARHE      TAFGQRRKMLR-----QNLKTLG-------------------GEVLLEKAGIDETRRAET
RSMA_BARQU      TAFGQRRKMLR-----QNLKTLG-------------------GEMLLAKAGIDGTRRAET
RSMA_BART1      TAFGQRRKMLR-----QNLKTLG-------------------GEIILEKAGIDGTRRAET
RSMA_BARBK      VAFGEKRKMLR-----QSLKTIG-------------------GKELLEKAGIDETRRAET
RSMA_BRUA2      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKTGIDGTRRAET
RSMA_BRUA1      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKTGIDGTRRAET
RSMA_BRUC2      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKTGIDGTRRAET
RSMA_BRUMB      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKTGIDGTRRAET
RSMA_BRUO2      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKTGIDGTRRAET
RSMA_BRUSU      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKTGIDGTRRAET
RSMA_BRUME      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKTGIDGTRRAET
RSMA_BRUSI      AAFGQRRKMLR-----QSLKSIG-------------------GGALLEKTGIDGTRRAET
RSMA_BRUAB      AAFGQRRKMLR-----QSLKSIG-------------------GAALLEKMGIDGTRRAET
RSMA_OCHA4      AAFGQRRKMLR-----QSLKPVG-------------------GAELLEKTGIDGTRRAET
RSMA_AZOC5      AAFGQRRKMLR-----QSLKSLGVD-----------------PLALLSETGIDETARAEE
RSMA_XANP2      AAFGQRRKMLR-----QSLKSLGVD-----------------TAALLKATGVEETARAEE
RSMA_METRJ      AAFGQRRKMLR-----QSLKALTPA-----------------AGDLLAAAGLSETARAEE
RSMA_BRASB      AAFGQRRKMLR-----QSLKSLPTD-----------------PARLAAAAGVDPTRRAET
RSMA_BRASO      AAFGQRRKMLR-----QSLKSLPAD-----------------PARLAAAAGIDPTRRAET
RSMA_BRADU      AAFGQRRKMLR-----QSLKSLGVD-----------------PARLAQAAGVDATRRAET
RSMA_NITHX      AAFGQRRKMLR-----QSLKSLPAD-----------------PARLTAAAGIEPTQRAET
RSMA_NITWN      AAFGHRRKMLR-----QSLKSLPAD-----------------PASLAAAAGIDPTRRAET
RSMA_RHOPA      AAFGQRRKMLR-----QSLKSLGVD-----------------PAQLTAAAGIDPARRAET
RSMA_RHOPT      AAFGQRRKMLR-----QSLKSLGVD-----------------PAQLTAAAGIDPARRAET
RSMA_RHOPS      AAFGQRRKMLR-----QSLKSLGVD-----------------PARLAAAAGIDPTRRAET
RSMA_RHOP2      AAFGQRRKMLR-----QSLKALGVD-----------------PARLAAAAGIDPTRRAET
RSMA_RHOP5      AAFGQRRKMLR-----QSLKSLGVD-----------------PARLAAAAGVEPTRRAET
RSMA_RHOPB      AAFGQRRKMLR-----QSLKPLGVD-----------------PARLAAAAGVDPTRRAET
RSMA_OLICO      AAFNQRRKMLR-----QSLKALGVD-----------------PAALAEAAGVDPTRRAET
RSMA_RUEPO      AAFNQRRKMLR-----AALKGQAPD-----------------IEDRLLAAGIKPTERAEQ
RSMA_RUEST      AAFNQRRKMLR-----ASLKGVSPQ-----------------IEDHLNAAGIPPTERAEQ
RSMA_ROSDO      MAFNQRRKMLR-----AALKGLGPD-----------------IEDRLLAAGIEPTERAER
RSMA_PARDP      AGFNQRRKMLR-----ASLKGLHPE-----------------IEALLIQAGIAPTARAEE
RSMA_DINSH      TAFNQRRKMLR-----ASLKGLTPG-----------------IEDHLAAVGIDPTRRAET
RSMA_RHOS4      MAFNQRRKMLR-----SSLKGLVPD-----------------IETVLREAGIEPTQRAEE
RSMA_RHOS1      MAFNQRRKMLR-----SSLKGLVPD-----------------IETVLREAGIEPTQRAEE
RSMA_RHOSK      MAFNQRRKMLR-----SSLKGLVPD-----------------IETVLREAGIEPTQRAEE
RSMA_RHOS5      MAFNQRRKMLR-----SSLKGLAPD-----------------IETVLRDAGIEPTQRAEE
RSMA_JANSC      AAFGQRRKMLR-----AALKGLAPD-----------------IEDRLVAAGLKPTDRAEQ
RSMA_ERYLH      AAFGQRRKMLR-----QSLKGVP-G-----------------AVETLAEVAIEETRRAET
RSMA_NOVAD      AAFGQRRKMLR-----QSLKGLP-G-----------------ALDALETLGIDPQRRAET
RSMA_SPHAL      KGFGQRRKMLR-----QSLKGID-G-----------------AVAAAEALGIDPTRRAET
RSMA_ZYMMO      AAFNQRRKMLR-----QSLKNIE-H-----------------MMEALELAGIDATRRPET
RSMA_MAGSA      AAFGQRRKMLR-----SSLKSLG-G-----------------AEDLLERTGILPTARAEE
RSMA_RHORT      AAFGQRRKMLR-----ASLKALG-D-----------------AEGLCAAAGLDPTARAET
RSMA_GLUOX      AAFGQRRKMLR-----SSLKSIG-------------------GERLLEQAEIEPTRRAET
RSMA_CAUVC      AAFGQRRKMLR-----SSLKALGGA-------------------DLCERAGVSPDARAEV
RSMA_PHEZH      AAFGQRRKMLR-----SSLKALGGE-------------------PLITAAGLDPAARAEV
RSMA_MARMM      SAFGQRRKTLR-----RSLAQAAGQGGTS-------------ADALLEEAGLNAGDRAEV
RSMA_ANAMF      KAFGCKRKTVR-----NALGLPHQEF-----------------DALLAECRIPPSVRAEN
RSMA_ANAMM      KAFGCKRKTVR-----NALGLPHQEF-----------------DALLAECRIPPSVRAEN
RSMA_ANAPZ      KLFHCRRKTIR-----NSLKSCIKDA-----------------DALFIGCNIDPNARAES
RSMA_EHRCJ      VTFGERRKMIR-----STLKKLINNT-----------------DEILQSLNINNNLRPEN
RSMA_EHRCR      TTFSERRKMIR-----STLKKLTNNA-----------------DEMLESLNIDNNLRPEN
RSMA_EHRRG      ITFNQRRKMIR-----STLKQITNNT-----------------DEILHSLNIPNNLRPEN
RSMA_EHRRW      ITFNQRRKMIR-----STLKQITNNT-----------------DEILHSLNIPNNLRPEN
RSMA_WOLPM      AVFAQRRKMLR-----NSLQNITNHA-----------------ETVLENAKLSGNERPEN
RSMA_WOLWR      AVFSQRRKMLR-----NSLQNITNHT-----------------ETVLENAKLSGNERPEN
RSMA_WOLTR      AVFAQRRKMLR-----NSLQNVTNRT-----------------ETALENAKLSGNERPKN
RSMA_WOLPP      AVFAQRRKMLR-----NSLQSITSDV-----------------STTLENAKLSGDERPES
RSMA_NEOSM      EGFSQRRKMIK-----KSLSRIFKDSEA--------------LHSALAQVGASPTMRIEE
RSMA_RICPU      LAFAGRRKMIK-----SSLKNLVPNI-----------------HEVLTQLKINDNYRAEN
RSMA_RICRS      LAFAGRRKMIK-----SSLKNLVPNI-----------------HEVLTQLNINDNYRAEN
RSMA_RICAE      LAFAGRRKMIK-----SSLKNLVPNI-----------------HEVLTQLKINDNYRAEN
RSMA_RICFE      LAFAGRRKMIK-----SSLKNLVPNI-----------------H----------------
RSMA_RICAH      FAFAGRRKMIK-----SSLKNLVPNI-----------------HEVLTQLKINDNYRAEN
RSMA_RICCK      LAFAGRRKMIK-----SSLKNFVPVK-----------------NEVLTQLNINDNYRAEN
RSMA_RICPR      LVFAGRRKMIK-----SSLRNLIPNI-----------------HEVLTQLKINCNDRAEN
RSMA_RICTY      LVFAGRRKMIK-----SSLRNLVPNI-----------------HEVLTQLKINNNDRAEN
RSMA_RICB8      MAFAGRRKMIK-----SSLKNLAPNI-----------------SELLAKLNISNNCRAEN
RSMA_RICBR      MAFAGRRKMIK-----SSLKNLAPNI-----------------SELLAKLNISDNCRAEN
RSMA_PELUB      IFFSQRRKMLK-----KPFNQVFDNG-----------------KEVAEKFGIDLNLRPQN
RSMA_PERMH      MLFSNRRKMLR-----SKIDK-----------------------DILERAGIDPKARAEE
RSMA_SULSY      HLFQNRRKMIK-----SKIEE-----------------------EMLNKAGISPNLRAEE
RSMA_AQUAE      KIFQNRRKVLR-----KKIPE-----------------------ELLKEAGINPDARVEQ
RSMA_HYDS0      KMFSNRRKMLK-----HKLN---------------------------NIEDKYALKRVEE
RSMA_DESVH      LCFQQRRKQLQ-----GILRPHVGGD----------------ASALLAGLGIDPAARPET
RSMA_DESVV      LCFQQRRKQLQ-----GILRPHVGGD----------------ASALLAELGIDPAARPET
RSMA_DESAG      ICFQQRRKQLQ-----KILKRYWSDA----------------VCGWFEQQGLPPAARPEE
RSMA_DESAD      YCFQYRRKQLG-----KILKSFISDA----------------VIQWAEKEGVSLTDRPEA
RSMA_LAWIP      QCFQHRRKQMQ-----SILRKIGFLN----------------YYESLERIGISPSARPES
RSMA_HALMA      AVFTQRRKTMR-----NAVRNTAHISGLGDP-----DAVV------EAADEGLMSARAGK
RSMA_NATPD      AVFTQRRKTMR-----NAVRNTTHISGIEDA-----EAVV------EAAGEDLMSKRAGN
RSMA_HALWD      AVFTQRRKTVR-----NAIRNTAHISMLDTP-----DAVV------NAADEALLSQRAGD
RSMA_HALSA      ALFTQRRKTTR-----NAIRNTAHISGLDDP-----DAVV------AAVDDDVLGTRPGS
RSMA_HALS3      ALFTQRRKTTR-----NAIRNTAHISGLDDP-----DAVV------AAVDDDVLGTRPGS
RSMA_METHJ      ELFTRRRKTVQ-----STLKALAGMFGKEKI-----DSVV------RDLNPEILSSRPEA
RSMA_METAC      AVFSQRRKKLR-----NSILNTNSMLKIPDI-----KEVV------NQLPDDFVNKRAEN
RSMA_METMA      AVFSQRRKKLR-----NAILNTSSLLKIPDI-----KEIV------SQLPEDFMNKRAED
RSMA_METBF      AVFSQRRKKLR-----NAILNTNYLLKIPNI-----KEVI------SRLPEDMMSKRAEN
RSMA_METBU      AVFLQRRKKLR-----NAIVKGNHLLNVPNI-----KQIV------AELPEEFMSKRAEN
RSMA_ARCFU      FAFSMRRKRMG-----KIVQEFRKRYGVE-----------------LAVNKNLAEKRPEE
RSMA_METTH      ALFQHRKKKTS-----KSLRESFHEIRTDLS----FNEVL------RGLPPEILEKRVFQ
RSMA_METST      ALFQHRNKKAK-----KALIQSAHELGVDKKV---LKQKL------SNVTNDLFEEKVFK
RSMA_PYRAB      ALFQHRRKVVS-----KALRESAHMLGIKDV--KTVKDIL------SSVPHS--NKRVFH
RSMA_PYRHO      ALFQHRRKTVP-----RALKDSIHMLGVSK---DEIRGII------NNVPHS--NKRVFQ
RSMA_PYRFU      ALFQHRRKLVS-----KALKESCHMLGINKKELKTLKNIL------ENVPHA--KKRVFE
RSMA_THEKO      ALFQHRRSTVS-----AALKKSAHMLGLSKDKARELRQVF------SRVPHS--ERRVFQ
RSMA_THEGJ      ALFQHRRSTVA-----SALKKSAHMLGTDK---KSIKDYL------SSLPHA--EKRVFQ
RSMA_THEON      ALFQHRRSTVA-----AALKKSHHMLGLSKAEFKNVKDVI------SSAPYA--EKRVFQ
RSMA_THESM      ALFQHRRKLAS-----KALKDSYHMLGLTREDFKKFKPII------ERVPHS--NKRVFQ
RSMA_METKA      ALFQHKNKTVR-----NALLLSAHEWATDRE---QAREVL------EELPEDLLSERPLH
RSMA_METM6      ALFQHRNRTIK-----RALIDSSHEIEIERD---ALKEIL-----EKIESEFDFTERVFK
RSMA_METM7      AIFQHRNRTIK-----RALIDSSHEIGIERN---ILKEIL-----EKIENKFEFTERVFK
RSMA_METMP      AVFQHRNRTIK-----RALIDSSHEIEVDRD---NLKGIL-----EKIENEFDFTQRVFK
RSMA_METM5      AMFQHRNRTIK-----RALIDSSHEIEIDRD---NLKEIL-----EKVESEFDFSERVFK
RSMA_METVS      AIFQHRNRTVK-----RALIDSSHEMNIERE---RLKEIL-----ENIKLDFDFSERVFK
RSMA_META3      ALFQHRNKNTK-----KALIHSAHEINMDRD---KLKELLNS--NEIMEFNDLLGKKVYT
RSMA_METJA      AIFQHRNKSVR-----KALIDSSKELNYNKD---EMKKILEDFLNTNSEIKNLINEKVFK
RSMA_PYRAE      WLFSARRKTLR-----RLKLADS-------------------------------TKRVYQ
RSMA_PYRIL      RLFSTRRKTLR-----RLKLGET-------------------------------EKRVYQ
RSMA_RUBXD      AAFRSRRKRLP-----NNLPGPLR---ERAE--EALAG-----------LGHGPDARAEE
RSMA_NATTJ      QAFNSRRKTLV-----NNILSIFTG--EKSELSQILEN-----------NGFSAGIRGEQ
RSMA_RHOBA      ALFFHRRKFLR-----SVVISAMKGRLDKPAIDEILGR-----------LGHGETARAEE
RSMA_PAEAT      AAFAQRRKTLR-----AALAGWAGSASEA----ERCLVAAG----------LDPTARGEV
RSMA_ARTS2      AAFAQRRKTLR-----AALAGWAGSAAEA----EQCLLAAG----------VDPTARGEV
RSMA_STRAW      AAFAQRRKTLR-----AALAGWAGSAAAA----EAALVAAG----------VSPQARGES
RSMA_STRCO      AAFAQRRKTLR-----AALAGWAGSAAAA----EAALVGAG----------VSPQARGEA
RSMA_STRGG      AAFAQRRKTLR-----AALSGWAGSAPAA----EAALVAAG----------ISPQARGEA
RSMA_THEFY      AAFAQRRKTLR-----AALSSWAGSAAAA----EAALRSAG----------VDPRSRGET
RSMA_KINRD      AAFAQRRKTLR-----AALAGWAGSPAAA----EEALRAAG----------VDPSVRGEQ
RSMA_LEIXX      AAFQQRRKTLR-----QSLAPVYGDPAAA----GAALEAAG----------VAPRRRGEQ
RSMA_CUTAK      AAFASRRKMLR-----SALAGLCGGSMAA----SELITAAG----------IDPTARGEA
RSMA_CORGL      AAFLQRRKTLR-----AALSGHYGSGQAA----EEALRAAD----------IDPTLRGEK
RSMA_CORGB      AAFLQRRKTLR-----AALSGHYGSGQAA----EEALRAAD----------IDPTLRGEK
RSMA_COREF      AAFLQRRKTLR-----AALSGHFGSASAA----EEALRAAD----------IDPQLRGER
RSMA_CORDI      SAFAQRRKTLR-----AALSGHFGSGPAA----EEALRTAG----------IDPILRGEK
RSMA_CORJK      AAFLQRRKTLR-----AALSGHFGSGQAA----EEALRSAG----------IDPTLRGEK
RSMA_MYCA1      IAFGQRRKTCR-----NAFVDWAGSGNES----ADRLLAAS----------IDPARRGET
RSMA_MYCPA      IAFGQRRKTCR-----NAFVDWAGSGNES----ADRLLAAS----------IDPARRGET
RSMA_MYCLE      IAFTQRRKTSR-----NAFVKWAGSSNES----ANRLLAAS----------IDPARRGET
RSMA_MYCLB      IAFTQRRKTSR-----NAFVKWAGSSNES----ANRLLAAS----------IDPARRGET
RSMA_MYCTU      IAFAQRRKTSR-----NAFVQWAGSGSES----ANRLLAAS----------IDPARRGET
RSMA_MYCTA      IAFAQRRKTSR-----NAFVQWAGSGSES----ANRLLAAS----------IDPARRGET
RSMA_MYCBT      IAFAQRRKTSR-----NAFVQWAGSGSES----ANRLLAAS----------IDPARRGET
RSMA_MYCBO      IAFAQRRKTSR-----NAFVQWAGSGSES----ANRLLAAS----------IDPARRGET
RSMA_MYCBP      IAFAQRRKTSR-----NAFVQWAGSGSES----ANRLLAAS----------IDPARRGET
RSMA_MYCGI      IAFAQRRKTSR-----NAFAEWAGSGNES----ASRLLAAS----------IDPSRRGET
RSMA_MYCVP      VAFAQRRKTSR-----NAFAEWAGSGNES----ASRLLAAS----------IDPSRRGET
RSMA_MYCSJ      IAFAQRRKTSR-----NAFAEWAGSGNES----ARRLLAAS----------IDPSRRGET
RSMA_MYCSS      IAFAQRRKTSR-----NAFAEWAGSGNES----ARRLLAAS----------IDPSRRGET
RSMA_MYCSK      IAFAQRRKTSR-----NAFAEWAGSGNES----ARRLLAAS----------IDPSRRGET
RSMA_RHOOB      AAFAQRRKTLR-----AALGGWAGSPAEA----ERRLLEAG----------IPPSSRGET
RSMA_RHOJR      AAFAQRRKTLR-----AALGGWAGSPAEA----ERRLLEAG----------IAPSARGET
RSMA_RHOE4      AAFAQRRKTLR-----AALSGWAGSPAEA----ERRLLAAG----------IEPQTRGEM
RSMA_NOCFA      AAFAQRRKTLR-----AALAGWAGSPAEA----ERRLLAAG----------IDPTARGET
RSMA_BIFLD      AAFGQRRKTLH-----AALKTIAPS---------EAFSIAG----------IDPTRRGET
RSMA_BIFLS      AAFGQRRKTLH-----AALKTIAPS---------EAFSIAG----------IDPTRRGET
RSMA_BIFLO      AAFGQRRKTLH-----AALKTIAPS---------EAFSIAG----------IDPTRRGET
RSMA_BIFAA      AAFGQRRKTLH-----AALKKIVPS---------EAFEKAG----------IDPTRRGET
RSMA_ACIC1      AAFAQRRKMLR-----RALSGWAGSAQAA----EERILAAG----------LRPTDRGEA
RSMA_OPITP      SVFQQRRKQIG-----GLLRDRLPDHGASW---LARLTAAG----------LSSLTRPEA
RSMA_DEIGD      AALHHRRKTLR-----NNLRLAGFGGEAV----GEALMAAG----------LRPDVRAED
RSMA_DEIRA      NALRYRRKTLR-----NNLRMMGHSGEAI----DAALSDLG----------LRPDVRAED
RSMA_THET2      AAFGKRRKTLL-----NALAAAGYPKARV----EEALRALG----------LPPRVRAEE
RSMA_THET8      AAFGKRRKTLL-----NALAAAGYPKARV----EEALRALG----------LPPRVRAEE
RSMA_CHLTR      AAFGQRRKLLA-----NSLKNLYPKDKVF-----QVLEQLG----------FSEKTRPET
RSMA_CHLTA      AAFGQRRKLLA-----NSLKNLYPKDKVF-----QVLEQLG----------FSEKTRPET
RSMA_CHLT2      AAFGQRRKLLA-----NSLKNLYPKDKVF-----QVLEQLG----------FSEKTRPET
RSMA_CHLTB      AAFGQRRKLLA-----NSLKNLYPKDKVF-----QVLEQLG----------FSEKTRPET
RSMA_CHLMU      AAFGQRRKLLA-----NSLKNLYPKDKVF-----QVLEHLG----------FSEKTRPET
RSMA_CHLCV      AAFGQRRKLLA-----NALKDLYPKELVF-----SALNQLN----------FSEKTRPET
RSMA_CHLFF      AAFGQRRKLLA-----NALKNLYPKDLVF-----SALNQLN----------FSEKTRPET
RSMA_CHLAB      AAFGQRRKLLA-----NALKDLYPKERVF-----EALSQLH----------FSDKTRPET
RSMA_CHLPN      TAFQQRRKVLA-----NTLKGLYPKEQVE-----QALKELG----------LLLNVRPEV
RSMA_PARUW      TAFEQRRKMLR-----ASLKSLFDPSKIS-----NALEIIG----------QNPQARPEV
RSMA_ALKMQ      DAFGKRRKTLL-----NALSS-GL-LQLSKEIVRESLEAAN----------IDENRRGET
RSMA_ALKOO      DAFGKRRKTLL-----NALST-GD-LKLEKSLLREVLAASN----------IDENRRGET
RSMA_CLOD6      ASFGQRRKTLL-----NSLG--GL-GFLNKDEIREILKEAN----------IDEKRRGET
RSMA_LACP7      ASFNQRRKTLA-----NGLNNSPE-ISLPKEMISEAIEELG----------VVATIRGEA
RSMA_CLOPE      HAFNMRRKTLW-----NATKN----VKLPKELMEKAYEEAG----------IDPKRRGET
RSMA_CLOP1      HAFNMRRKTLW-----NATKN----VKLPKELMEKAYEEAG----------IDPKRRGET
RSMA_CLOPS      HAFNMRRKTLW-----NATKN----VKLPKELMEKAYEEAG----------IDPKRRGET
RSMA_CLOAB      SAFNMRRKTLW-----NAMKG----LKLSSEDLEKAFEAAG----------IDSKRRGET
RSMA_CLOB6      SSFNMRRKTLW-----NSLKS----LNINKESMENAFERAG----------IDSKRRGET
RSMA_CLOBJ      SSFNMRRKTLW-----NSLKS----LNINKESMENAFERAG----------IDSKRRGET
RSMA_CLOB1      SSFNMRRKTLW-----NSLKS----LNIDKESMENAFERAG----------IDPKRRGET
RSMA_CLOBL      SSFNMRRKTLW-----NSLKS----LNIDKESMENAFERAG----------IDPKRRGET
RSMA_CLOBK      SSFNMRRKTLW-----NSLKS----LNIDKESMENAFERAG----------IDPKRRGET
RSMA_CLOBM      SSFNMRRKTLW-----NSLKS----LNIDKESMENAFERAG----------IDPKRRGET
RSMA_HALOH      AIFQQRRKTLK-----NSLTKSSE-IKLDKGIVTEAIRELG----------LDPRIRGEK
RSMA_MOOTA      AAFNQRRKTIL-----NALGS-LG-FE--KSKIMEALAGAG----------IDPRRRGET
RSMA_PELTS      AAFGFRRKTLL-----NSLAA-SG-LGPGREAWLEVLKRAG----------IDPQRRGET
RSMA_SYMTH      AAFGQRRKSLV-----NALTS-LG-VE--KAAVHAALEAAG----------IDPGRRGES
RSMA_CALS4      AAFGQRRKVLS-----NSLKV----LGFSKEVLHETLLKVG----------ISPQARGET
RSMA_DEHMB      AGFGTRRKTLL-----NALAQ--G-LGISKPVILSLLNGAG----------IDPARRAET
RSMA_DEHMC      AGFGTRRKTLL-----NALAQ--G-LGISKPVILSLLNGAG----------IDPARRAET
RSMA_DEHM1      AGFGTRRKTLL-----NALAQ--G-LGVSKQSVLALLNRAG----------IEPARRAET
RSMA_DESHD      AAFSQRRKTLG-----NSLAG--G-LGLPKQQIGEILAAAG----------VDEQRRAET
RSMA_DESHY      AAFSQRRKTLG-----NSLAG--G-LGLPKQQIGEILAAAG----------VDEQRRAET
RSMA_GEOKA      ASFAQRRKTLF-----NNLTNNLPGGKENKEQIERVLVALG----------IDPRRRGET
RSMA_GEOTN      ASFAQRRKTLL-----NNLLNNLPDGKEKKEQIERALDAVG----------IDPRRRGET
RSMA_GEOSW      ASFAQRRKTIL-----NNLVNNLPNGKAMKEQIERVLTETD----------IDPRRRGET
RSMA_ANOFW      ASFGQRRKTIL-----NNLLNQLPNGKEKKEQIENALANAG----------IDPKRRGET
RSMA_BACLD      ASFAQRRKTLF-----NNLVNNLPNGKENKSKIERALQDSH----------IDGKRRGES
RSMA_BACSU      ASFAQRRKTLL-----NNLVNNLPEGKAQKSTIEQVLEETN----------IDGKRRGES
RSMA_BACP2      ASFGQRRKTLM-----NNLMNNLPDGKQHKAIIEEALQTAD----------IDGKRRGES
RSMA_BACAN      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACAA      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACHK      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACCZ      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACAC      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACC7      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACC0      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACC1      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACCQ      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACCR      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACC4      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACC2      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACC3      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACAH      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACMK      ASFAQRRKTLM-----NNLSNNLNGFPKDKELLDRILTEVG----------IDPKRRGET
RSMA_BACCN      ASFAQRRKTLM-----NNLSNNLNDFPKDKELLERILTEIG----------IDPKRRGET
RSMA_BACHD      ASFANRRKTIL-----NNLIHNLV-GKERKDKAVQALAEAG----------IDPSRRGET
RSMA_LYSSC      ASFVQRRKTIY-----NNLQAGLPNGKTQKDFILEALAAAN----------IEPTRRGET
RSMA_BACSK      ASFANRRKTIL-----NNLVHNLA-GKDAKAAIEQALSEAG----------IDPKRRGET
RSMA_OCEIH      ASFAQRRKTLK-----NNLTRFFKGVHD-KEKIDHILQEAG----------VEGIRRGES
RSMA_LISMC      ASFAQRRKTLW-----NNLASKFPALKPRKDELVEGLNAIG----------IDLIRRGET
RSMA_LISMF      ASFAQRRKTLW-----NNLASKFPALKPRKDELVEGLNAIG----------IDLIRRGET
RSMA_LISMO      ASFAQRRKTLW-----NNLASKFPALKPRKDELVEGLNAIG----------IDLIRRGET
RSMA_LISMH      ASFAQRRKTLW-----NNLASKFPALKPRKDELVEGLNAIG----------IDLIRRGET
RSMA_LISIN      ASFAQRRKTLW-----NNLASKFPALKPRKEELIEGLNAIG----------IDLIRRGET
RSMA_LISW6      ASFAQRRKTLW-----NNLASKFPALKPRKDELVEGLNAIG----------IDLIRRGET
RSMA_STAAT      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAA3      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAC      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAA2      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAA9      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAS      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAA1      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAM      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAW      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAN      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAA8      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAB      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAE      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVILQWLEQAG----------IDPRRRGET
RSMA_STAAR      AAFAQRRKTIN-----NNYQNYFKDGKQHKEVIIQWLEQAG----------IDPRRRGET
RSMA_STAES      AAFAQRRKTIN-----NNYQNFFKDGKKNKETIRQWLESAG----------IDPKRRGET
RSMA_STAEQ      AAFAQRRKTIN-----NNYQNFFKDGKKNKETIRQWLESAG----------IDPKRRGET
RSMA_STAHJ      AAFAQRRKTIN-----NNYQNFFKDGKKHKESILKWLEQTG----------IDPKRRGET
RSMA_STACT      AAFSQRRKTIA-----NNYQSLFFDGKQKKYIIKTWLEDGG----------IDPRRRGET
RSMA_STAS1      AAFSQRRKTIN-----NNYQSLFVNGKVNKEKILEWLEAAG----------IDPRRRGET
RSMA_MACCJ      GAFVQRRKTIL-----NNYMSLIQDSKEHKSRIIEWLEASG----------VAPSRRGES
RSMA_STRA1      VAFVHRRKTLW-----NNLTSHFGKSEDTKAKLEKALEIAK----------IKPSIRGEA
RSMA_STRA5      VAFVHRRKTLW-----NNLTSHFGKSEDTKAKLEKALEIAK----------IKPSIRGEA
RSMA_STRA3      VAFVHRRKTLW-----NNLTSHFGKSEDTKAKLEKALEIAK----------IKPSIRGEA
RSMA_STRMU      AAFVHRRKTLW-----NNLTSHFGKSEEVKVKLEQALEAAD----------IKPSIRGEE
RSMA_STRS7      VGFVHRRKTLW-----NNLVSHFGKAEDTKARLEQGLALAG----------IKPSIRGEA
RSMA_STREM      VGFVHRRKTLW-----NNLVSHFGKAEDTKARLEQGLALAG----------IKPSIRGEA
RSMA_STRE4      VGFVHRRKTLW-----NNLVSHFGKAEDTKARLEQGLALAG----------IKPSIRGEA
RSMA_STRPB      LSFVHRRKTLW-----NNLTSHFGKSEDIKAKLEKGLALAD----------IKPSIRGEA
RSMA_STRPC      LSFVHRRKTLW-----NNLTSHFGKSEDIKAKLEKGLALAD----------IKPSIRGEA
RSMA_STRP1      LSFVHRRKTLW-----NNLTSHFGKSEDIKAKLEKGLALAD----------IKPSIRGEA
RSMA_STRPF      LSFVHRRKTLW-----NNLTSHFGKSEDIKAKLEKGLALAD----------IKPSIRGEA
RSMA_STRPD      LSFVHRRKTLW-----NNLTSHFGKSEDIKTKLEKGLALAD----------IKPSIRGEA
RSMA_STRPM      LSFVHRRKTLW-----NNLTSHFGKSEDIKTKLEKGLALAD----------IKPSIRGEA
RSMA_STRP8      LSFVHRRKTLW-----NNLTSHFGKSEDIKTKLEKGLALAD----------IKPSIRGEA
RSMA_STRPG      LSFVHRRKTLW-----NNLTSHFGKSEDIKTKLEKGLALAD----------IKPSIRGEA
RSMA_STRP6      LSFVHRRKTLW-----NNLTSHFGKSEDIKTKLEKGLALAD----------IKPSIRGEA
RSMA_STRP3      LSFVHRRKTLW-----NNLTSHFGKSEDIKAKLEKGLALAD----------IKSSIRGEA
RSMA_STRU0      VGFIHRRKTLW-----NNLTSHFGKTEEIKTKLTQALELAD----------IKPSIRGEA
RSMA_STRT2      ASFLHRRKTLW-----NNLTSHFGKSEEVKNKLDQALENAA----------IKPSIRGEA
RSMA_STRTD      ASFLHRRKTLW-----NNLTSHFGKSEEVKNKLDQALENAA----------IKPSIRGEA
RSMA_STRT1      ASFLHRRKTLW-----NNLTSHFGKSEEVKNKLDQALENAA----------IKPSIRGEA
RSMA_STRGC      ASFVHRRKTLW-----NNLTSYFGKSEEVKEKLENALAKAN----------LVANVRGEA
RSMA_STRSV      ASFVHRRKTLW-----NNLTSYFGKSEETKGKLTAALERAE----------LSPSVRGEA
RSMA_STRPN      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRZT      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRPJ      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRP7      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRZJ      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRPI      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRP4      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRR6      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRP2      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRPS      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_STRZP      ASFTHRRKTLW-----NNLTGYFGKTEEVKDKLTKALDQAG----------LSPSVRGEA
RSMA_LACLA      SSFVHRRKTLM-----NNLQAAFGK--ESKPEIEKLLAQAE----------ISPTIRGEA
RSMA_ENTFA      ASFQLRRKTLW-----NNLTHFYGKDEQTVAWLKESLAEAE----------IDPSRRGET
RSMA_LACSS      GAFAQRRKTLW-----NNLQNQFGKQEEVKAGLVAALDQAD----------IAPSTRAEQ
RSMA_LACPL      AGFAHRRKNLW-----NNLQSLFGKQPETKTAIQQALDIAT----------IDPKIRAER
RSMA_LACS1      GSFMHRRKSLW-----NNLQSLYGKDPETKEKMLQALEVAD----------IKQSIRAEK
RSMA_LACBA      GCFAHRRKSLW-----NNLQGIFGKQPEVRERIETVLNQTG----------ISRQLRPER
RSMA_PEDPA      GCFMHRRKNIW-----NNMQGLYGKEPEIKAKIQNVLDDLG----------IDPQVRPER
RSMA_LACRD      GCFAHRRKSLW-----NNLQSVIGKDPAAKEKMTAVLNQLD----------ISPQIRPEK
RSMA_LACRJ      GCFAHRRKSLW-----NNLQSVIGKDPAAKEKMTAVLNQLD----------ISPQIRPEK
RSMA_LEUCK      GSFAHRRKSLW-----NNMLQMFGKQEDVKQRIQDALDSVN----------IASSIRAER
RSMA_LEUMM      GSFSHRRKSLW-----NNMLQTYGKDAGTKEQLTVALKSAQ----------IDPAIRAER
RSMA_OENOB      ASFAHRRKSLV-----NNLLYYFGKNDENRTKIERSISETG----------FDLNIRGER
RSMA_LACAC      MCFSQRRKTLN-----NNLKALIPN----AKEREALISKLG----------VDPRVRPED
RSMA_LACH4      MCFSQRRKTLN-----NNLKTLIPD----SEKREALIKKLG----------VDPRVRPEN
RSMA_LACJO      MCFAQRRKTLA-----NNLKTLIKD----KDEREKLINDLG----------LDVRVRPEE
RSMA_LACDA      LCFAQRRKTLA-----NNLKTLLPD----KEDREKLLADLD----------LDPRQRPEQ
RSMA_LACDB      LCFAQRRKTLA-----NNLKTLLPD----KEDREKLLADLD----------LDPRQRPEQ
RSMA_CARHZ      AAFATRRKTIA-----KSLSGALNL---KRNYVEEVLLKVG----------IKPDLRAEQ
RSMA_ACIF2      TSFAQRRKTLA-----NNLRGILSAD-------------------DLRGLQIDPGSRAET
RSMA_ACIF5      TSFAQRRKTLA-----NNLRGILSAD-------------------DLRGLQIDPGSRAET
RSMA_HALHL      AAFGGRRKTLR-----NSLKGLVTAQ-------------------AFEAAGVDPGARAET
RSMA_ACISJ      VAFSQRRKLLR-----HTLGRWLEAR-------------------QFAG-TFDTQRRAEE
RSMA_ACIET      VAFSQRRKLLR-----HTLGRWLEAR-------------------QFAG-TFDTQRRAEE
RSMA_ACIAC      VAFSQRRKLLR-----HTLGRWLEAR-------------------QFTG-TFDTQRRAEE
RSMA_POLSJ      VAFSQRRKLLR-----HTLGQWLTAR-------------------GFPG-AFDVQRRAEE
RSMA_POLNA      VAFSQRRKLLR-----HTLGQWLEQH-------------------AFSG-EFDVKRRAEE
RSMA_RHOFT      VAFSQRRKLLR-----HTLGQWLQQK-------------------GYAD-EFDVQRRAEE
RSMA_VARPS      VAFSQRRKIMR-----HTLGKWLDEH-------------------GFAG-QFDAQRRAEE
RSMA_VEREI      LAFSQRRKLLH-----HTLGRWLDAH-------------------QYAG-RFDTRRRAEE
RSMA_LEPCP      VAFSQRRKMLR-----NTLGRWLEAR-------------------EHGG-AFDLTRRAEE
RSMA_METPP      TAFSQRRKLLR-----HTLGKWLDAR-------------------EFSG-TFDTQRRAEE
RSMA_BURCM      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDGLGFDLARRAED
RSMA_BURA4      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDGLGFDLARRAED
RSMA_BURCA      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDALGFDLARRAED
RSMA_BURCH      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDALGFDLARRAED
RSMA_BURCC      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDALGFDLARRAED
RSMA_BURCJ      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDALGFDLARRAED
RSMA_BURL3      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDALGFDLARRAED
RSMA_BURM1      AAFSQRRKMLR-----NTLGDYRETI-------------------DFDALGFDLARRAED
RSMA_BURVG      AAFSQRRKMLR-----NTLGAYRDTI-------------------DFDALGFDLARRAED
RSMA_BURMA      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURPS      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURM9      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURM7      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURMS      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURP1      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURP0      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURP6      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_BURTA      AAFSQRRKMLR-----NTLGGYRDLV-------------------DFDALGFDLARRAED
RSMA_PARPJ      AAFSQRRKMLR-----NTLAAYRDSV-------------------DFEALGFDLQRRAED
RSMA_PARXL      AAFSQRRKMLR-----NTLAAYRDSV-------------------DFEGLGFDLQRRAED
RSMA_PARP8      AAFSQRRKMLR-----NTLSTYRDSV-------------------DFEALGFDLQRRAED
RSMA_CUPTR      AAFSQRRKVLR-----NTLSFLRDQV-------------------DFDAMGFDLGRRAEE
RSMA_CUPNH      AAFSQRRKVLR-----NTLSFLRDQV-------------------DFDAMGFDLGRRAEE
RSMA_CUPPJ      AAFSQRRKVLR-----NTLSFLRDQI-------------------DFEAIGFDLGRRAEE
RSMA_CUPMC      AAFSQRRKVLR-----NTLSFLRDQV-------------------DFDALGFDLTRRAEE
RSMA_RALSO      LAFSQRRKVLR-----NTLGSLREVI-------------------DFDALGFDLGRRAEE
RSMA_BURSP      AAFSQRRKILR-----HTLSVYQKTP-------------------DFDALGFDHGRRAQE
RSMA_BORBR      RAFSQRRKMLR-----RVLGDWAALT-------------------PWDELGIAPTARAEE
RSMA_BORPE      RAFSQRRKMLR-----RVLDDWAALT-------------------PWDELGIAPTARAEE
RSMA_BORPA      RAFSQRRKMLR-----RVLGDWAALT-------------------PWDELGIAPTARAEE
RSMA_BORA1      RAFSQRRKMLR-----RGLGDWAAHV-------------------PWDDIGVPPTARAEE
RSMA_BORPD      RAFAQRRKMLR-----RGLGDWAALV-------------------PWDALDIAPTARAEE
RSMA_HERAR      KAFSQRRKVIR-----NCLAGMFSEA-------------------DLIEAGINPQMRPET
RSMA_JANMA      KAFSQRRKVIR-----NCLAGMFAES-------------------DLLEVGIDPQLRPET
RSMA_AROAE      AAFGQRRKTLR-----NTLREWLDEA-------------------DFPALGIDPGLRGER
RSMA_THIDA      AAFAQRRKTLR-----NTLSALMRPE-------------------DFVALGIDPGLRAEA
RSMA_METFK      AAFAQRRKTLR-----NTLKGLLDDT-------------------GFASLGIDPQLRAEN
RSMA_CHRVO      QAFAQRRKTLR-----NNLKGLADAA-------------------DLEALGIDPGLRPEN
RSMA_LARHH      QAFAQRRKTLR-----NNLRGWLDDD-------------------DFAALGIDPQRRPET
RSMA_NEIG1      LAFRQRRKTIR-----NNLKELADDD-------------------DLQAVGISPQDRAEH
RSMA_NEIG2      LAFRQRRKTIR-----NNLKELADDD-------------------DLQAVGISPQDRAEH
RSMA_NEIMA      LAFHQRRKTIR-----NNLKELAGDD-------------------DLQAVGINPQDRAEH
RSMA_NEIM0      LAFHQRRKTIR-----NNLKELAGDD-------------------DLQAVDINPQDRAEH
RSMA_NEIMB      LAFHQRRKTIR-----NNLKELAGDD-------------------DLQAVGINPQDRAEH
RSMA_NEIMF      LAFHQRRKTIR-----NNLKELAGDD-------------------DLQAVGINPQDRAEH
RSMA_DECAR      TAFSQRRKMLR-----NTMKTLLSDA-------------------AFTELGIDPTCRPED
RSMA_NITEU      AAFSQRRKTLR-----NTLRHYLTAD-------------------DFERLEIDSGLRAEN
RSMA_NITEC      AAFSQRRKTLR-----NTLRHYLTIK-------------------DFDQLRIDPGLRAEN
RSMA_NITMU      AAFSQRRKILR-----NTLRDYLTGE-------------------DYLKLGIDSNLRAEN
RSMA_PSYA2      ETFNHRRKTLRAIFKKSTLLPTLSED-------------------DFAACAIDPQARPET
RSMA_PSYCK      ETFNHRRKTLRAIFKKSTLLPTLSED-------------------DFAACAIDPQARPET
RSMA_ACIAD      HVFTQRRKTLR-----NSLKGMLADD-------------------AFDKAGIDPMARPET
RSMA_COXBU      EAFSYRRKTVG-----NALKKLINPS-------------------QWPLLEINPQLRPQE
RSMA_COXB2      EAFSYRRKTVG-----NALKKLINPS-------------------QWPLLEINPQLRPQE
RSMA_COXBR      EAFSYRRKTVG-----NALKKLINPS-------------------QWPLLEINPQLRPQE
RSMA_COXBN      EAFSYRRKTVG-----NALKKLINPS-------------------QWPLLEINPQLRPQE
RSMA_COXB1      EAFSYRRKTVG-----NALKKLINPS-------------------QWPLLEINPQLRPQE
RSMA_ALCBS      QAFTQRRKAIR-----NGLKSWVSAE-------------------QFQAVGIDAGLRPDQ
RSMA_HAHCH      QAFAMRRKTLR-----NTLKQLITVD-------------------ALQSLDIDPQIRPER
RSMA_MARHV      TAFNARRKTLR-----KALAAMVTVE-------------------QLQSLGINDGLRPEN
RSMA_MARMS      IGFQQRRKTLR-----NNYKGVLDND-------------------DFSALNIDPTLRPER
RSMA_PSEF5      EAFNQRRKTLR-----NTLKALLSSA-------------------EIEAAGVDGSLRPEQ
RSMA_PSEPF      EAFNQRRKTLR-----NTLKQLLSNA-------------------EIEAAGVDGSLRPEQ
RSMA_PSE14      EAFNQRRKTLR-----NTLKLLLSSD-------------------EITASGVDGSLRPEQ
RSMA_PSESM      EAFNQRRKTLR-----NTLKLLLSSD-------------------EITASGVDGSLRPEQ
RSMA_PSEU2      EAFNQRRKTLR-----NTLKLLLTSD-------------------EITASGVDGSLRPEQ
RSMA_PSEPK      EAFNQRRKTLR-----NTMKGLLDSA-------------------AIEAAGVDGSLRPEQ
RSMA_PSEAE      EAFNQRRKTLR-----NTLKPLLSVE-------------------DIEAAEVDPTLRPEQ
RSMA_CHRSD      EAFGQRRKTLR-----NNLKTRLDDT-------------------AWAALDIDPGRRPQT
RSMA_SACD2      TAFAQRRKTLR-----NNLKNLDEEL-------------------DLEALDIDLTRRAES
RSMA_METCA      AAFGQRRKTLR-----NALKGLLDET-------------------AMVRAGIDPGARAEE
RSMA_LEGPC      KAFAMRRKTLT-----NNLKGIISLS-------------------QLNDLGIDGGKRPEQ
RSMA_LEGPA      KAFAMRRKTLT-----NNLKGIISLS-------------------QLNDLGIDGGKRPEQ
RSMA_LEGPL      KAFAMRRKTLT-----NNLKGIISLS-------------------QLNDLGIDGGKRPEQ
RSMA_LEGPH      KAFAMRRKTLT-----NNLKGIISLS-------------------QLNDLGIDGGKRPEQ
RSMA_NITOC      QAFSQRRKTLA-----NALKGLLSSA-------------------ELIALGIDPRQRPET
RSMA_HYDCU      QAFSQKRKTLR-----NNLKGFLNDE-------------------QIEACGLDPSVRAEK
RSMA_XANAC      AGFGQRRKTLR-----NALSAICEPA-------------------HFDAAQVRPDARAEQ
RSMA_XANC5      AGFGQRRKTLR-----NALSTICEPA-------------------HFDAAQVRPDARAEQ
RSMA_XANOR      AGFGQRRKTLR-----NALSTVCEPA-------------------HFEAAQVRPDARAEQ
RSMA_XANOM      AGFGQRRKTLR-----NALSTVCEPA-------------------HFEAAQVRPDARAEQ
RSMA_XANOP      AGFGQRRKTLR-----NALSTVCEPA-------------------HFEAAQVRPDARAEQ
RSMA_XANCP      AGFGQRRKTLR-----NALSTVCEPA-------------------HFEAAGVRPDARAEQ
RSMA_XANC8      AGFGQRRKTLR-----NALSTVCEPA-------------------HFEAAGVRPDARAEQ
RSMA_XANCB      AGFGQRRKTLR-----NALSTVCEPA-------------------HFEAAGVRPDARAEQ
RSMA_XYLFA      AAFGQRRKTLR-----NSLADICTPA-------------------HFEHAGIRTNARAEQ
RSMA_XYLFT      AAFGQRRKTLR-----NSLADICTPA-------------------HFEHAGIRTNARAEQ
RSMA_DICNV      SAFSQRRKMLR-----KSLAAYFEPK-------------------ELMALDVDPTARAET
RSMA_ACTP2      QAFNQRRKTLR-----NALSTLFSPE-------------------QLEALNIDLNARAEN
RSMA_ACTP7      QAFNQRRKTLR-----NALSTLFSPE-------------------QLEALSIDLNARAEN
RSMA_ACTPJ      QAFNQRRKTLR-----NALSTLFSPE-------------------QLEALNIDLNARAEN
RSMA_HAEDU      HAFNQRRKTLR-----NALSTLFTAQ-------------------QLEMLGINLTDRAEN
RSMA_HAEIE      QAFNQRRKTLR-----NALSTLFSPE-------------------NLTALGIDLNARAEN
RSMA_HAEIG      QAFNQRRKTLR-----NALSTLFSPE-------------------NLTALGIDLNARAEN
RSMA_HAEIN      QAFNQRRKTLR-----NALSTLFSPE-------------------NLTALGIDLNARAEN
RSMA_HAEI8      QAFNQRRKTLR-----NALSTLFSPE-------------------NLTALGIDLNARAEN
RSMA_PASMU      QAFNQRRKTLR-----NALSTLFSAD-------------------QLTELGIDLTARAEN
RSMA_MANSM      QAFNQRRKTLR-----NALSTLFTPE-------------------QLTALNIDLTARAEN
RSMA_HAES1      QAFNQRRKTLR-----NALSTLFSAE-------------------KLTALAIDLEARAEN
RSMA_HISS2      QAFNQRRKTLR-----NALSTLFSAE-------------------KLTALAIDLEARAEN
RSMA_PSYIN      MAFNQRRKTIR-----NGLRDLLSIE-------------------QLQEIGIDTTKRAEN
RSMA_AERHH      EGFGQRRKTIR-----NSFSNFITDA-------------------QLTELGIDGNLRPEN
RSMA_TOLAT      EGFGQRRKTIR-----NTFRSFITAE-------------------QLEEIDINPNLRPEN
RSMA_ALIF1      EGFNQRRKTVR-----NCYKALLTKE-------------------QLEELGINPSMRPEN
RSMA_ALIFM      EGFNQRRKTVR-----NCYKALLTKE-------------------QLEELGINPSMRPEN
RSMA_ALISL      EGFNQRRKTVR-----NCFKALLTKE-------------------QLEALGVNPSHRPEN
RSMA_VIBA3      EGFNQRRKTVR-----NCYKSLIDKE-------------------VLEELGVNPGMRPEN
RSMA_VIBCH      EGFNQRRKTVR-----NCYKGLAEPE-------------------TLETLGINPGMRPEN
RSMA_VIBC3      EGFNQRRKTVR-----NCYKGLAEPE-------------------TLETLGINPGMRPEN
RSMA_VIBCB      EGFNQRRKTVR-----NCYKALISAE-------------------VLEELGVNPSMRPEN
RSMA_VIBPA      EGFNQRRKTVR-----NCYKSLLSAE-------------------VLEELGVNPSMRPEN
RSMA_VIBVU      EGFNQRRKTVR-----NCYKSLMSEQ-------------------VLEELGVNPGMRPEN
RSMA_VIBVY      EGFNQRRKTVR-----NCYKSLMSEQ-------------------VLEELGVNPGMRPEN
RSMA_PHOPR      EGFNQRRKTIR-----NCYKALLTVE-------------------QLEDLGVNPGLRPEN
RSMA_SHEB5      TAFNMRRKTLR-----NNLKHMLSDD-------------------EFEQLGIDSSQRPEQ
RSMA_SHEB2      TAFNMRRKTLR-----NNLKHMLSDD-------------------EFEQLGIDSSQRPEQ
RSMA_SHEB8      TAFNMRRKTLR-----NNLKHMLSDD-------------------EFEQLGIDSSQRPEQ
RSMA_SHEB9      TAFNMRRKTLR-----NNLKHMLSDD-------------------EFEQLGIDSSQRPEQ
RSMA_SHEPC      TAFNMRRKTLR-----NNLKHMLSDA-------------------EFEQLGIDQSQRPEQ
RSMA_SHESW      TAFNMRRKTLR-----NNLKHMLSDA-------------------EFEQLGIDQSQRPEQ
RSMA_SHESM      TAFNMRRKTLR-----NNLKQVLSDA-------------------EFEQLGIDPNLRPEQ
RSMA_SHESR      TAFNMRRKTLR-----NNLKQVLSDE-------------------EFEQLGIDPNLRPEQ
RSMA_SHESA      TAFNMRRKTLR-----NNLKQVLSDE-------------------EFEQLGIDPNLRPEQ
RSMA_SHEON      TAFNMRRKTLR-----NNLKQVLSDE-------------------EFEQLGIDQNLRPEQ
RSMA_SHEDO      TAFNMRRKTLR-----NNLKQLISDE-------------------EFGLLNIDASLRPEQ
RSMA_SHEFN      TAFNMRRKTLR-----NNLKTLLSDE-------------------DFAELQIDASLRPEQ
RSMA_SHEHH      TAFNMRRKTLR-----NNLKQLLSDE-------------------DFAELGIDATLRPEQ
RSMA_SHEPA      TAFNMRRKTLR-----NNLKQLLSDE-------------------DFAVLGIDATLRPEQ
RSMA_SHEPW      TAFNMRRKTLR-----NNLKHMLSDD-------------------EFAQLEIDSTLRPEQ
RSMA_SHESH      TAFNMRRKTLR-----NNLKHMISDE-------------------EFAALGIDATLRPEQ
RSMA_SHEWM      TAFNMRRKTLR-----NNLKHMISDE-------------------EFAELGIDATLRPEQ
RSMA_SHELP      TAFNMRRKTLR-----NNLKQLLNDD-------------------DFSALGIDASMRPEQ
RSMA_SHEAM      TAFNMRRKTLR-----NNLKPLLQDA-------------------DFDVLGIDAGLRPED
RSMA_PSET1      EAFNQRRKTLR-----NSLSNLLTAD-------------------ELTSIGIDVTLRAER
RSMA_COLP3      AAFNQRRKTIR-----NTFKKLITEA-------------------QLAELNIDANLRPEN
RSMA_IDILO      TAFNQRRKTIR-----NNLKQLVPAE-------------------QMEALGIDPGARPET
RSMA_SALA4      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALDC      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALEP      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALG2      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALHS      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALPA      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALPK      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALPB      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALPC      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALTI      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALTY      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALAR      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALNS      EAFNQRRKTIR-----NSLDNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALCH      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_SALSV      EAFNQRRKTIR-----NSLGNLFSVE-------------------TLTEMGIDPAMRAEN
RSMA_CITK8      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTELGIDPALRAEN
RSMA_KLEP3      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTELGVDPAVRAEN
RSMA_KLEP7      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTELGIDPAMRAEN
RSMA_ECOUT      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO27      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOK1      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO45      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOL6      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOL5      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO81      EAFNQRRKTIR-----NSLGNLFSAE-------------------VLTGMGIDPAMRAEN
RSMA_ECO55      EAFNQRRKTIR-----NSLGNLFSAE-------------------VLTGMGIDPAMRAEN
RSMA_ECOLC      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOHS      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_SHIBS      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOBW      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECODH      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOLI      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOSM      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO7I      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO8A      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_SHIF8      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_SHISS      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_SHIB3      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGLDPAMRAEN
RSMA_ECOSE      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO57      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO5E      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_SHIFL      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ESCF3      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_SHIDS      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECO24      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_ECOLU      EAFNQRRKTIR-----NSLGNLFSVE-------------------VLTGMGIDPAMRAEN
RSMA_CROS8      EAFNQRRKTIR-----NSLGNVFSPE-------------------VLTSLGIDPAMRAEN
RSMA_ENT38      EAFNQRRKTIR-----NSLGNTFTVD-------------------VLTELGIDPAMRAEN
RSMA_PECAS      EAFNQRRKTLR-----NSLGNLFTPE-------------------TLTELGINITSRAEN
RSMA_PECCP      EAFNQRRKTLR-----NSLGNLFTPD-------------------VLAELGIDATSRAEN
RSMA_YERPE      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERPP      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERPN      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERPG      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERPA      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERPS      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERPB      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERP3      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERPY      QAFNQRRKTVR-----NSLGDLFTSE-------------------QLIELGIDPILRAEN
RSMA_YERE8      QAFNQRRKTVR-----NSLGDLFTPE-------------------QLIELGIDPILRAEN
RSMA_SERP5      QAFNQRRKTVR-----NSLGDLFTPE-------------------QLTELGIDPILRAEN
RSMA_PHOLL      QAFNQRRKTIR-----NSLGDLFTVE-------------------QLTELGIDPSTRAEN
RSMA_ERWT9      EAFGKRRKTLR-----NSLGHLFTVD-------------------VLAEMNIDPTLRAEN
RSMA_SODGM      LAFNQRRKTLR-----NSLGNLFSAQ-------------------QLAEQGIDATLRAEN
RSMA_PROMH      QAFNQRRKTLR-----NSLGGLLTAE-------------------DMLALDIDPTARAEN
RSMA_HAMD5      QAFNQRRKTLH-----NSLGALFTDQ-------------------ELAETGICPKLRAEN
RSMA_BAUCH      LAFQQRRKTIR-----NSLRNLFSVE-------------------QLLTQGIISTLRAEN
RSMA_BLOFL      FAFHQRRKIIH-----NSLSSLLNST-------------------EIIQCGINTESRAEN
RSMA_BLOPB      LAFRQRRKTLR-----NSLSTFFNET-------------------EITQKGINPALRAEN
RSMA_BUCAI      DAFQNRRKILR-----HSLKNLFSEK-------------------ELIKLEINSNLRAEN
RSMA_BUCAP      LAFQKRRKILR-----HSLGKIFSEK-------------------IFLKLNVDPKLRAEN
RSMA_BUCBP      LAFQQRRKIVK-----NSLSSLFNDD-------------------ALRKLGIDPLLRAEN
RSMA_WIGBR      SAFNQRRKMLK-----NSLKKYFSVE-------------------QIILYKINPKLRAEN
RSMA_FRATF      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRATH      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRATO      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRATM      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRATW      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRATT      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRAT1      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRATN      QSFAQRRKTLH-----NNLKSILKERKI-----------------DPSTLPVDTNLRAEN
RSMA_FRAP2      QSFAQRRKTLH-----NNLKGILKELDI-----------------DPNTLPVDTKLRAEN
RSMA_BACFR      TTFNQRRKTLR-----NSIKPILGKDCP-----------------LTEDALFNK--RPEQ
RSMA_BACFN      TTFNQRRKTLR-----NSIKPILGKDCP-----------------LTEDALFNK--RPEQ
RSMA_BACTN      TTFNQRRKTLR-----NSIKPILGKDCP-----------------LTEDALFNK--RPEQ
RSMA_BACV8      TTFNQRRKTLR-----NSISSILDKENP-----------------LSADPIFNK--RPEQ
RSMA_PARD8      TSFNQRRKTLR-----NSMKPLLGKDCP-----------------DYALPIFDK--RPEQ
RSMA_PORGI      TAFGQRRKTLR-----NSLRGILPAGFD-----------------RFDEPVFSK--RPEQ
RSMA_PORG3      TAFGQRRKTLR-----NSLRGILPAGFD-----------------RFDEPVFSK--RPEQ
RSMA_FLAJ1      TAFQQRRKTLR-----NSLKTLNLSDK------------------LREDIIFDK--RPEQ
RSMA_FLAPJ      TAFQQRRKTLR-----NSLKTLNLSDI------------------LREDEVFNL--RPEQ
RSMA_CYTH3      AGFNMRRKTLR-----NALKSINVQNI------------------SMDLPIFDK--RAEQ
RSMA_CHLP8      RAFHQRRKTLW-----NNLKEYYNTS-------------------EVP--AETLKLRAEA
RSMA_CHLTE      RVFHQRRKTLL-----NNLKEYYDTS-------------------GVP--EPTLKLRAES
RSMA_CHLPB      TSFGQRRKTLH-----NNLKKYYDLS-------------------MVT--SIDLKLRAES
RSMA_PROA2      LAFQQRRKTLQ-----NNLKQHYDIS-------------------QLS--ASELQRRAES
RSMA_CHLL2      CAFHQRRKTLL-----NNLKESYNLD-------------------AVP--SEVLKRRAEA
RSMA_CHLPD      CAFHQRRKTLQ-----NNLKKTYELD-------------------RVE--SSVLKQRAEE
RSMA_PELLD      TAFHQRRKTLY-----NNLKDAYMLQ-------------------AVD--EGTLKLRAEA
RSMA_CHLCH      IAFHQRRKTLL-----NNLKESYNLE-------------------LVD--SNKLQLRAEA
RSMA_SALRD      AAFNQRRKMLR-----NSLSAWTKEQ-------------------DVGFPNDWGRKRAEA
RSMA_ANAD2      AGFGQRRKTLR-----NALGS-AKLAD--------PARLEA----AFAAAGVDPGRRGET
RSMA_ANASK      AGFGQRRKTLR-----NALGS-AKLAD--------PARLEA----AFAAAGVDPGRRGET
RSMA_ANADE      AGFGLRRKTLR-----NALGS-AKLAE--------PARLEA----AFAAAGVDPGRRGET
RSMA_MYXXD      ASFAHRRKTLI-----NSIKSDPTLGT--------TETLIA----ALEAAGVDPQRRAET
RSMA_GEOMG      GAFSMRRKTLW-----NCLKNAGLGLS--------GEQLSE----ALAVCGIEPGRRGET
RSMA_GEOSL      ASFAMRRKTLW-----NCLKGGALGVP--------TDGIRD----VLARCGIDEGRRGET
RSMA_PELCD      AAFAQRRKTLR-----NSLTGAGLGF----------DGLEV----SLLDAGIDPGRRAET
RSMA_MAGMM      AAFAQRRKTLR-----NTLKTICPDP-------------NR----WLEQAGIDGALRAEV
RSMA_DESAH      AAFSKRRKTLR-----NSLAGGEL--------DIDTKVSAK----ILETAEIDPVRRAET
RSMA_DESOH      SAFATRRKTIK-----NALSAGMT--------KISPSAWEE----LLVRADVAPTVRAET
RSMA_DESPS      SAFSQRRKTIL-----NTLSSASFFFAEKENKAKNKAMTEK----TIEKAGFAVSLRPEV
RSMA_SYNAS      AAFAQRRKTLL-----NNMKNAHW-------KDCDAGRIEN----LLRDMGAGEKIRAEE
RSMA_MYCCT      TLFNNKRKTIL-----NNLNNIIQ-N---------KNKALE----YLKMLNISSNLRPEQ
RSMA_MYCMS      ILFNNKRKTIL-----NNLNNIIQ-N---------KNKALE----YLNTLNISSNLRPEQ
RSMA_MESFL      KIFNNRRKTIL-----NNLSNVTN-D---------KTKANE----ILDNLNIDKSLRPEV
RSMA_FUSNN      AAFSNKRKNIV-----NNLVTLGY-S---------KDKIKE----ILNQIEISENERAEN
RSMA_AYWBP      NSFKQKRKTLL-----NNLSCQFLLS---------KETIIP----FFLQHHIPLQIRAEQ
RSMA_ONYPE      ASFKQKRKTLL-----NNLSCQFLLS---------KETIIP----FFLQHHIPLQIRAEQ
RSMA_PHYAS      AAFKQKRKTLL-----NNLSSVFLLP---------KTEIIL----FFEQNKLLTKIRAEE
RSMA_MYCH7      KCFQFKRKTLY-----NNLIFFLN-----------KQQIEK----IYNFFQFAQNIRPQQ
RSMA_MYCHJ      KCFQFKRKTLY-----NNLIFFLN-----------KQQIEK----IYNFFQFAQNIRPQQ
RSMA_MYCH2      RCFQFKRKTLY-----NNLIFFLN-----------KQQIEK----IYNFFQFAQNIRPQQ
RSMA_MYCMO      TCFSQQRKKLS-----NNLKNVYD-----------LEKIKS----VLKKLNLSFEVRPQQ
RSMA_MYCS5      VCFANRRKKLT-----FTLNRNFN-----------STKVKL----AYEKLNLSDNARIQE
RSMA_MYCPU      IAFSSRRKTLL-----NNLKYFFN-----------EQKILK----FFELKNYDPKVRAQN
RSMA_MYCA5      QIFAFKRKMLI-----NNLVPQWP-----------KADVIW----AIEQIGHKQTTRAEE
RSMA_KORVE      LIFGQKRKTLF-----NNLRVA-Y-D---------MAKARE----AMKAVGLKSDVRAEA
RSMA_ACIC5      SCFAQKRKTLG-----NNLRAAKY-E---------PAAIAG----AMQSAGVAAGVRAEE
RSMA_THEMA      MIFAKKRKTLK-----NNLRPF-----------------------LSIFEGVDLSRRAEQ
RSMA_THESQ      MIFAKKRKTLK-----NNLKPF-----------------------LSIFEGVDLSRRAEQ
RSMA_THEP1      MIFAKKRKTLK-----NNLRPF-----------------------LSVFEGVDLSRRAEQ
RSMA_THENN      MIFSKKRKTLK-----NNLRPF-----------------------LSVFEGVDLSRRAEQ
RSMA_NOSS1      LGFGAKRKMLR-----NNLQSVVDR---------------DRLSQLLEQLNINPQARAED
RSMA_TRIV2      LGFGAKRKMLR-----NNLQSVVDR---------------DRLSQLLEQLNINPQARAED
RSMA_NOSP7      LGFGAKRKMLR-----NNLQSVIER---------------DRLSHLLEQLKINPQARAED
RSMA_CROS5      LGFSSRRKMLR-----NNLQSLIDR---------------DLLTEFLTEIDLNEQVRAEN
RSMA_RIPO1      LGFANRRKMLH-----NNLKSIIDK---------------DHLTLLLDQLQINPQVRAEE
RSMA_SYNY3      LGFANRRKMLR-----NNLKGLIAP---------------EQLTTLLEQLALPSTARAED
RSMA_ACAM1      VGFSSRRKMLR-----NNLKSLVDR---------------DQLSECLNTLNISLQARAED
RSMA_SYNE7      QGFSAKRKMLR-----NNLKSLYSS---------------EQIEAAFAAHQIAPEARAET
RSMA_SYNP6      QGFSAKRKMLR-----NNLKSLYSS---------------EQIEAAFAAHQIAPEARAET
RSMA_SYNP2      VGFASKRKMLR-----NNLKSLYNP---------------EILDPIFADLDISPQARGEE
RSMA_THEEB      QGFATRRKMLA-----NALKSLVEP---------------EQVRQALLQLGRDANSRAEA
RSMA_SYNJB      QGFSTRRKKLV-----NALGSLVER---------------EVVAAALAQLRLNPDARAEE
RSMA_SYNJA      QGFSARRKQLV-----NALGGLVDR---------------QTVAAALAQLRLSPTARAEE
RSMA_GLOVI      RAFATRRKMLK-----NCLKGWVET---------------EKLLAAFASLDISPDARAED
RSMA_PROMA      IAFLSRRKKLR-----NTLTKICPL---------------DELEPLAYRQGINLNQRPQE
RSMA_PROM4      TAFLGRRKKLR-----NTLASIRPL---------------NQLESLADQLGISLNQRPQE
RSMA_PROM3      QAFLARRKMLR-----NTLAKVLPA---------------AELNALADDLGISLQQRPQE
RSMA_PROMM      QAFLARRKMLR-----NTLAKVLPA---------------AELNALADDLGISLQQRPQE
RSMA_SYNS3      MAFLSRRKMLR-----NTLAPVGST---------------DLLQSLAEEAGISLQQRPQD
RSMA_SYNPW      QAFLARRKMLR-----NTLTVSQPL---------------SELETITQQAGIDLRQRPQE
RSMA_SYNSC      QAFLARRKMLR-----NTLAGVAEP---------------NRLKDLAASAGFSLQQRPQE
RSMA_SYNPX      QAFLARRKMLR-----NTLASLAPE---------------PQLQALAAAAGFQLHQRPQE
RSMA_SYNS9      QAFQARRKMLR-----NTLAGVIDP---------------QVLEPLAASVGISLQQRPQE
RSMA_SYNR3      LAFSARRKMVR-----NTLASAAPA---------------VGLEVWLADAGLTPQQRPQE
RSMA_PROM1      HAFAGRRKKLR-----NTIGSFVTSN--------------DQIKEFFAYRGISLDQRPQE
RSMA_PROMT      HAFAGRRKKLR-----NTIGSFVTSN--------------DQIKEFFAYRGISLDQRPQE
RSMA_PROM0      ISFNSRRKMLR-----NTLNTILSN---------------EEINELSESSKVCFNLRPQD
RSMA_PROM9      ISFNSRRKMLR-----NTLNSILSN---------------EEINELSESSKVCFNLRPQD
RSMA_PROMS      ISFNSRRKMLR-----NTLNSILSN---------------EEINELSESSKVCFNLRPQD
RSMA_PROM2      ISFNSRRKMLR-----NTLNSILSN---------------EEMNELSESSKVCFKLRPQD
RSMA_PROM5      ISFNSRRKMIR-----NTLNSILSE---------------DEIKKLAELSEICFNSRPQD
RSMA_PROMP      ISFNSRRKMIR-----NTLNSILSA---------------EEIEKLSESSQICFNSRPQD
RSMA_TREPA      TLFSARRKTVR-----NNLLTWQKRMPGGAAVCVEELCARA---------GIDARARAEQ
RSMA_TREPS      TLFSARRKTVR-----NNLLTWQKRMPGGAAVCVEELCARA---------GIDARARAEQ
RSMA_TREDE      ALFSSRRKNIK-----NNLGSWMK--SNGYGDKIDLVLERS---------GLSGNLRAES
RSMA_BORAP      TVFSSRRKKLK-----NTIINFITNKA--------------ILRENFLKEYLDKRPENIS
RSMA_BORBP      TVFSGRRKKLK-----NTIINFIKNKA--------------ILEENFLKEYLGKRPENIS
RSMA_BORBU      TVFSNRRKKLK-----NTIINFITNKA--------------TLRENFLKEYLDKRPENIS
RSMA_BORBZ      TVFSNRRKKLK-----NTIINFITNKA--------------TLRENFLKEYLDKRPENIS
RSMA_UREPA      ICFLNKRKKLK-----NNLSNIYDIK---------------IINQMFIDYNLDMNLRAEN
RSMA_UREP2      ICFLNKRKKLK-----NNLSNIYDIK---------------IINQMFIDYNLDMNLRAEN
RSMA_UREU1      ICFLNKRKKLK-----NNLSNIYDIK---------------LVNEMFIDYNLDMNLRAEN
RSMA_MYCPE      KCFSQKRKTIF-----NNLKNYFPKQ---------------KIEEVFNKHSIIPTTRPEN
RSMA_MYCGE      QCFNQRRKMLI-----NNLKHFFAVD---------------YLLNIIQKQNLKTSIRAQE
RSMA_MYCPN      QCFHQRRKLLV-----NNLKQLLPPT---------------LLTNVLQQQDLAATVRAQE
RSMA_MYCGA      LIFLSRRKTIL-----NNLKNNYDPK---------------LIIQSLVSLGFKKTSRAQE
RSMA_ARCB4      ACFIQPRKKLS-----KNLTTIFDKNI---------------IFEIYKELNINDNVRPHE
RSMA_SULDN      VAFTQPRKTLM-----KNLSSTYDKAM---------------LQEIFEKLSLAQTIRPHQ
RSMA_HELHP      IAFYAPRKTLF-----KNLSQVFDKKL---------------LEEVFENENIKSNARAHE
RSMA_CAMC1      AAFASPRKTLL-----KNLSTNFDKKA---------------LEEIFENMNLATNLRPHE
RSMA_CAMC5      IAFASPRKTLM-----KNLSAKFDKFE---------------LNTLFAELNLSPAIRPHE
RSMA_CAMHC      ICFSSPRKTIM-----KNLSTKFDKEI---------------LQSIFEKLDLTTNLRAHE
RSMA_CAMFF      VAFSAPRKTLL-----KNLSNLVQRDR---------------LEIFFNTENLSHTIRPHE
RSMA_CAMJE      DCFKAPRKQLL-----GNLKTYKAK-----------------VLEVLSTLGLKENIRPHE
RSMA_CAMJR      DCFKAPRKQLL-----GNLKTYKAK-----------------VLEVLSTLGLKENIRPHE
RSMA_HELPY      ACFSSPRKTLS-----NNLKKSVSYRE---------------KLDKVLDF-LALENQPTS
RSMA_HELPH      ACFSSPRKTLS-----NNLKKSVSYKE---------------KLDKVLDF-LALENQPTS
RSMA_HELPG      ACFSSPRKTLS-----NNLKKSVSYRE---------------KLDKVLDF-LALENQPTS
RSMA_HELP2      ACFSSPRKTLS-----NNLKKSVSYRE---------------KLDKVLDF-LALESQPTS
RSMA_HELPS      ACFSSPRKTLS-----NNLKKSVSYRE---------------KLDKVLDF-LALENQPTS
RSMA_HELPJ      ACFSSPRKTLS-----NNLKKSVSYKE---------------KLDKVLDF-LALENQPTS
RSMA_HELAH      ACFSSPRKTLS-----NNLKKSVSYKE---------------KLDKVLDF-LALENQPTS
RSMA_BDEBA      CAFAQRRKLLK-----KNLSGLLSQKK----------LTEEQMVGWLAELGFKETARAEE
                  :   .                                                     

RSMA_RHIEC      LSVEEFCLLANNL--------------------------------------
RSMA_RHIE6      LSVEEFCLLANSL--------------------------------------
RSMA_RHILW      LSVEEFCLLANSL--------------------------------------
RSMA_RHIL3      LSVKEFCLLANSL--------------------------------------
RSMA_AGRVS      LSVEEFCRIANLL--------------------------------------
RSMA_RHIME      LTVEEFCRLANCL--------------------------------------
RSMA_SINMW      LSVEEFCRLANCL--------------------------------------
RSMA_SINFN      LTVEEFCRLANCLLGEKVPRSGAAPLRTGFPSEDR----------------
RSMA_AGRFC      LSVEEFVTLANCL--------------------------------------
RSMA_CHESB      LSVEEFVRLAREI--------------------------------------
RSMA_RHILO      LSVEEFVRLTNSV--------------------------------------
RSMA_BARHE      LEISEFVTLANLVI-------------------------------------
RSMA_BARQU      LSISEFVTLANLVI-------------------------------------
RSMA_BART1      LSISEFVTLANLIT-------------------------------------
RSMA_BARBK      LLIPEFITLANLMT-------------------------------------
RSMA_BRUA2      LSVEEFVALANACLP------------------------------------
RSMA_BRUA1      LSVEEFVALANACLP------------------------------------
RSMA_BRUC2      LSVEEFVALANACLP------------------------------------
RSMA_BRUMB      LSVEEFVALANACLP------------------------------------
RSMA_BRUO2      LSVEEFVALANACLP------------------------------------
RSMA_BRUSU      LSVEEFVALANACLP------------------------------------
RSMA_BRUME      LSVEEFVALANACLP------------------------------------
RSMA_BRUSI      LSVEEFVALANACLP------------------------------------
RSMA_BRUAB      LSVEEFVALANACLP------------------------------------
RSMA_OCHA4      LSVEEFVALANAYRPIK----------------------------------
RSMA_AZOC5      IDVAGFLALANAFGRARGGGTGDAAGA------------------------
RSMA_XANP2      IDVDGFVRLANTFAQLKSG-AGAAA--------------------------
RSMA_METRJ      IPVAGFVDLANRWDAHRKAGAPVGTPA------------------------
RSMA_BRASB      IPVSGFVAMARELTNSRDDNKT-----------------------------
RSMA_BRASO      IPVSGFVAMARELTNSRNDNTT-----------------------------
RSMA_BRADU      IPISGFVAMARELADIRSEG-------------------------------
RSMA_NITHX      VPISGFAAMARELADIRNRTNRA----------------------------
RSMA_NITWN      VSISGFAAMARELASIVGSGKRL----------------------------
RSMA_RHOPA      VPVSGFVAMANELANSRAIRTQA----------------------------
RSMA_RHOPT      VPVSGFVAMANELANSRAIRTQA----------------------------
RSMA_RHOPS      VAVSGFVAMANELNNIRNTKTQT----------------------------
RSMA_RHOP2      VPVSGFVAMANELIDIRDTKNTP----------------------------
RSMA_RHOP5      IPVAGFVAMARELANIRGIKSEC----------------------------
RSMA_RHOPB      IAVSGFVAMARELTDIRAIKSV-----------------------------
RSMA_OLICO      VSIAGFVAMANRLIELKA---------------------------------
RSMA_RUEPO      VPLEAFCALARELAR------------------------------------
RSMA_RUEST      VSVEDFCALARSLEKG-----------------------------------
RSMA_ROSDO      VSLEGFCALARAVAAT-----------------------------------
RSMA_PARDP      IGLEQFCALARGLAAAPR---------------------------------
RSMA_DINSH      LSLEEFCALARQIAAG-----------------------------------
RSMA_RHOS4      IPLEGFCALARRLAG------------------------------------
RSMA_RHOS1      IPLEGFCALARRLAG------------------------------------
RSMA_RHOSK      IPLEGFCALARRLAG------------------------------------
RSMA_RHOS5      LSLEAFCALARRVAG------------------------------------
RSMA_JANSC      VPLEGFCALARVMEDVITPSHGREA--------------------------
RSMA_ERYLH      VTVEEFVALARRLGASRPSSNSG----------------------------
RSMA_NOVAD      LSVEDFVAIARLLTK------------------------------------
RSMA_SPHAL      VSVAEWVALARALGR------------------------------------
RSMA_ZYMMO      VSVAEFIAIGRHWEKLSA---------------------------------
RSMA_MAGSA      IPVEGFCALARALDARTLDGHQSA---------------------------
RSMA_RHORT      IPVEGFAALARAVDAAGSV--------------------------------
RSMA_GLUOX      LSVAEFARLAELNLASR----------------------------------
RSMA_CAUVC      IDLAGFLDLARATLGGADQ--------------------------------
RSMA_PHEZH      VPVAGFLALADAWLARREAPATAAPRGR-----------------------
RSMA_MARMM      IDITGFQSLARAWRAAYDAGRA-----------------------------
RSMA_ANAMF      LSVEQLCAVSNFLQSRQYQFSTG----------------------------
RSMA_ANAMM      LSVEQLCAVSNFLQSRQYQFSTG----------------------------
RSMA_ANAPZ      LTIEQLCSLTNALKARNINII------------------------------
RSMA_EHRCJ      LSIEQFCKIANSI--------------------------------------
RSMA_EHRCR      LSIEQFCQITNCIN-------------------------------------
RSMA_EHRRG      LSIKQFCDIANCI--------------------------------------
RSMA_EHRRW      LSIKQFCDIANCI--------------------------------------
RSMA_WOLPM      LTIEQFCLLANNVECLLCNKMY-----------------------------
RSMA_WOLWR      LTIEQFCLLANNVECLFCKSPIAI---------------------------
RSMA_WOLTR      LTVEQFCLLANNM--------------------------------------
RSMA_WOLPP      LTIEQFCLLANNIIMR-----------------------------------
RSMA_NEOSM      LNPEQLCRLSCIAEMD-----------------------------------
RSMA_RICPU      LAPQDYLRIAEIL--------------------------------------
RSMA_RICRS      LAPQDYLRIAEIL--------------------------------------
RSMA_RICAE      LAPQDYLRIAEIL--------------------------------------
RSMA_RICFE      ---------------------------------------------------
RSMA_RICAH      LAPQDYLRIAMSLSVNKL---------------------------------
RSMA_RICCK      LTPQDYLMIAACEMS------------------------------------
RSMA_RICPR      LTPKDYLRIAMKL--------------------------------------
RSMA_RICTY      LTPKDYLRIAMQL--------------------------------------
RSMA_RICB8      LTPNDYLSLASLI--------------------------------------
RSMA_RICBR      LTPNDYLSLASLI--------------------------------------
RSMA_PELUB      LEPDVYFKLVKEYEDLRG---------------------------------
RSMA_PERMH      LSVDDFIRLFSEHLLYKHDGKNENS--------------------------
RSMA_SULSY      LSVEDFIRIFG---VVENDDR------------------------------
RSMA_AQUAE      LSLEDFFKLYR---LIEDSGE------------------------------
RSMA_HYDS0      LSLEDIKYIYNTLSCFNKNIFTSTPAL------------------------
RSMA_DESVH      LSPERFIALGEAVAMSAIA--------------------------------
RSMA_DESVV      LSPERFIALGEAVAMSAIA--------------------------------
RSMA_DESAG      LSPNQFQQLANLLESQLVS--------------------------------
RSMA_DESAD      LSPLQFQSLYKSVKNDFPS--------------------------------
RSMA_LAWIP      LSNQLFQQLSQEFLLQLIDFPKKT---------------------------
RSMA_HALMA      LTPADFATLATLAYEVGQPEA------------------------------
RSMA_NATPD      VPPEAFARLAAIAAEVDG---------------------------------
RSMA_HALWD      LTPSEFAELATIAAEKGK---------------------------------
RSMA_HALSA      LSPATFAALANVAWGVETAPGPDPQ--------------------------
RSMA_HALS3      LSPATFAALANVAWGVETAPGPDPQ--------------------------
RSMA_METHJ      LYLEDFATISNQLSS------------------------------------
RSMA_METAC      LTPEELASVANMLFDLKSR--------------------------------
RSMA_METMA      LTPEELASVANMIFDLKSRNF------------------------------
RSMA_METBF      LTPEELAQVANHIIDLKTSILANELNE------------------------
RSMA_METBU      LEPHELAEIANFIFKMRSTS-------------------------------
RSMA_ARCFU      LGARKFAEIVVGE--------------------------------------
RSMA_METTH      LRPEDILEIAEHIEDLSGSS-------------------------------
RSMA_METST      LTPTQIKEISLILEGNL----------------------------------
RSMA_PYRAB      LTPEEVKEIEEYLREHRIIS-------------------------------
RSMA_PYRHO      LYPEEVKDIEEYLKKHGIIS-------------------------------
RSMA_PYRFU      LTPEEVKEIEEFLKIQGIIN-------------------------------
RSMA_THEKO      LSPEDVLEIEEFLKKEGVIESYPASP-------------------------
RSMA_THEGJ      LSPEEVLDIEVYLRDNGLLSQKPEKGLN-----------------------
RSMA_THEON      LSPEEVKEIEAYLKVNNII--------------------------------
RSMA_THESM      LSIEDIKDIEEFLRNESLID-------------------------------
RSMA_METKA      LPPERVAELAAAIESALG---------------------------------
RSMA_METM6      TPPEKIGHLSNLLYDEL----------------------------------
RSMA_METM7      TPPEKIGYLSNLLYDEI----------------------------------
RSMA_METMP      TPPEKIGDLSNLLYDEIANLE------------------------------
RSMA_METM5      TSPEKIGYLSNLLYDEI----------------------------------
RSMA_METVS      LAPEKIGELSNILYLNIISKK------------------------------
RSMA_META3      LSLKEIGVLCNNLYKIINKSK------------------------------
RSMA_METJA      LSVKDIVNLSNEFYRFLQNRGRL----------------------------
RSMA_PYRAE      LTLEELVELFKRHKA------------------------------------
RSMA_PYRIL      LTLEEIVELYKKHFDTTETCRS-----------------------------
RSMA_RUBXD      LSPEDFVALYRRISP------------------------------------
RSMA_NATTJ      LTVDEFAQIFKIIYNRIKYS-------------------------------
RSMA_RHOBA      LNLEQISDLVEALRQAELANE------------------------------
RSMA_PAEAT      LDINAYVKIAEARHPVDA---------------------------------
RSMA_ARTS2      IDIAAFARIAEARQDRQA---------------------------------
RSMA_STRAW      LTVEEFARIAENRGADHADDANN----------------------------
RSMA_STRCO      LTVEEFARIAEHKV-------------------------------------
RSMA_STRGG      LTVEEFAAIAEHKPEVSSL--------------------------------
RSMA_THEFY      LGIADFARIAEHRP-------------------------------------
RSMA_KINRD      LGVADFARIAAHRPGGARAAGEPAGTP------------------------
RSMA_LEIXX      LTLADFVRLAAR---------------------------------------
RSMA_CUTAK      LDIGDLARVVEALAQAGALSDSGQV--------------------------
RSMA_CORGL      LDVTDYVRLAGVLQQKDEK--------------------------------
RSMA_CORGB      LDVTDYVRLAGVLQQKDEK--------------------------------
RSMA_COREF      LDVADYVRLAGVIGS------------------------------------
RSMA_CORDI      LDIADFVRLARVTAAQEQA--------------------------------
RSMA_CORJK      LSTEQFVQLAATSLRSVR---------------------------------
RSMA_MYCA1      LSIDDFVRLLQRSADRG------GSDREGTSPPTAGQGAPAC---------
RSMA_MYCPA      LSIDDFVRLLQRSADRG------GTDREGTSPPTAGQGAPAR---------
RSMA_MYCLE      LSIDDFVRLLRRSDGR---------DDAAVRSASAS---------------
RSMA_MYCLB      LSIDDFVRLLRRSDGR---------DDAAVRSASAS---------------
RSMA_MYCTU      LSIDDFVRLLRRSGGSDE---ATSTGRDARAPDISGHASAS----------
RSMA_MYCTA      LSIDDFVRLLRRSGGSDE---ATSTGRDARAPDISGHASAS----------
RSMA_MYCBT      LSIDDFVRLLRRSGGSDE---ATSTGRDARAPDISGHASAS----------
RSMA_MYCBO      LSIDDFVRLLRRSGGSDE---ATSTGRDARAPDISGHASAS----------
RSMA_MYCBP      LSIDDFVRLLRRSGGSDE---ATSTGRDARAPDISGHASAS----------
RSMA_MYCGI      LSINDFVRLLQRSADWHTVPKADDAGDDADAQAKADGAQVSTL--------
RSMA_MYCVP      LSINDFVRLLQRSADWHVVPKPESA---ATAVATDEDAQVPTL--------
RSMA_MYCSJ      LAIADFVRLLQRSGE------------------AEEQVRVQ----------
RSMA_MYCSS      LAIADFVRLLQRSGE------------------AEEQVRVQ----------
RSMA_MYCSK      LAIADFVRLLQRSGE------------------AEEQVRVQ----------
RSMA_RHOOB      LDAAAFVRLAATHP-------------------------------------
RSMA_RHOJR      LDAAAFVRLAATQP-------------------------------------
RSMA_RHOE4      LDAAAFVRLAGGE--------------------------------------
RSMA_NOCFA      LDTAAYVRLAAQA--------------------------------------
RSMA_BIFLD      LTIAEFTALAKAIESCGDGDEAQ----------------------------
RSMA_BIFLS      LTIAEFTALAKAIESCGDGDEAQ----------------------------
RSMA_BIFLO      LTIAEFTALAKAIESCGDGDEAQ----------------------------
RSMA_BIFAA      LTIDEFVALARALDEVFAS--------------------------------
RSMA_ACIC1      LTLADFIRLAQAPPTR-----------------------------------
RSMA_OPITP      IPTELWRALQVRES-------------------------------------
RSMA_DEIGD      VPLEDLRVLARRLGVLR----------------------------------
RSMA_DEIRA      VPLSGLRAVAAALGVVR----------------------------------
RSMA_THET2      LDLEAFRRLREGLEGAV----------------------------------
RSMA_THET8      LDLEAFRRLREGLEGAV----------------------------------
RSMA_CHLTR      IFLEEYLKIFHLLKDI-----------------------------------
RSMA_CHLTA      IFLEEYLKIFHLLKDI-----------------------------------
RSMA_CHLT2      IFLEEYLKIFHLLKDI-----------------------------------
RSMA_CHLTB      IFLEEYLKIFHLLKDI-----------------------------------
RSMA_CHLMU      ISLEEYLKIFRLLKDF-----------------------------------
RSMA_CHLCV      LSLNEYLQLFHLLSSNA----------------------------------
RSMA_CHLFF      LSLDEYLKLFQLLSLNS----------------------------------
RSMA_CHLAB      LSLDDYLKLFYLLSLPA----------------------------------
RSMA_CHLPN      LSLNDYLALFHKMQAG-----------------------------------
RSMA_PARUW      LSLEDFIKLYHELYSSERH--------------------------------
RSMA_ALKMQ      LTIEEYATLTKEVAARQ----------------------------------
RSMA_ALKOO      LTIEEYGVLANNLAKKL----------------------------------
RSMA_CLOD6      LSIEEFSVLSNIINTKVSSK-------------------------------
RSMA_LACP7      LTLEQFAKLADIIDEKMK---------------------------------
RSMA_CLOPE      LSLAEFGALSDAIDKYMNN--------------------------------
RSMA_CLOP1      LSLAEFGALSDAIDKYMNN--------------------------------
RSMA_CLOPS      LSLAEFGALSDAIDKYMNN--------------------------------
RSMA_CLOAB      LSIEEFGKLSDEIYR------------------------------------
RSMA_CLOB6      LSIEEFGKLSDCIYDIL----------------------------------
RSMA_CLOBJ      LSIEEFGKLSDCIYDIL----------------------------------
RSMA_CLOB1      LSIEEFGKLSDCIYDIL----------------------------------
RSMA_CLOBL      LSIEEFGKLSDCIYDIL----------------------------------
RSMA_CLOBK      LSIEEFGKLSDCIYDIL----------------------------------
RSMA_CLOBM      LSIEEFGKLSDCIYDIL----------------------------------
RSMA_HALOH      LTIKQMAILSNTLWYKISEEDGENHEIY-----------------------
RSMA_MOOTA      LGMEEFASISRTLQH------------------------------------
RSMA_PELTS      LSLSEFASIADSFLDAGGQ--------------------------------
RSMA_SYMTH      LSLEEFAAVARTLWQRT----------------------------------
RSMA_CALS4      LSIDQFANLANALYLLIKE--------------------------------
RSMA_DEHMB      LSMEEWKKLCLEYAGNPC---------------------------------
RSMA_DEHMC      LSMEEWKKLCLEYAGNPC---------------------------------
RSMA_DEHM1      LSMEEWKMLCLVYTENPC---------------------------------
RSMA_DESHD      LSIDEFQAVTEAVMKNLD---------------------------------
RSMA_DESHY      LSIDEFQAVTEAVMKNLD---------------------------------
RSMA_GEOKA      LDIAEFASLSNALAPLFGK--------------------------------
RSMA_GEOTN      LDMAEFASLSNALMPLFRV--------------------------------
RSMA_GEOSW      LTMEEFAALSNALQHVL----------------------------------
RSMA_ANOFW      LAIAEFATLSEQLYPIFYEEA------------------------------
RSMA_BACLD      LSIEEFAVLSDRLREVLL---------------------------------
RSMA_BACSU      LSIEEFAALSNGLYKALF---------------------------------
RSMA_BACP2      LSIEEFARLSNVLQKALF---------------------------------
RSMA_BACAN      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACAA      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACHK      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACCZ      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACAC      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACC7      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACC0      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACC1      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACCQ      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACCR      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACC4      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACC2      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACC3      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACAH      LSIEEFATLSNALVLHKLS--------------------------------
RSMA_BACMK      LSIEEFATLSNALILHKLS--------------------------------
RSMA_BACCN      LSIEEFAMLSNALVPHKMK--------------------------------
RSMA_BACHD      LTIEEFANLSEQLQKR-----------------------------------
RSMA_LYSSC      LTIQEFGKLADALYPVFAK--------------------------------
RSMA_BACSK      LSPQEFARLSDALYSTLRKAD------------------------------
RSMA_OCEIH      LTMEEFAQVANTFYQYQSK--------------------------------
RSMA_LISMC      LDIPEFAKLSNFLGDFLKEK-------------------------------
RSMA_LISMF      LDIPEFAKLSNFLGDFLKEK-------------------------------
RSMA_LISMO      LDIPEFAKLSNFLGDFLKEK-------------------------------
RSMA_LISMH      LDIPEFAKLSNFLGDFLKEK-------------------------------
RSMA_LISIN      LDIPEFAKLSNFLADFLAEK-------------------------------
RSMA_LISW6      LDIPEFAKLSNFLADFLEEK-------------------------------
RSMA_STAAT      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAA3      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAC      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAA2      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAA9      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAS      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAA1      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAM      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAW      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAN      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAA8      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAB      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAE      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAAR      LSIQDFAKLYEEKKKFPQLEN------------------------------
RSMA_STAES      LTIQDFATLYEQKKKFSELTN------------------------------
RSMA_STAEQ      LTIQDFATLYEQKKKFSELTN------------------------------
RSMA_STAHJ      LSIQDFARLYEEKKNFPELEN------------------------------
RSMA_STACT      LSIKEFANLFNNLKKFPELEF------------------------------
RSMA_STAS1      LSIKEFANLYNELQNFTELEF------------------------------
RSMA_MACCJ      LNLNDYAQLSNNMKKYPELVI------------------------------
RSMA_STRA1      LSIPDFASLADALKEVEI---------------------------------
RSMA_STRA5      LSIPDFASLADALKEVGI---------------------------------
RSMA_STRA3      LSIPDFASLADALKEVGI---------------------------------
RSMA_STRMU      LTITDFARLADALREVDLK--------------------------------
RSMA_STRS7      LSIQDFGRLADALKQVGL---------------------------------
RSMA_STREM      LSIQDFGRLADALKQVGL---------------------------------
RSMA_STRE4      LSIQDFGRLADALKQVGF---------------------------------
RSMA_STRPB      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRPC      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRP1      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRPF      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRPD      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRPM      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRP8      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRPG      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRP6      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRP3      LSIQDFGKLADALKEVGL---------------------------------
RSMA_STRU0      LTIPQYGKLADALKEVGF---------------------------------
RSMA_STRT2      LSISDFARLSDALREAGL---------------------------------
RSMA_STRTD      LSISDFARLSDALREAGL---------------------------------
RSMA_STRT1      LSISDFARLSDALREAGL---------------------------------
RSMA_STRGC      LDLVAFARLSDALKSEGL---------------------------------
RSMA_STRSV      LSLEEFACLADALKSEGL---------------------------------
RSMA_STRPN      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRZT      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRPJ      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRP7      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRZJ      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRPI      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRP4      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRR6      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRP2      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRPS      LSLAEFAGLADALKGQGL---------------------------------
RSMA_STRZP      LSLEEFASLADALKGQGL---------------------------------
RSMA_LACLA      LSIEEFAKLADALLPLKK---------------------------------
RSMA_ENTFA      LSLEEFARLSNALEKNKPV--------------------------------
RSMA_LACSS      LSIQQFAQLSDCLNEQPVFAKKRG---------------------------
RSMA_LACPL      LTVDEFITLTDALHQADLL--------------------------------
RSMA_LACS1      LTVADFINLSDALVKMGIN--------------------------------
RSMA_LACBA      LTLLNFIELTNAFHNEGLM--------------------------------
RSMA_PEDPA      LTVLDFIKLHNRIQIEGLKRK------------------------------
RSMA_LACRD      LTLEQFIELANALHQQNLL--------------------------------
RSMA_LACRJ      LTLEQFIELANALHQQNLL--------------------------------
RSMA_LEUCK      LSLNQLTALYEALKLQGLIK-------------------------------
RSMA_LEUMM      LNLEQFTQLYLALRDQNLTQ-------------------------------
RSMA_OENOB      LTLENYEQLVNNLSENMIFSKE-----------------------------
RSMA_LACAC      LTIDQFIEIARNIPAK-----------------------------------
RSMA_LACH4      LTIEQFIEIARNIPAK-----------------------------------
RSMA_LACJO      LTLNQFVQLAHLLKDRQA---------------------------------
RSMA_LACDA      LAISDFIRISQAIAEMNK---------------------------------
RSMA_LACDB      LAISDFIRISQAIAEMNK---------------------------------
RSMA_CARHZ      IPPESFYRLSQEVVGGKW---------------------------------
RSMA_ACIF2      LDQAAFFRLAEATVEQGNRS-------------------------------
RSMA_ACIF5      LDQAAFFRLAEATVEQGNRS-------------------------------
RSMA_HALHL      LSVEAFVRLADAARSAPAAAAGR----------------------------
RSMA_ACISJ      VPVSEYVALAQECS-------------------------------------
RSMA_ACIET      VPVSEYVALAQKCS-------------------------------------
RSMA_ACIAC      VPVADYVALAQACA-------------------------------------
RSMA_POLSJ      VPVAEYVALAQQVAAMAV---------------------------------
RSMA_POLNA      VPVAEYLALAQQVQTGTAQPEKIELL-------------------------
RSMA_RHOFT      VPVAEYLALALKLATHSQAASH-----------------------------
RSMA_VARPS      VPVAEYVALAQAVPPRP----------------------------------
RSMA_VEREI      VPVQEYLDLAREAHRWIADGKDPPCAGA-----------------------
RSMA_LEPCP      VPVAEFVALTMAIQQTPSNSPLTAGATPDAA--------------------
RSMA_METPP      VPVADYLALALALTPGER---------------------------------
RSMA_BURCM      VSVAEYVGVAQALAARRKAAE------------------------------
RSMA_BURA4      VSVAEYVGVAQALAAVRR---------------------------------
RSMA_BURCA      VSVAEYVGVAQALAALRKAG-------------------------------
RSMA_BURCH      VSVAEYVGVAQALAALRKAG-------------------------------
RSMA_BURCC      VSVAEYVGVAQALAALRKAG-------------------------------
RSMA_BURCJ      VSVAEYVGVAQALAAVRKAG-------------------------------
RSMA_BURL3      VSVAEYVGVAQALAAVRKAG-------------------------------
RSMA_BURM1      VSVAEYVGVAQALAATRNAQ-------------------------------
RSMA_BURVG      VSVAEYVGVAQALARTRNVAQ------------------------------
RSMA_BURMA      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURPS      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURM9      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURM7      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURMS      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURP1      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURP0      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURP6      IGVDEYVRVAQAVASARASG-------------------------------
RSMA_BURTA      VGVDEYVRVAQAACAARAGR-------------------------------
RSMA_PARPJ      VPVDEYVRVAQIVAAKA----------------------------------
RSMA_PARXL      VPVAEYVRVAQIVAASKA---------------------------------
RSMA_PARP8      VPVAEYVAVAQAVSAAAGT--------------------------------
RSMA_CUPTR      VPVGEYVELARRLGDKASGQAA-----------------------------
RSMA_CUPNH      VPVGEYVELARRLGGTPSGRAGQAA--------------------------
RSMA_CUPPJ      VPVGEYVELARRLGGDASDRSAA----------------------------
RSMA_CUPMC      VPVAEYVELARIVGGAEPPARVA----------------------------
RSMA_RALSO      VPVADFVAVANALPAERIAGGAPDLNED-----------------------
RSMA_BURSP      VPVGEYLKLAQHIEQNAHPNPKP----------------------------
RSMA_BORBR      VGVAQFIGLADALLAAGAPGLARP---------------------------
RSMA_BORPE      VGVAQFIGLADALLAAGAPGLARP---------------------------
RSMA_BORPA      VGVAQFIGLADALLAAGAPGLARP---------------------------
RSMA_BORA1      VGVAQFIRLTDALLAAGVIKA------------------------------
RSMA_BORPD      ISVEKFIRLTDALLQAGAVPA------------------------------
RSMA_HERAR      ISLAQYVALANRL--------------------------------------
RSMA_JANMA      IPLAQYVALANRL--------------------------------------
RSMA_AROAE      LTVADYVAITNYIAAKSPRALANA---------------------------
RSMA_THIDA      LHVADYEAITAYLATR-----------------------------------
RSMA_METFK      IAPAGFVAIANYLAA------------------------------------
RSMA_CHRVO      LPVEDFVRLANHLHDKGARG-------------------------------
RSMA_LARHH      LTLREFVLLSNRHGEKGRQ--------------------------------
RSMA_NEIG1      IAPEKYVALSNYLADKAV---------------------------------
RSMA_NEIG2      IAPEKYVALSNYLADKAV---------------------------------
RSMA_NEIMA      IAPEKYVALSNYLAGKAV---------------------------------
RSMA_NEIM0      IAPEKYVALSNYLAGKAV---------------------------------
RSMA_NEIMB      IAPEKYVALSNYLAGKVV---------------------------------
RSMA_NEIMF      IAPEKYVALSNYLAGKAV---------------------------------
RSMA_DECAR      VSVEDYVRIANYLS-------------------------------------
RSMA_NITEU      LSLAQYAAIVRQVYEDRQ---------------------------------
RSMA_NITEC      LSLEQYSAITRHIHKIR----------------------------------
RSMA_NITMU      LSITQYVAITNYFNRVRSG--------------------------------
RSMA_PSYA2      LNVKDFVNLSNQARTIPV---------------------------------
RSMA_PSYCK      LSVKDFVNLSNQARKVEG---------------------------------
RSMA_ACIAD      LTLAQFVALSDQMVP------------------------------------
RSMA_COXBU      LTVEDFVKISNILN-------------------------------------
RSMA_COXB2      LTVEDFVKISNILN-------------------------------------
RSMA_COXBR      LTVEDFVKISNILN-------------------------------------
RSMA_COXBN      LTVEDFVKISNILN-------------------------------------
RSMA_COXB1      LTVEDFVKISNILN-------------------------------------
RSMA_ALCBS      LSVADYVALANISRPPADVEDANAPHTEQGKGDNSQ---------------
RSMA_HAHCH      LGLPEFVRIADYVYDHPLENES-----------------------------
RSMA_MARHV      LGLADYVRIADLLADTGKLQADDNEVSDD----------------------
RSMA_MARMS      LDVEDFVRIANYVIKKEG---------------------------------
RSMA_PSEF5      LDLAAFVRLADQLADQPKPATD-----------------------------
RSMA_PSEPF      LDLAAFVRLADKLAEQPAKAPEAD---------------------------
RSMA_PSE14      LDLAAFVRLADTLSEKVVTE-------------------------------
RSMA_PSESM      LDLAAFVRLADTLSEKVLTE-------------------------------
RSMA_PSEU2      LDLAAFVRLADTLSEKVVTE-------------------------------
RSMA_PSEPK      LDLAAFVRLADQLADQQQA--------------------------------
RSMA_PSEAE      LDLAAFVRLANQLAELPGNR-------------------------------
RSMA_CHRSD      LSVEELVRIANHVAETAP---------------------------------
RSMA_SACD2      LSLEEYVNLSNTLWP------------------------------------
RSMA_METCA      LSLADYVGLSRQLNP------------------------------------
RSMA_LEGPC      ISVAEYVQLAKFISN------------------------------------
RSMA_LEGPA      ISVAEYVQLAKFISN------------------------------------
RSMA_LEGPL      ISVAEYVQLAKFISN------------------------------------
RSMA_LEGPH      ISVAEYVQLAKFISN------------------------------------
RSMA_NITOC      ISLEDYLALTRYWLKAQ----------------------------------
RSMA_HYDCU      VPVEAFVLLSNLYHKDKA---------------------------------
RSMA_XANAC      LEVADFIRLANVELA------------------------------------
RSMA_XANC5      LEVADFIRLANVELA------------------------------------
RSMA_XANOR      LEVADFIRLANVEPA------------------------------------
RSMA_XANOM      LEVADFIRLANVEPA------------------------------------
RSMA_XANOP      LEVADFIRLANVEPA------------------------------------
RSMA_XANCP      LEVADFIRLANVELA------------------------------------
RSMA_XANC8      LEVADFIRLANVELA------------------------------------
RSMA_XANCB      LEVADFIRLANVELA------------------------------------
RSMA_XYLFA      LEVTEFIALANAKDT------------------------------------
RSMA_XYLFT      LEVTEFIALANAKNT------------------------------------
RSMA_DICNV      IDGASFARLANALYLKEKNL-------------------------------
RSMA_ACTP2      LSIADYARLANWLYDNPPAVDNQEEIIDEDI--------------------
RSMA_ACTP7      LSIADYARLANWLYDNPPAVDNQKEIIDEDI--------------------
RSMA_ACTPJ      LSIADYARLANWLYDNPPAVDNQEEIIDEDI--------------------
RSMA_HAEDU      LTISDYARLANWLCDNPPAIDTNQEILYDEL--------------------
RSMA_HAEIE      LAIADYARLANWLADNPPADINKDEILDSEE--------------------
RSMA_HAEIG      LAIADYARLANWLADNPPADINKDEILDSEE--------------------
RSMA_HAEIN      LAIADYARLANWLADNPPADVNKDEILDSEE--------------------
RSMA_HAEI8      LAIADYARLANWLADNPPADVNNDEILDSEE--------------------
RSMA_PASMU      LSIADYARLANWLTDNPPADVNKDEMIEHLDD-------------------
RSMA_MANSM      LSIADYARLANWLADNPPADVRRDEIIEENEE-------------------
RSMA_HAES1      LSIADYARLANYLADNPPTEDLQSE--------------------------
RSMA_HISS2      LSIADYARLANYLADNPPTEDLQSE--------------------------
RSMA_PSYIN      ISVEEYVNIANYVFDLK---ENK----------------------------
RSMA_AERHH      LSLEQFVMIANWLADQQQA--------------------------------
RSMA_TOLAT      LTLAQFVSIANWLTTHR----------------------------------
RSMA_ALIF1      LTLEQFVNMANWLDANHSAE-------------------------------
RSMA_ALIFM      LTLEQFVNMANWLDANHSAE-------------------------------
RSMA_ALISL      LTLEQFVIMANWLNDNYQAESTESA--------------------------
RSMA_VIBA3      LTLEQFVDMANWLHDSHNADK------------------------------
RSMA_VIBCH      LTLAQFVALANWLDATHKTHA------------------------------
RSMA_VIBC3      LTLAQFVALANWLDATHKTHA------------------------------
RSMA_VIBCB      LTLQQFVAMANWLADNPQH--------------------------------
RSMA_VIBPA      LTLQQFVAMANWLADNPQH--------------------------------
RSMA_VIBVU      LTLQQFVAMANWLDANHK---------------------------------
RSMA_VIBVY      LTLQQFVAMANWLDANHK---------------------------------
RSMA_PHOPR      ITLQQFVKMANWLDANHQNA-------------------------------
RSMA_SHEB5      ISVQQYVAMANMVCDKKA---------------------------------
RSMA_SHEB2      ISVQQYVAMANMVCDKKA---------------------------------
RSMA_SHEB8      ISVQQYVAMANMVCDKKA---------------------------------
RSMA_SHEB9      ISVQQYVAMANMVCDKKA---------------------------------
RSMA_SHEPC      ISVEQYVAMANMICDRKA---------------------------------
RSMA_SHESW      ISVEQYVAMANMICDRKA---------------------------------
RSMA_SHESM      ISVEQYVAMANMVCDKQA---------------------------------
RSMA_SHESR      ISVEQYVAMANMVCDKQA---------------------------------
RSMA_SHESA      ISVEQYVAMANMVCDKQA---------------------------------
RSMA_SHEON      ISVEQYVAMANMVCDKQA---------------------------------
RSMA_SHEDO      ISVEQYVALANLLCDKQ----------------------------------
RSMA_SHEFN      ISVPQYVAMANMLCDKKD---------------------------------
RSMA_SHEHH      IRVDQYVAMANHVFDKK----------------------------------
RSMA_SHEPA      ISVEQYVAMANHVFDRK----------------------------------
RSMA_SHEPW      ISVQQYVAMANLFIDKQTKS-------------------------------
RSMA_SHESH      ITVQQYVAMANLVIDKK----------------------------------
RSMA_SHEWM      ITVEQYVAMANFVVDKQ----------------------------------
RSMA_SHELP      ITVQQYVAMANHLVDKRQA--------------------------------
RSMA_SHEAM      ISVAQYVAMANYLCEKR----------------------------------
RSMA_PSET1      LSLQQFIDIANWIYDNKQ---------------------------------
RSMA_COLP3      LSLDEYKKLADFIVDNPPEAAPVKEKRRMAKNKMTEPANNNLNENSAPEVD
RSMA_IDILO      LSVDDYCRISDWLTEHSLTKQAEKNDSQ-----------------------
RSMA_SALA4      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALDC      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALEP      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALG2      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALHS      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALPA      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALPK      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALPB      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALPC      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALTI      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALTY      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALAR      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALNS      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALCH      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_SALSV      ISVAQYCQMANYLSENAPLKES-----------------------------
RSMA_CITK8      ISVAQYCQMANYLSENAPSKES-----------------------------
RSMA_KLEP3      ISVEQYCKMANWLSNNLPSKES-----------------------------
RSMA_KLEP7      ISVAQYCLMANWLSDNLPTKES-----------------------------
RSMA_ECOUT      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECO27      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOK1      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECO45      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOL6      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOL5      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECO81      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECO55      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOLC      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOHS      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_SHIBS      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOBW      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECODH      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOLI      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOSM      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECO7I      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECO8A      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_SHIF8      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_SHISS      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_SHIB3      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOSE      ISVAQYCQMANYLAENATLQES-----------------------------
RSMA_ECO57      ISVAQYCQMANYLAENAPFQES-----------------------------
RSMA_ECO5E      ISVAQYCQMANYLAENAPFQES-----------------------------
RSMA_SHIFL      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ESCF3      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_SHIDS      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECO24      ISVAQYCQMANYLAENAPLQES-----------------------------
RSMA_ECOLU      ISVAQYCQMANYLAENALLQES-----------------------------
RSMA_CROS8      ISVAQYCQMANYLADNPPSKES-----------------------------
RSMA_ENT38      ISVEQYCKLANYISDNAPPKES-----------------------------
RSMA_PECAS      VTVEQYCRLANWLSEHPAKQE------------------------------
RSMA_PECCP      VSVEQYCRLANWLSEHPAKQE------------------------------
RSMA_YERPE      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERPP      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERPN      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERPG      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERPA      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERPS      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERPB      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERP3      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERPY      ISVAQYCKLANWLSAQSTPQK------------------------------
RSMA_YERE8      ISVAQYCKLANWLSAQSTPQE------------------------------
RSMA_SERP5      ISVAQYCKLANWLSANPAPQQ------------------------------
RSMA_PHOLL      ISVEQYCKMANWLSEQPEMQS------------------------------
RSMA_ERWT9      ITVAQYCQLANWLTAHPQPQEN-----------------------------
RSMA_SODGM      VSVELYCRLANVLAERTVSQD------------------------------
RSMA_PROMH      ISVEQYCKVANWLSSQQQHAE------------------------------
RSMA_HAMD5      VSVEQYCLLANRLH-------------------------------------
RSMA_BAUCH      LSVEQYCCLASTLAECLPKK-------------------------------
RSMA_BLOFL      LTIQQFCKLTTILHHKYNLN-------------------------------
RSMA_BLOPB      ITINQYCTLANMLNNK-----------------------------------
RSMA_BUCAI      VSVSHYCKLANYLYKKSNNLLKIN---------------------------
RSMA_BUCAP      LSILQYCQLSNYIIE--NDILKNKNFN------------------------
RSMA_BUCBP      LSVKQYCLLSNHVC-------------------------------------
RSMA_WIGBR      LSIENYCNLSNNMIIKK----------------------------------
RSMA_FRATF      LSVGDFVSLANFLS-------------------------------------
RSMA_FRATH      LSVGDFVSLANFLS-------------------------------------
RSMA_FRATO      LSVGDFVSLANFLS-------------------------------------
RSMA_FRATM      LSVGDFVSLANFLS-------------------------------------
RSMA_FRATW      LSVGDFVSLANFLS-------------------------------------
RSMA_FRATT      LSVGDFVSLANFLS-------------------------------------
RSMA_FRAT1      LSVGDFVSLANFLS-------------------------------------
RSMA_FRATN      LSVGDFVSLANFLS-------------------------------------
RSMA_FRAP2      LSMEDFVSLVNFLK-------------------------------------
RSMA_BACFR      LSVQEFIHLTNQVEQALKVPIEPVSQIENP---------------------
RSMA_BACFN      LSVQEFIHLTNQVEQALKVPIEPVSQIENP---------------------
RSMA_BACTN      LSVEEFISLTNQVEEALKTATASGN--------------------------
RSMA_BACV8      LSVQEFIELTNQVEAALKNKTDIVYSNDIARKGTNKKE-------------
RSMA_PARD8      LSMEQFVELTLISQKHLEKQAGDVL--------------------------
RSMA_PORGI      LSPDDFIALTLLLQQ------------------------------------
RSMA_PORG3      LSPDDFIALTLLLQQ------------------------------------
RSMA_FLAJ1      LSVEEFIVLTQKIEADGVQS-------------------------------
RSMA_FLAPJ      LDVQQFIELTKKIEADGI---------------------------------
RSMA_CYTH3      LSVQEFFDLTNMLSGK-----------------------------------
RSMA_CHLP8      LTVEGLIELFEKLTPIDHALNDPETRNGIE---------------------
RSMA_CHLTE      LSVPALITLFTQLKLIARGDASGQLLLKRRR--------------------
RSMA_CHLPB      LSVEQFLTLFKELRPLPD---------------------------------
RSMA_PROA2      FTITEFEMLFSRIRPLQ----------------------------------
RSMA_CHLL2      LAIQELFELFKEMKPKMLS--------------------------------
RSMA_CHLPD      LSIDEFFRLFEQIRPLMVSSADPES--------------------------
RSMA_PELLD      LSIEKLADLFKLVQPLPAGEPPMKRDGRR----------------------
RSMA_CHLCH      LSIEELLELFSLIKTKSE---------------------------------
RSMA_SALRD      LTPDEFATLARHLDAHADPVPDA----------------------------
RSMA_ANAD2      LTLAEWAALERTLG-------------------------------------
RSMA_ANASK      LTLAEWAALERTLG-------------------------------------
RSMA_ANADE      LTLAEWAALDRALG-------------------------------------
RSMA_MYXXD      LTPEEFAAIERALGPLTPATSTPAE--------------------------
RSMA_GEOMG      LSLDEFAALSRAMMALGGK--------------------------------
RSMA_GEOSL      LSLQEFASLTKGLLAAGGSL-------------------------------
RSMA_PELCD      LSLEEFGKLAQLIQPHFV---------------------------------
RSMA_MAGMM      LTLAQFAQLANTPMPTSAP--------------------------------
RSMA_DESAH      LSVEEYSRLSDALWSMHGSEEV-----------------------------
RSMA_DESOH      LDVGDFLNICRHYKAMSGNISTKEA--------------------------
RSMA_DESPS      LSIQDFVRLTTVFEQEMNRTEE-----------------------------
RSMA_SYNAS      LSIQQFAALCNSLSYS-----------------------------------
RSMA_MYCCT      LDIDEYIKLFNLIYISNF---------------------------------
RSMA_MYCMS      LDIDEYIKLFNLVYTSNF---------------------------------
RSMA_MESFL      VGLEDFIRIYNKTR-------------------------------------
RSMA_FUSNN      ISIDKFIELIKIFEGR-----------------------------------
RSMA_AYWBP      VTLETFQKLTVKWFIFLNMS-------------------------------
RSMA_ONYPE      VTLETFQKLTVKWFIFFNIS-------------------------------
RSMA_PHYAS      ITLKEFQKISIQWFLFQNKTKESQLNNYILKKV------------------
RSMA_MYCH7      LDLVTYIRLADFYFNNIF---------------------------------
RSMA_MYCHJ      LDLVTYIRLADFYFNNIF---------------------------------
RSMA_MYCH2      LDLVTYIRLADFYFNNIF---------------------------------
RSMA_MYCMO      IDLNVYKILFYELN-------------------------------------
RSMA_MYCS5      LDVSQIVLLFTYLN-------------------------------------
RSMA_MYCPU      IKNEDFYALFLELR-------------------------------------
RSMA_MYCA5      LSLQEIMKLYEILVNSKSN--------------------------------
RSMA_KORVE      VALEKTAQLYNELRKG-----------------------------------
RSMA_ACIC5      LSLEALAALWRTLEDRS----------------------------------
RSMA_THEMA      LTVEEIVELYEKWRRALECSRG-----------------------------
RSMA_THESQ      LTVEEIVELYEKWRRALECSRG-----------------------------
RSMA_THEP1      LTVEEIVEFYEKWRRALECSKE-----------------------------
RSMA_THENN      LSIEEIIELYNIWRRALECSEE-----------------------------
RSMA_NOSS1      ISTQQWVKLANLLGVE-----------------------------------
RSMA_TRIV2      ISTQQWVELANLLGVE-----------------------------------
RSMA_NOSP7      ISVQQWVILANELAVASGEQGVGNR--------------------------
RSMA_CROS5      LDLNQWIALSNYFSQ------------------------------------
RSMA_RIPO1      LSLEQWIMFSNLLETVS----------------------------------
RSMA_SYNY3      LSLEQWLELTNLLPTFLPPT-------------------------------
RSMA_ACAM1      LSVTQWIALSDSVHPSQV---------------------------------
RSMA_SYNE7      LSIDQWIGLCTDLGDPTDSAINPTA--------------------------
RSMA_SYNP6      LSIDQWIGLCTDLGDPTDSAINPTA--------------------------
RSMA_SYNP2      VDLLQWIALSDRLNDYPKE--------------------------------
RSMA_THEEB      LSLEDWLALSEVLRQLQQN--------------------------------
RSMA_SYNJB      LDLPHWLALSDLLLEKAPKRAVVPQEEQEPG--------------------
RSMA_SYNJA      LDLPDWLALSDLLLEQTPRMAAVSGEGKPR---------------------
RSMA_GLOVI      LSVERFVQLSNRLAESDYPSGAARGDRRA----------------------
RSMA_PROMA      LAPMIWVQLARELERWDRSKKK-----------------------------
RSMA_PROM4      ISPMMWVSLAKRIHDMDKLVGEIQS--------------------------
RSMA_PROM3      LSPATWVELARGLNRADLVDPEP----------------------------
RSMA_PROMM      LSPATWVELARGLNRADLVDPEP----------------------------
RSMA_SYNS3      VAPEAWVALAKGLNQVDSVA-------------------------------
RSMA_SYNPW      VAPHAWVELARGLNQADSAASSL----------------------------
RSMA_SYNSC      LAPATWVALARGLNRGD----------------------------------
RSMA_SYNPX      LAPQVWVALARGLNQGIDAASADGHDHGDGSGQGESSPGGARDQI------
RSMA_SYNS9      VAAEAWVALARGLNQDV----------------------------------
RSMA_SYNR3      IAAQQWVALAAALQPAL----------------------------------
RSMA_PROM1      ISPSNWFGLAKALKETCVIENGTFQSK------------------------
RSMA_PROMT      ISPSNWFGLAKALKETCVIENGTFQSK------------------------
RSMA_PROM0      ISIDQWIKLAENCIKIKK---------------------------------
RSMA_PROM9      ISIHQWIKLAENCIKIKKKI-------------------------------
RSMA_PROMS      ISIEQWIKLAENCIKIKK---------------------------------
RSMA_PROM2      ISINQWIKLAENCIKIKK---------------------------------
RSMA_PROM5      ISINKWIKLAEGCIKITNKN-------------------------------
RSMA_PROMP      ISINKWIKLAEACIKITNKNQ------------------------------
RSMA_TREPA      LSIYDFITLSDTLRALL----------------------------------
RSMA_TREPS      LSIYDFITLSDTLRALL----------------------------------
RSMA_TREDE      LALYDFLLLSDIIGHL-----------------------------------
RSMA_BORAP      VEEFIQISNTLTAYH------------------------------------
RSMA_BORBP      VEEFIQISNNLNAYH------------------------------------
RSMA_BORBU      VEEFIQISNTLNAYH------------------------------------
RSMA_BORBZ      VEEFIQISNTLNAYH------------------------------------
RSMA_UREPA      IEPKMFLKL-FNYLNR-----------------------------------
RSMA_UREP2      IEPKMFLKL-FNYLNR-----------------------------------
RSMA_UREU1      IEPKMFLEL-FNYLNKSNNE-------------------------------
RSMA_MYCPE      IKEELYLKMCFDFYDL-----------------------------------
RSMA_MYCGE      LSPCQLFNLY----QNICNGKN-----------------------------
RSMA_MYCPN      LTPTQLFRLYLSLKPHLSDGKD-----------------------------
RSMA_MYCGA      LSPTQLFSLY----ESLSKLC------------------------------
RSMA_ARCB4      VSSSLYSQMYTKVK--NGRNK------------------------------
RSMA_SULDN      VSTNDYHQLYKLARSLDGTRERTEC--------------------------
RSMA_HELHP      VKTKSFHHILQFLKKRNDNGKQTLTRTTKQRPS------------------
RSMA_CAMC1      LDVDSYLKIFEITKEDNERQKRRESCN------------------------
RSMA_CAMC5      LNVELYLKIFENLKEDNERQKRRKSGSLAGQEQ------------------
RSMA_CAMHC      LNFTLFFKIFKNLRIRDERNK------------------------------
RSMA_CAMFF      LSVALYLKLFKEAE--NERRKQNPCG-------------------------
RSMA_CAMJE      ICVDLYLKIYDKLKDEYGRKQRDK---------------------------
RSMA_CAMJR      ICVDLYLKIYDKLKDEYGRKQRDK---------------------------
RSMA_HELPY      VRASEIKDYLKLLNYLLKG--------------------------------
RSMA_HELPH      VRASEIKDYLKLLNYLLKG--------------------------------
RSMA_HELPG      VRASEIKDYLKLLEYLLKG--------------------------------
RSMA_HELP2      VRASEVKDYLKLLEYLLKG--------------------------------
RSMA_HELPS      VRASEIKDYLKLLEYLLKG--------------------------------
RSMA_HELPJ      VRASEVKDYLKLLKSVLKG--------------------------------
RSMA_HELAH      VRASEIQDYLKLLKYLLKG--------------------------------
RSMA_BDEBA      LSPKQFVALYKHFGFE-----------------------------------