CLUSTAL format seed alignment for MF_00610

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CYF_BRARR       ------------MQTR--NTFSW--IREEITRSISVSLMI--YIITWASISSAYPIFAQQ
CYF_LOBMA       ------------MQTR--NTFSW--IREEITRSISVLLMI--YIITWASISSAYPIFAQQ
CYF_ARAHI       ------------MQTR--NTFSW--IREEITRSISVSLII--YIITWASISSAYPIFAQQ
CYF_DRANE       ------------MQTR--NTFSW--IREEITRSISVSLII--YIITRASISSAYPIFAQQ
CYF_ARATH       ------------MQTR--NTFSW--IREEITRSISVSLII--YIITWASISSAYPIFAQQ
CYF_CRUWA       ------------MQTR--NTFSW--IREEITRSISVSLMI--YIITWASISSAYPIFAQQ
CYF_CAPBU       ------------MQTR--NTFSW--IREEITRSISVSLMI--YIITWASISGAYPIFAQQ
CYF_OLIPU       ------------MQTR--NTLSW--IREEITRSISVSLMI--YIITWASISSAYPIFAQQ
CYF_LEPVR       ------------MQTR--NTFSW--IREEITRSISVSLMI--YIITWASISSAYPIFAQQ
CYF_NASOF       ------------MQTR--NTFSW--IREEITRSISVSLMI--YIITWASISSAYPIFAQQ
CYF_BARVE       ------------MQTR--NTFSW--IREEITRSISVSLMI--YIITWASISSAYPIFAQQ
CYF_AETCO       ------------MQTR--NTFSWTWIREEITRSISVSLMI--YIITWSSISNAYPIFAQQ
CYF_AETGR       ------------MQTR--NTFSWTWIREEITRSISVSLMI--YIITWSSISNAYPIFAQQ
CYF_CARPA       ------------MQTR--NTLSW--IKEEITRSISVSLMI--YIITWASISNAYPIFAQQ
CYF_GOSBA       ------------MQTR--NTFSW--IKEEITRSISVSLMI--YIITGASISNAYPIFAQQ
CYF_GOSHI       ------------MQTR--NTFSW--IKEEITRSISVSLMI--YIITGASISNAYPIFAQQ
CYF_CITSI       ------------MQIR--NTFSS--LKGEITRFISVSLMI--YIITRASISNAYPIFAQQ
CYF_POPAL       ------------MQTR--KTLSW--IKEEITRSISVSLMI--YIITGAYISNAYPIFAQQ
CYF_POPTR       ------------MQTR--KTLSW--IKEEITRSISVSLMI--YIITGAYISNAYPIFAQQ
CYF_MANES       ------------MQTR--KTFSW--IKEEITRSISVLLMI--YIITWASISNAYPIFAQQ
CYF_PELHO       ------------MQTR--KTLSW--IKEEITRSISLSLML--SIITHASLSNAYPIFAQQ
CYF_SOYBN       ------------MQTR--NAFSC--IKEGITRSISISIMI--YIIIRAPISNAYPIFAQQ
CYF_PHAVU       ------------MQTR--NAFSC--IKEGITRSISISVMI--YIIIRAPFSNAYPIFAQQ
CYF_LOTJA       ------------MQTR--NAFSY--IKEEITRSISVLLVI--YIIIRAPISNAYPIFAQQ
CYF_MORIN       ------------MQMR--NTFSW--IKEEIIRFIAVSLII--YIITRAPISNAYPIFAQQ
CYF_CUCSA       ------------MQTR--NTFSS--IKEEITRSISVSLMI--YIITWAPVSNAYPIFAQQ
CYF_OENEH       --------------MK--NTFSW--IKKEITRSISLSLMI--YIITRTSISNAYPIFAQQ
CYF_OENAR       --------------MK--NTFSW--IKKEITRSISLSLMI--YIITRTSISNAYPIFAQQ
CYF_OENBI       --------------MK--NTFSW--IKKEITRSISLSLMI--YIITRTSISNAYPIFAQQ
CYF_OENGL       --------------MK--NTFSW--IKKEITRSISLSLMI--YIITRTSISNAYPIFAQQ
CYF_OENPA       --------------MK--NTFSW--IKKEITRSISLSLMI--YIITRTSISNAYPIFAQQ
CYF_EUCGG       ------------MQTK--NTFSW--IKKEIIRSISVSLMI--YIIARTSISNAYPIFAQQ
CYF_DAUCA       ------------MQTR--KTFSW--IKEQINRSISVSLMI--YIITRPSISIAYPIFAQQ
CYF_PANGI       ------------MQTR--KTFSW--IKEQITRSISASLMI--YIITRTSISSAYPIFAQQ
CYF_VITVI       ------------MQTR--NTFSW--IKEQITRSISVSLMI--YIITRTSISNAYPIFAQQ
CYF_SOLBU       ------------MQTR--NAFSW--LKKQITRSISVSLMI--YILTRTSISSAYPIFAQQ
CYF_SOLLC       ------------MQTR--NAFSW--LKKQITRSISVSLMI--YILTRTSISSAYPIFAQQ
CYF_SOLTU       ------------MQTR--NAFSW--LKKQITRSISVSLMI--YILTRTSISSAYPIFAQQ
CYF_ATRBE       ------------MQTR--NAFSW--LKKQITRSISVSLMI--YILTRTSISSAYPIFAQQ
CYF_NICSY       ------------MQTR--NAFSW--LKKQITRSISVSLMI--YILTRTSISSAYPIFAQQ
CYF_TOBAC       ------------MQTR--NAFSW--LKKQITRSISVSLMI--YILTRTSISSAYPIFAQQ
CYF_NICTO       ------------MQTR--NAFSW--LKKQITRSISVSLMI--YILTRTSISSAYPIFAQQ
CYF_CUSEX       ------------MQTI--NTFSW--INQRITRSISVLLLV--YIITRTSISSAYPIFAQR
CYF_IPOPU       ------------MQTR--NTFSC--IKKQITRSISVSLML--YIITRTSIASAYPIFAQQ
CYF_JASNU       ------------MQTR--KTFSW--IKEQIARSISVSLLI--YIITRTSISSAYPIFAQQ
CYF_COFAR       ------------METR--NIFSW--IKEQITRSISVSLMI--YIITRTAVSNAYPIFAQQ
CYF_HELAN       ------------MQTR--NTFSW--IKEQITRSISASLMI--YIITRTSISNAYPIFAQQ
CYF_LACSA       ------------MQTR--NNFSW--IKEQITRSISVSLMI--YIITRASISNAYPIFAQK
CYF_SPIOL       ------------MQTI--NTFSW--IKEQITRSISISLIL--YIITRSSIANAYPIFAQQ
CYF_AGRST       ------------MENR--NTFSW--VKEQMTRSISVSIMI--YVITQTSISNAYPIFAQQ
CYF_LOLPR       ------------MENK--NTFSW--VKEQMTRSISVSIMI--YVITQTSISNAYPIFAQQ
CYF_WHEAT       ------------MENR--NTFSW--VKEQITRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_HORVU       ------------MENR--NTFSW--VKEQITRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_ORYNI       ------------MENR--NTFSW--VKEQMTRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_ORYSA       ------------MENR--NTFSW--VKEQMTRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_ORYSI       ------------MENR--NTFSW--VKEQMTRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_ORYSJ       ------------MENR--NTFSW--VKEQMTRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_SACHY       ------------MENR--KTFSW--LKEQMIRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_SACOF       ------------MENR--KTFSW--LKEQMIRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_SORBI       ------------MENR--KTFSW--LKEQMIRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_MAIZE       ------------MENR--KTFSW--LKEQMIRSISVSIMI--YVITRTSISNAYPIFAQQ
CYF_CERDE       ------------MQNR--NTFSW--VKDQMSRFISVSIMI--YVITRTSISNAYPIFAQQ
CYF_CALFG       ------------MQNR--NTFSW--VKEEMTRFISVSIMI--YVITRTSISNAYPIFAQQ
CYF_LIRTU       ------------MQNR--NTFSW--VKEQMTRFISVSIMI--YVITRTSISNAYPIFAQQ
CYF_CHLSC       ------------MQNR--NTFSW--VKEQMTRSISVSIII--YVITRTSISNAYPIFAQQ
CYF_DRIGR       ------------MQNR--NTFSW--VKEQMTRFISVSIMI--YVITRTSISNAYPIFAQQ
CYF_ACOCL       ------------MQNR--NTFSW--VKEQMTRFISVSIMI--YVITRTSIANAYPIFAQQ
CYF_PHAAO       ------------MQNR--KTFSW--VKEQMTRSIYVSIMI--YVITRASISNAYPIFAQQ
CYF_DIOEL       ------------MQNR--NTFLG--VKEQITRSIFVSIMI--YVITRASISNAYPIFAQQ
CYF_NYMAL       -----------MQKNR--NTFSW--VKEQMTRCISVSMMI--YVITRASISNAYPIFAQQ
CYF_ILLOL       --------------------MTR--SISISVLIISVLIMI--YVITRTSISNAYPIFAQQ
CYF_PIPCE       ------------MQNR--NTFSW--VKEPINRSISVLIII--YVITQTSISNAYPIFAQQ
CYF_LEMMI       ------------MQNR--NTFFG--VKQQITRFISVSIGI--YVITQTSISNAYPIFAQQ
CYF_BUXMI       ------------MQTR--NTFFW--IKEQMTRSISVSIIV--YVITQTSISNAYPIFAQQ
CYF_PLAOC       ------------MQNR--NTFSW--IKEQMTRSISVSIMI--YVITRTAISNAYPIFAQQ
CYF_NANDO       ------------MQNR--NIFSW--VKEQTTRSISVSIMILIYVITWTSISHAYPIFAQQ
CYF_AMBTC       ------------MQNR--NTFSW--VKEQMTRSIFVSMMI--YIITRASISNAYPIFAQQ
CYF_CUSGR       ------------MHTK--NLFYS--RTQQITQYLSALLMM--VILTRTSISSAYPLFAQQ
CYF_CUSOB       ------------MHTK--NLFYS--RPQQITQYLSAFLMM--VILTRTSISSAYPLFAQQ
CYF_PINKO       ------------MQNR--NTYE--WTKK-MTRLISVLVMI--HIITRTSISNAYPIFAQQ
CYF_PINTH       ------------MQNR--NTYE--WAKK-MTRLISVLVMI--HIITRTSISNAYPIFAQQ
CYF_CYCTA       ------------MRNI--NTYD--WMKKWMTRSISILVMI--HMITRTSISNAYPIFAQQ
CYF_CRYJA       ------------MQNR--KTYDD-WVKKWITQSISVLIMI--DIMTRTSIANAYPIFAQQ
CYF_MARPO       ------------MQNR--NFNNL--IIKWAIRLISIMIII--NTIFWSSISEAFPIYAQQ
CYF_PHYPA       ------------MQNR--NISYW--IKKCVIQSISIVILM--KIIAWPSISEAYPIFAQQ
CYF_PSINU       ------------MQNR--NKNNW--MKKWVIRSISILIIL--NIIAWPSISYAYPIFAQQ
CYF_HUPLU       ------------MQNV--NTYDC--IKKLVTQLISVLIVI--NTIAWPSIPKAYPIFAQQ
CYF_ANTAG       ------------MQNRKTYAYDW--IKKWMIKSISTLIII--NTMVWSSVSEAYPIFAQQ
CYF_GNEPA       ------------MKTK--KSYDK--VTRWVTPPILMLIII--HIITGACSSNAYPIFAQK
CYF_ADICA       ------------MQTA--ITKKW--MKEWWILSLAALISF--GKLSCPSVSNAYPIFAQQ
CYF_ANGEV       ------------MQNK--NNYNW--LKEWVIRSFLLLT-----LLTWPSVSNAYPIFAQQ
CYF_CHAVU       ------------MQNT--NTLNW--INKLIYLSISIPIFFLILVTTYPNSVEAYPVFAQQ
CYF_STAPU       ------------MQNK--DACKS--LSSWVSLSISLLVLT--VPLIWPYNSTAFPIYAQQ
CYF_ZYGCR       ------------MQKK--DVCEY--ITKWVSVTISTLVTI--GVLVFPLSSEAYPIFAQQ
CYF_CHAGL       ------------MQNR--NFFEY--PKNWIILLIPIFTTF---NLLFTSDCYAFPIYAQQ
CYF_CHLRE       ------------MSNQVFTTLRA----ATLAVILGMAGGL--AVS----PAQAYPVFAQQ
CYF_TETOB       ------------MNFFTHKKNNF----GSFVTIFSFLVAL--GVTNLTPAAEAYPIFAQQ
CYF_TUPAK       MKRNIIFLVIHQFENLTMKKKQN----IFFIFLLTVFFNF--TVNS---NVSAYPVFAQQ
CYF_CHLVU       --------------MRTFLKFST----LVSKGVLVLVCSF--FLTA---SSNAYPIFAQQ
CYF_OLTVI       -----------MFTNNLTKNALV----TLVSGFMAIFIGF--NTVQ---PAEAYPIFAQQ
CYF_BIGNA       --------------MYLSKNFFL----NLKTFIFSFFVLC--FFSQ---SAQAYPIFAKQ
CYF_NEPOL       -----------------MRNWSF----SKAALTVSLLALS--WSPFGPAEVQAYPIYAQE
CYF_OSTTA       ----------------------M----KKNLFLVSVFASL--FVG-TANNALAYPMYAQQ
CYF_CHLAT       -----------MFQQM--QKISLKLLKTTFLFLFATFILV-----GLPSTSQAYPIFAQQ
CYF_MESVI       ------------MQNM----FSF----LSNKKIIALFLII--GTIFMPLSSEAYPIFAQQ
CYF_CYAPA       ------------MKIYRQIKQSF----SITKIVFSFFISLLLNLVAQPTICQAFPIYAQQ
CYF_CYACA       ------------MKHTNSKQKLK-----DIINFCQAIFTLCIICLYQANISNSYPIYAQQ
CYF_CYAM1       ------------MMTYLSKQFSK-------LLFGQLLFLF--IGNLLLKPVQAYPIYAQQ
CYF_PORPU       ------------MKLNSLINLIQ-----KSIYSCTLLLTILNIICIAPNSSNAFPIYAQQ
CYF_PYRYE       ------------MKLNSLINLIQ-----KSIYSCTLLLIILNIICVAPNSSNAFPIYAQQ
CYF_GRATL       --------------MNIKLTLL-------------VLISIINLMIIQPIQTLAFPIYAQQ
CYF_GUITH       ------------MINLFLLKYKTAFSTFLKPFAYLSLILS---VCFYSIQAQAFPVFAQQ
CYF_RHDSA       ------------MKNNYLANLIKTLQAIVVSVALLAPLV-------LPSAVNAFPVYAQQ
CYF_TRICV       ------------MATN--KFFKS------LLFTLTIAISL---FGLSIENSSAYPVFAQQ
CYF_THAPS       ------------MATN--KFFKS------LLFTLTIAISS---FGFCVENSSAYPVFAQQ
CYF_PHATC       ------------MATN--KFFKS------LLFALTIAINS---FGFCIQDAVAYPVFAQQ
CYF_EMIHU       ------------MQIS--KFFKF------VFISVSLCGSL---LFPQMAN--AYPVFAQQ
CYF_NOSS1       ------MRNACTRARLTRTARAMVKTLFIAIASVTFFFTS---DLALPQSAAAYPFWAQQ
CYF_TRIV2       ------MRNACTRARLTRTARAMVKTLFIAIASVTFFFTS---DLALPQSAAAYPFWAQQ
CYF_MICAN       ------MRTFNFLSFPQVHRQALVKAVLVAIATVSLLLTS---DVINPQSAQAYPFWAQQ
CYF_SYNP2       ------MKTPELMAI----WQRLKTACLVAIATFGLFFAS---DVLFPQAAAAYPFWAQQ
CYF_SYNY3       ------MRNPDTLGLWTKTMVALRRFTVLAIATVSVFLIT---DLGLPQAASAYPFWAQE
CYF_TRIEI       ------MSKINLSTMWSSFIKKIAKTILVAIACISLFLTS---S----PAANAYPFWAQE
CYF_THEEB       -----------------------MKHFFKSLTLAIALAAS---VLFWSPQAQAYPFYAQQ
CYF_ACAM1       --------------MKQSLLSVLTKKSLRLLAALFLVVTS---VFSLPQAAQAFPIYAQQ
CYF_PROMS       -----------MKGLKNQIMKKTSLFICTLLFISSIVFY--------PKISFAYPFWAQQ
CYF_PROM0       -----------MKGLKNQIMKKTSLFICTLLFISSIVFH--------PKITFAYPFWAQQ
CYF_PROM2       -----------MKGLKNQIMKKTSLFICTLLFILSIVFY--------PKITFAYPFWAQQ
CYF_PROM9       -----------MKDLKNQIMRKTTLFIFSLLFISSILFY--------PKTTFAYPFWAQQ
CYF_PROM5       -----------MINFKKQIMKKTTFFLCAMLLVSSILIA--------PRSSLAYPFWAQQ
CYF_PROMP       -----------MINFKKQIMKKTTFFLCKLLLISSIVIF--------PRSSFAYPFWAQQ
CYF_PROM1       -------MKKNFYTISKTMSRSLKLILFSVFIGFSIFLI--------PQPTWAYPFWAQQ
CYF_PROMT       -------MKKNFYTISKTMSRSLKLILFSVFIGFSIFLI--------PQPTWAYPFWAQQ
CYF_PROMA       ------------------MRRILTFFLGSIIIGLSIIIS--------PSSSFAYPFWAQQ
CYF_PROM3       ------------------MRRLIPILLGSLVLSLSILVA--------PAASWAYPFWAQQ
CYF_PROMM       ------------------MRRLIPILLGSLVLSLSILVA--------PAASWAYPFWAQQ
CYF_SYNS3       ------------------MRRLLSSTFAALIVGLAVFSA--------PAASWAYPFWAQQ
CYF_SYNPW       ------------------MRRLLSPLFAALIVGVTVLTA--------PSTSWAYPFWAQQ
CYF_SYNSC       ------------------MRRHLSLFLGSLVIGLALLIA--------PAASWAYPFWAQQ
CYF_SYNS9       ------------------MRRHLSLVLGSLVIGLALLIA--------PGASWAYPFWAQQ
CYF_SYNPX       ------------------MRRHLSLLIGSLVLGLSLLIA--------PAASWAYPFWAQQ
CYF_SYNR3       ------------------MRRSLSLLLGSLLLTVGLLVG--------AQPSWAYPFWAQQ
CYF_SYNP6       ---------MNMRFSPKALVRQLGRLSLVACLSLGLLGAA---DWLQPQAAAAYPFWAQE
CYF_SYNE7       ---------MNMRFSPKALVRQLGRLSLVACLSLGLLGAA---DWLQPQAAAAYPFWAQE
CYF_SYNJB       -------------------MKRIGLVFCALLLLLGMGAR----------PAAAYPYYAQM
CYF_SYNJA       -------------------MKRIYLALCALLLLLGTGSR----------PAAAYPYYAQM
                                                                    ::* :*: 

CYF_BRARR       NYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_LOBMA       NYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_ARAHI       NYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_DRANE       NYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_ARATH       NYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_CRUWA       NYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_CAPBU       NYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_OLIPU       NYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_LEPVR       NYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_NASOF       NYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_BARVE       NYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_AETCO       NYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_AETGR       NYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_CARPA       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_GOSBA       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_GOSHI       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_CITSI       GFE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_POPAL       GYE-NPREATGRIVCANCHLANKPVGIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_POPTR       GYE-NPREATGRIVCANCHLANKPVGIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_MANES       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_PELHO       GYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVRIPYDMQIKQVLANGKK
CYF_SOYBN       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKK
CYF_PHAVU       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKK
CYF_LOTJA       GYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVRIPYDMQVKQVLANGKR
CYF_MORIN       SYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDLQLKQVLANGKK
CYF_CUCSA       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_OENEH       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKK
CYF_OENAR       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKK
CYF_OENBI       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKK
CYF_OENGL       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKK
CYF_OENPA       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDRQVKQVLANGKK
CYF_EUCGG       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKR
CYF_DAUCA       GYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVRIPYDMQLKQVLANGKR
CYF_PANGI       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_VITVI       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQMKQVLANGKR
CYF_SOLBU       GYE-NPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_SOLLC       GYE-NPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_SOLTU       GYE-NPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_ATRBE       GYE-NPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_NICSY       GYE-NPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKR
CYF_TOBAC       GYE-NPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKR
CYF_NICTO       GYE-NPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKR
CYF_CUSEX       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDSQLKQVLSNGKK
CYF_IPOPU       GFE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLSNGKK
CYF_JASNU       GYE-NPREATGRIVCANCHLANKPVDVEVPQAVLPDTVFEAVVRIPYDKQLKQVLANGKK
CYF_COFAR       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDKQLKQVLANGKK
CYF_HELAN       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDTQLKQVLANGKK
CYF_LACSA       GYE-NPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_SPIOL       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_AGRST       GYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_LOLPR       GYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_WHEAT       GYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_HORVU       GYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_ORYNI       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_ORYSA       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_ORYSI       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_ORYSJ       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_SACHY       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_SACOF       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_SORBI       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_MAIZE       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKK
CYF_CERDE       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_CALFG       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_LIRTU       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_CHLSC       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKK
CYF_DRIGR       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_ACOCL       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDKQLKQVLANGKK
CYF_PHAAO       VYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_DIOEL       GYE-NPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_NYMAL       SYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_ILLOL       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPNTVFEAVVRIPYDMQLKQVLANGKR
CYF_PIPCE       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDSQLKQVLANGKK
CYF_LEMMI       GYE-NPREATGRIVCANCHLASKPVDIEVPQSVLPDTVFEAVVRIPYDTQVKQVLANGKK
CYF_BUXMI       GYE-NPREATGRIVCANCHLANKPLDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_PLAOC       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKK
CYF_NANDO       SYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLSNGKR
CYF_AMBTC       GYE-NPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKK
CYF_CUSGR       GYE-NPREATGRIVCANCHLANKPVNIEVPQAILPDTVFEAVVQIPYDLQLKQVLSNGKK
CYF_CUSOB       GYE-NPREATGRIVCANCHLANKPVNIEVPQVILPDTVFEAVVQIPYDLQLKQVLSNGKK
CYF_PINKO       GYE-NPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAIVKIPYDTQMKQVLANGKK
CYF_PINTH       GYE-NPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAVVKIPYDMQMKQVLANGKK
CYF_CYCTA       GYE-NPREATGRIVCANCHLAKKPVNIEVPQSVLPDTVFEAVVQIPCDMQIKQVLANGKK
CYF_CRYJA       AYE-NPREATGRIVCANCHLAKKPVEIEVPQSVLPDTVFEAVVKIPYDKQIKQVLANGKK
CYF_MARPO       GYE-NPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAVVKIPYDMQIKQVLANGKK
CYF_PHYPA       AYE-DPREATGRIVCANCHLAKKPVDIEVPQSVLPDTVFEAVVKIPYDMQIKQVLANGKK
CYF_PSINU       SYE-NPREATGRIVCANCHLAKKPVDIEVPQSVFPNTVFEAVVKIPYDKQIKQVLGNGKK
CYF_HUPLU       SYE-NPREATGRIVCSNCHLAKKLVDIEVPQSVLPNTVFEAVVKIPYDMQIKQVLANGKK
CYF_ANTAG       GYE-NPREATGRIVCANCHLAKKPVDIEVPQSVLPDTVFEAVVKIPYDTQVKQVLANGKK
CYF_GNEPA       SYE-NPREATGRIVCANCHLAKKSVEVEVPQSVLPNSVFEAVVKIPYDTQIKQVLANGKK
CYF_ADICA       NYE-NPREATGRIVCANCHLAKKTVDLEAPQSVLPDTVFEAIVKIPYDTRIKQVLANGKK
CYF_ANGEV       GYE-NPREATGRIVCANCHLAKKPVDIEVPQSVLPDTVFEAIVKIPYDMQVKQVLANGKK
CYF_CHAVU       AYK-SPREATGRIVCANCHLAKKTVDIEVPQAVLPNTVFEAVVKIPYDMQLKQVLANGKK
CYF_STAPU       NYE-SPREATGRIVCANCHLAKKAVDIEVPQAVLPDTVFEAVVKIPYDTQIKQVLSNGKK
CYF_ZYGCR       NYE-SPREATGRIVCANCHLAKKPVEIEVPQAVLPDTVFEAVVKIPYDKQINQVLANGKP
CYF_CHAGL       NYE-NPREATGRIVCANCHLAKGPVDIEVPKTVFPDTVFEAVVKIPYDTQIKQVLANGKK
CYF_CHLRE       NYA-NPREANGRIVCANCHLAQKAVEIEVPQAVLPDTVFEAVIELPYDKQVKQVLANGKK
CYF_TETOB       NYE-NPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEAVVKIPYDQQVQQVLGNGKK
CYF_TUPAK       GYK-NPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEAMVKIPYDQQIKQVQANGKK
CYF_CHLVU       NYA-NPREANGRIVCANCHLAEKPIEIEVPQAVLPDTVFEAVVKIPYDKQIKQVLANGKK
CYF_OLTVI       NFK-NPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEATVKVPYDKSIKQVGANGKP
CYF_BIGNA       YFS-SPREVSGRIACSYCHLAQKPVELSVPQSVFPNTVFEAVIKVPYDKTVKQVSGQGSK
CYF_NEPOL       NYA-YPREATGRIVCANCHLAQKPVDIEVPQAVLPDTVFEATVKIPYDTEAKQVLGTGKK
CYF_OSTTA       GYE-NPREATGRIVCANCHLAQKPVDIEVPQAVLPDSVFEAVVKIPYNQEVKQVLGNGKK
CYF_CHLAT       AYE-NPREATGRIVCANCHLAKKSVDIEVPQAVLPNTVFEAVVKIPYDIQLKQVLANGKK
CYF_MESVI       NYA-SPREATGRIVCANCHLAKKPVDIEVPQAVLPDTVFEAVVKIPYDTQVQQVLGNGKK
CYF_CYAPA       AYQ-IPREATGRIVCANCHLGKKPVEIEVPQAVLPNTVFEAVVKIPIDKGAQQIQANGQK
CYF_CYACA       TYE-NPRESTGRIVCANCHLAQKNIYIEAPKEVLPNTVFETVVKIPYEFNKKQILGNGSK
CYF_CYAM1       AYA-NPREVTGRIVCANCHLAQKAIELEVPNSVLPNQEFEATVKIDYDLNQKQLLGNGQK
CYF_PORPU       AYE-SPREATGRIVCANCHLAQKPVEIEAPQAVLPNTVFETVVKIPYDNNAKQILGNGSK
CYF_PYRYE       AYE-SPREATGRIVCANCHLAQKPVEIEAPQAVLPNTVFETVVKIPYDSNAKQILGNGSK
CYF_GRATL       GYE-NPREATGRIVCANCHLAQKPIKIEAPKTVLPNSIFEAIVKIPYDTNNKQLLGNGIK
CYF_GUITH       AYE-NPREATGRIVCANCHLAQKPVEIEVPQAVLPDTVFEAVVEVPYDLSLQQVTGNGTK
CYF_RHDSA       AYE-NPREATGRIVCANCHLAQKPVEIEVPQGVLPDTVFEAKVEIPYDLSVKQVTGDGTK
CYF_TRICV       GYS-NPRAANGKLACANCHLNQKAIEIEAPQAVLPNSVFEVTVKVPYDTTRQQVGANGKK
CYF_THAPS       GYS-NPRAANGKLACANCHLNQKAIEIEAPQGVLPNSVFEIEIKVPYDVNRQQISADGKP
CYF_PHATC       NYS-NPRAANGKLACANCHLNQKAIEIEAPQAVLPNSIFEVEIKVPYDTTKQQLGANGKK
CYF_EMIHU       AYD-NPREATGRIVCANCHLAQKPTEVEVPQAVLPDTVFEAVVNIPYDTKVQQVTASGTP
CYF_NOSS1       TYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVVKIPYDTSVQQVGADGSK
CYF_TRIV2       TYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVVKIPYDTSVQQVGADGSK
CYF_MICAN       TAPETPREATGRIVCANCHLAQKPAEIEIPHSVLPDSVFEAVVKIPYDPASQQVLGDGSK
CYF_SYNP2       TAPETPREATGRIVCANCHLAAKEAEVEIPQSVLPDQVFEAVVKIPYDHSQQQVLGDGSK
CYF_SYNY3       TAPLTPREATGRIVCANCHLAQKAAEVEIPQAVLPDTVFEAVVKIPYDLDSQQVLGDGSK
CYF_TRIEI       TAPATPREATGRIVCANCHLGAKLTEVEVPQSVLPDTVFKAVVKIPYDTDVQQVLGDGSK
CYF_THEEB       GYE-SPREATGRIVCANCHLAAKPIQVEVPQAVTPDSVFEAVVKIPYDTSVQQVLGDGSK
CYF_ACAM1       AYD-SPREANGRIVCANCHLAAKPTQVEVPQAVLPDTVFEAVIKIPYDTDAQQVLGSGDL
CYF_PROMS       NYE-SPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEIGADGSE
CYF_PROM0       NYE-SPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEIGADGSE
CYF_PROM2       NYE-SPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEIGADGSE
CYF_PROM9       NYE-SPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEIGADGSE
CYF_PROM5       NYE-SPREATGKIVCANCHLAQMPTIAEVPQAVGADSVFKAVVKIPYKDDIKEIGADGSE
CYF_PROMP       NYE-SPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKDDIKEIGADGSA
CYF_PROM1       KFE-NPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEIGADGSK
CYF_PROMT       KFE-NPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEIGADGSK
CYF_PROMA       NYE-NPREATGKLVCANCHLAKMTTQVEVPQSVGADSVFKAAVKIPYKPGTEEIGADGSK
CYF_PROM3       NYD-NPREATGKIVCANCHLAQKTTQAEVPQSVLPDSVFKAVVKIPYKKDTTEISSDGSD
CYF_PROMM       NYD-NPREATGKIVCANCHLAQKTTQAEVPQSVLPDSVFKAVVKIPYKKDTTEISSDGSD
CYF_SYNS3       NYD-SPREATGKIVCANCHLAQKLTQAEVPQSVLPDSVFKAVVKIPYDTGVQELGADGSQ
CYF_SYNPW       NYD-SPREATGKIVCANCHLAQKLTQAEVPQSVLPDSVFKAVVKIPYDTSVPEIGADGSE
CYF_SYNSC       NYD-SPREATGKIVCANCHLAKKLTQAEVPQSVLPDSVFTASVRVPYENGLQEIGADGSD
CYF_SYNS9       NYD-SPREATGKIVCANCHIAKKLTQAEVPQSVLPDSVFTASVKVPYEEGIKEIGADGSE
CYF_SYNPX       NYD-SPREATGKIVCANCHLAKKLTQAEVPQSVLPDTVFTASVKIPYEEGLLEIGADGSD
CYF_SYNR3       NYD-SPREATGKIVCANCHLAKKLTQVEVPQSVMPDTVFKAVVKVPYDTDVQQVGADGNR
CYF_SYNP6       NYA-SPREATGKIVCANCHLAKKPTEVEVPHSVLPDTVFKAVVKIPYDRSSQQVLGDGSK
CYF_SYNE7       NYA-SPREATGKIVCANCHLAKKPTEVEVPHSVLPDTVFKAVVKIPYDRSSQQVLGDGSK
CYF_SYNJB       AYD-NPREATGKIVCANCHLNAMPTRAEVPQAVTPGQVFTIKVGIPYDLSKQQVLADGSK
CYF_SYNJA       AYD-NPREATGKIVCANCHLNAMPARAEVPQAVTPGQVFTIKVGIPYDLSKQQVLADGSK
                     **  .*::.*: **:       . *: : ..  *   : :  .    :: . *  

CYF_BRARR       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_LOBMA       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_ARAHI       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_DRANE       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_ARATH       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_CRUWA       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_CAPBU       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_OLIPU       GALNVGAVLILPEGFELAPPDRISPEIKEKIGTL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_LEPVR       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_NASOF       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPDKKNILVIGPVPGQKYSE
CYF_BARVE       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_AETCO       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_AETGR       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPNKKNILVIGPVPGQKYSE
CYF_CARPA       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPTQKKILVIGPVPGQKYSE
CYF_GOSBA       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPTKKNILVIGPVPGKKYSE
CYF_GOSHI       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPTKKNILVIGPVPGKKYSE
CYF_CITSI       GALNVGAVLILPEGFELAPPDRISPEMKEKIGKL-SFQTYRPTKKNILVIGPVPGQKYSE
CYF_POPAL       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPAKKNILVIGPVPGQKYSE
CYF_POPTR       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPAKKNILVIGPVPGQKYSE
CYF_MANES       GALNVGAVLILPEGFELAPPDRISPEMKEKMGNL-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_PELHO       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-PFQSYRPTQKNILVIGPVPGQKYSE
CYF_SOYBN       GALNVGAVLILPEGFELAPPDRISPEIKEKIGNL-SFQNYRPTKKNILVVGPVPGQKYKE
CYF_PHAVU       GTLNVGAVLILPEGFELAPPDRISPEIKEKIGNL-SFQNYRPTKKNILVVGPVPGQKYKE
CYF_LOTJA       GALNVGAVLILPEGFELAPTDRISPEIKEKMGNL-SFQSYRPTKKNILVVGPVPGQKYSE
CYF_MORIN       GALNVGAVLILPEGFELAPPDRISPEIKEKISNL-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_CUCSA       GGLNVGAVLILPEGFELAPPDRISPEIKEKMGNL-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_OENEH       GGLNVGAVLILPEGFELAPPARISPEMKERIGNP-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_OENAR       GGLNVGAVLILPEGFELAPPARISPEMKERIGNP-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_OENBI       GGLNVGAVLILPEGFELAPPARISPEMKERIGNP-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_OENGL       GGLNVGAVLILPEGFELAPPARISPEMKERIGNP-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_OENPA       GGLNVGAVLILPEGFELAPPARISPEMKERIGNP-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_EUCGG       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVSGQKYSE
CYF_DAUCA       GTLNVGAVLILPEGFELAPADRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVPGQKYSE
CYF_PANGI       GALNVGAVLILPEGFELAPVDRISPEMKERIGNL-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_VITVI       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQNYRPTKKNILVIGPVPGQKYSE
CYF_SOLBU       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKTNILVVGPVPGKKYSE
CYF_SOLLC       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKTNILVVGPVPGKKYSE
CYF_SOLTU       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKTNILVVGPVPGKKYSE
CYF_ATRBE       GGLNVGAVLILPEGFELAPSDRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_NICSY       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVPGQKYSE
CYF_TOBAC       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVPGQKYSE
CYF_NICTO       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVPGQKYSE
CYF_CUSEX       GGLNVGAVIILPEGFELAPPDRLSPQMKEKIGNL-SFQNYRPNQKNIIVVGPVPGQKYSE
CYF_IPOPU       GGLNVGAVLILPEGFELAPPDRLSTEMKEKIGNL-SFQSYRPNKKNILVVGPVPGKKYSE
CYF_JASNU       GGLNVGAVLILPEGFELAPTDRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVPGQKYSE
CYF_COFAR       GGLNVGAVLILPEGFELAPPDRISPEIKEKIGNL-SFQSYRPNKKNILVIGPIPGQKYSE
CYF_HELAN       GGLNVGAVLILPEGFELAPPDRISPEIKEKMGNL-SFQSYRPNQKNILVIGPVPGQKYSE
CYF_LACSA       GALNVGAVLILPEGFELAPPDRISPEIKEKMGNL-SFQSYRPNQKNILVIGPVPGQKYSE
CYF_SPIOL       GGLNVGAVLILPEGFELAPPDRISPEMKEKMGNL-SFQSYRPNKQNILVIGPVPGQKYSE
CYF_AGRST       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPDKKNILVIGPVPGKKYSE
CYF_LOLPR       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPDKKNILVIGPVPGKKYSE
CYF_WHEAT       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-AFQSYRPDKKNILVIGPVPGKKYSE
CYF_HORVU       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-AFQSYRPDKKNILVIGPVPGKKYSE
CYF_ORYNI       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_ORYSA       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_ORYSI       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_ORYSJ       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_SACHY       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_SACOF       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_SORBI       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_MAIZE       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-SFQSYRPNKKNILVIGPVPGKKYSE
CYF_CERDE       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKKNILIMGPVPGKKYSQ
CYF_CALFG       GALNVGAVLILPEGFELAPPDRISPELKEKMGNL-SFQSYRPNKRNILVVGPVPGQKYSE
CYF_LIRTU       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPTKRNILVVGPVPGQKYSE
CYF_CHLSC       GALNVGALLILPEGFELAPPDRISPEMKEKMGNL-SFQSYRPTKRNILVIGPVPGQKYSE
CYF_DRIGR       GSLNVGAVLILPDGFELAPPDRISPEMKEKIGNL-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_ACOCL       GSLNVGAVLILPEGFELAPPDRISPEMKEKMGNL-AFQSYRPTKKNIIVIGPVPGQKYSE
CYF_PHAAO       GALNVGAVIILPEGFELAPPDRISPEIKEKMGNL-SFQFYRPNKRNILVIGPVPGQKYSE
CYF_DIOEL       GALNVGAVLILPEGFELAPPDRISPEVKEKMGNL-SFQNYRPNKKNIIVIGPAPGQKYSE
CYF_NYMAL       GGLNVGAVLILPEGFELAPPDRISPEMKEKMGNL-SFQSYRPNKKNILVVGPVPGQKYSE
CYF_ILLOL       GGLNVGAVLILPEGFELAPPDRISPEMKEKMGNL-SFQNYRPTKRNILVIGPVPGQKYSE
CYF_PIPCE       GGLNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPNKKNILVIGPVPGQKYRE
CYF_LEMMI       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNI-SFQSYSPTKKNILVIGPVPGQKYRE
CYF_BUXMI       GALNVGAVLILPEGFELAPPDRISPEMKEKIGNL-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_PLAOC       GALNVGAVLILPEGFELAPPDRISPEMKEKIGKL-SFQSYRPTKKNILVIGPVPGQKYSE
CYF_NANDO       GSLNVGAVLILPEGFELAPPDRISPEMKEKMGNL-SFQNYRPTKKNILVIGPVPGQKYSE
CYF_AMBTC       GGLNVGAVLILPDGFELAPPDRISPAMKEKIGNL-SFQSYRPTKKNILVIGPVPGQKYNE
CYF_CUSGR       GGLNVGAVLILPEGFELAPPDRISPELKEKIGNL-YFQSYRPNIKNIFVVGPVPGQKYTK
CYF_CUSOB       GGLNVGAVLILPEGFELAPPDRISPELKEKIGKL-YFQSYRPNIKNIFVVGPVPGQKYKK
CYF_PINKO       GALNVGAVLILPEGFELAPPDRISPEIRQKTGNL-YFQNYRPNQKNIIVIGPVPGQKYSE
CYF_PINTH       GALNVGAVLILPEGFELAPPDRISPEIRQKTGNL-YFQNYRPNKKNIIVIGPVPGQKYSE
CYF_CYCTA       GALNVGAVLILPEGFELAPPDRISPEIKEKIGNL-YFQNYRPNQKEILVIGPVPGQKYSE
CYF_CRYJA       GTLNVGAVLILPEGFELAPPDRIYPEIKEKIGDL-YFQNYRPNQKNILIIGPVPGQKYSE
CYF_MARPO       GSLNVGAVLILPEGFELAPSDRIPPEMKEKIGNL-FFQPYSNDKKNILVIGPVPGKKYSE
CYF_PHYPA       GALNVGAVLILPKGFELAPADRIPPEMKEKIGNL-YFQPYSSDKKNILVIGPVPGKKYSE
CYF_PSINU       GGINVGAVLILPEGFELAPYNRIPAEMKDKIGDLALFQNYRPDKRNIIVIGPVPGKAYSE
CYF_HUPLU       GALNVGAVLILPEGFELAPPDRIPPDTKEKIGNL-YFQAYRPNKNNILVIGPVPGKKYSE
CYF_ANTAG       GALNVGAVLILPEGFELAPSNRVPPEMKEKIGNL-YFQSYRPDKKNILVVGPVPGKKYSE
CYF_GNEPA       GGLNVGAVLILPEGFELAPPERISPEIKEKMGTL-NFQNYSPSKKNIIVIGPIPGQKYQE
CYF_ADICA       GGLNVGAVLILPEGFELAPPNRIPTELKNKLGKL-SFQTYRPGEKNIIVVGPVPGKLYSE
CYF_ANGEV       GGLNVGAVPILPQGFELAPSDRIPTEIKEKIGNL-SFQNYSPDKKNIIIVGPVPGKKYSE
CYF_CHAVU       GNLNVAAVLILPEGFELAPPDRISPDIKEKIGNL-SFQSYSPDQKNILVVGPVPGKKYSE
CYF_STAPU       GGLNVGAVLILPEGFELAPSDRIPPELKEKISNI-YFQPYSPEKKNILVVGPLPGNKYSE
CYF_ZYGCR       GGLNVGAVLILPEGFQLAPPERIPPELKEKIGNL-YFQPYRPEKSNILVVGPVPGKTYSE
CYF_CHAGL       GGLNVGAVLILPEGFQLAPSDRIPAEIKEKIGNL-AFQPYSEDKKNLLVIGPIPGKTYQE
CYF_CHLRE       GDLNVGMVLILPEGFELAPPDRVPAEIKEKVGNL-YYQPYSPEQKNILVVGPVPGKKYSE
CYF_TETOB       GDLNVGMVLILPDGFELAPADRVPEEMKKKVGKL-FYQPYSPDKKNILVVGPVPGKKYSE
CYF_TUPAK       GDLNVGMVLILPEGFELAPSDRLPEEMKKKVGNL-YYQPYSSEQKNILVIGPIPGKLYNE
CYF_CHLVU       GDLNVGAVLILPDGFEIAPPDRIPEEMKAKVGKL-YFQPYSAEKKTIFVVGPVPGKKYSE
CYF_OLTVI       AELNVGAVLILPEGFQLAPSDRIPEEMKTKVGNL-YFSPYSTEQKNILVVGPVPGKDYSE
CYF_BIGNA       FGLNIGAILILPEGFTLAPVDRLSESLKKKTAGL-SFLPYNNNNKSTFMVGPVSGDKYDK
CYF_NEPOL       GPLNVGAVLILPEGFQIAPTDRIPEEMQTKVGKL-YFQQYSPEHPNVIVVGPLPGKKYNE
CYF_OSTTA       GGLNVGAVLILPDGFTMAPADRMSAELKEKVGKL-YFQPYSEDKQNILIVGPVPGKKYSE
CYF_CHLAT       GGLNVGAVLILPEGFQIAPADRIPEEMKSKIGNL-YYQPYSAEKKNIVVVGPIPGKTYQE
CYF_MESVI       GPLNVGAVLILPEGFKLAPQDRIPEEMKSKISNL-YFQPYNAANENILVIGPIPGDKNRE
CYF_CYAPA       GPLNVGAVLMLPEGFKLAPAERLSEELKAKTAGL-YFQPYSADKENILVIGPIPGDKNQE
CYF_CYACA       GDLNVGAVVILPEGFKLAPKDRMDEKLLKKTKNL-YFNNYSQKLDNIIVIGPITGKDNQE
CYF_CYAM1       GGLNVGAVLILPEGFRLSPN----------SRSP-FFNTYSEQLPNVIVIGPVPGEKYRE
CYF_PORPU       GGLNVGAVVILPEGFKLAPANRLSPELKEKTKNL-YIQPYSTKQSNILVIGPIPGDKNRE
CYF_PYRYE       GGLNVGAVVILPEGFKLAPVNRLSTELKEKTRNL-YIQPYSAKQDNILVIGPISGDKNRE
CYF_GRATL       GSINTGAVMILPEGFKLAPKNLLSEELREKTKNV-YIQPYSTTKDNILLVGPLAGEKNQE
CYF_GUITH       GPLNVGAVVILPEGFTLAPKDRISSELKEKTKGL-IITPYNEANPNILVVGPVPGKDHQK
CYF_RHDSA       GPLNVGAVLILPEGFTLAPKDRLTPEMKEKTKGV-VISPYSDSKKSIFVVGPIPGAEHQT
CYF_TRICV       ADLNVGGIVILPKGFKLAAKNQIPAEVKAKNKGV-FISPYSTEFDNILIVGPIAGKTHQE
CYF_THAPS       ADLNVGGILILPKGFKLASKTQISPEVKAKNKGV-FISPYSTEFDNILVVGPIAGKTHQE
CYF_PHATC       ADLNVGGILMLPEGFKLAPKNQIPAEVKEKNKGV-FISPYSSEFDNILVVGPIAGKTHQE
CYF_EMIHU       GPLNVGAVVILPEGFKLAPKGRMSDELKAKTKGV-FVQPYSKTRPNILVVGPILGEKNRE
CYF_NOSS1       VGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGDV-YFQPYGEDKDNIVIVGPLPGEQYQE
CYF_TRIV2       VGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGDV-YFQPYGEDKDNIVIVGPLPGEQYQE
CYF_MICAN       GGLNVGAVLMLPDGFKIAPPDRIPEEMQEKLGGV-YFQSYKEGQDNVVIVGPLPGDQYKE
CYF_SYNP2       GGLNVGAVLMLPDGFKIAPADRLSDELKEKTEGL-YFQSYAPDQENVVIIGPISGDQYEE
CYF_SYNY3       GGLNVGAVLMLPEGFKIAPPDRLSEGLKEKVGGT-YFQPYREDMENVVIVGPLPGEQYQE
CYF_TRIEI       GGLNVGAVLMLPEGFKIAPEDRIPQEWQEELADL-YFMPYSEEQENVLLFGPMPGDEYQE
CYF_THEEB       GGLNVGAVLMLPEGFKIAPPDRLPEELQAKTSGI-YYQPYSDDQQNIILVGPLPGEQYQE
CYF_ACAM1       GPLNVGAVLMLPDGFQIAPDDRIPEKMKEEINGV-FYQKYKPDTDNVIVVGPLSGADHQE
CYF_PROMS       VPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGV-YFTNYSEEQDNIIIVGPLPGDTNKE
CYF_PROM0       VPLQVGAVVMLPDGFKLAPQERWTEEIKKETEGV-YFTNYSEEKDNIIVVGPLPGDTNKE
CYF_PROM2       VPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGV-YFTNYSEEKENIIIVGPLPGDTNKE
CYF_PROM9       VPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGV-YFTNYSEEKDNIIIVGPLPGDTNKE
CYF_PROM5       VPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGV-YFTNYSEEKENIIIVGPLPGDTNKE
CYF_PROMP       VPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGV-YFTNYSEEKDNIILVGPLPGDTNKE
CYF_PROM1       VPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGV-YFTQYSEEQENIILVGPLPGDQNRE
CYF_PROMT       VPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGV-YFTQYSEEQENIILVGPLPGDQNRE
CYF_PROMA       VPLQVGAVVMLPDGFKLAPQDRWTEDIKEETKGV-YFTQYSEEKDNIILVGPLPGDQNKE
CYF_PROM3       VPLQVGAVVMLPDGFKLAPQDRWSEEIKEETKGV-FFTQYSEEKENILLVGPLPGDNNKE
CYF_PROMM       VPLQVGAVVMLPDGFRLAPQDRWSEEIKEETKGV-FFTQYSEEKENILLVGPLPGDNNKE
CYF_SYNS3       VPLQVGAVVMLPDGFTLAPQDRWTDEIKEETEGV-YFTEYSDDQPNVILVGPIPGDEHQE
CYF_SYNPW       VPLQVGAVVMLPDGFTLAPQDRWTDDIKEETEGV-YFSEYSDDQPNVILVGPIPGDQHQE
CYF_SYNSC       VGLQVGAVVMLPDGFTLAPQDRWTDEIKEETEGV-YFTQYSDEQPNILLVGPIPGDEHQE
CYF_SYNS9       VQLQVGAVVMLPDGFTLAPQDRWTDEIKEETEGV-YFTQYSDEQPNILLVGPIPGDQNQE
CYF_SYNPX       VGLQVGAVVMLPDGFTLAPQDRWTEEMKEETEGV-YFSQYSDDQPNILLVGPIPGDQHQE
CYF_SYNR3       TALNVGAVVMLPDGYTLAPQDRLSDELKEETEGI-YYTQYSDDQPNILLVGPLPGDEHQE
CYF_SYNP6       GGLNVGAVLMLPDGFKLAPEDRISEELKEEIGNV-YFTNYSADQENIILVGPLPGDDHQE
CYF_SYNE7       GGLNVGAVLMLPDGFKLAPEDRISEELKEEIGNV-YFTNYSADQENIILVGPLPGDDHQE
CYF_SYNJB       GGLNVGAVVVLPEGFRLATEAEMTEEQRQETAET-YITPYSDAKPNILLVGPLPGEQHQE
CYF_SYNJA       GGLNVGAVVVLPEGFRLATEEEMTEEQRQETAET-YITPYSDEKPNILLVGPLPGEQHQE
                  :: . : :**.*: ::.                    *       .:.**  *     

CYF_BRARR       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_LOBMA       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIINKILRK
CYF_ARAHI       ITFPILAPDPATNKDVHFLKYPLYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_DRANE       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKIVRK
CYF_ARATH       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_CRUWA       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_CAPBU       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_OLIPU       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATTGGIISKILRK
CYF_LEPVR       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_NASOF       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_BARVE       ITFPILAPDPASNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_AETCO       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_AETGR       ITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRK
CYF_CARPA       ITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGRKSNNTVYNATAAGIVSKILRK
CYF_GOSBA       ITFPILSPDPASNKDAHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATATGIISKIIRK
CYF_GOSHI       ITFPILSPDPASNKDAHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATATGIVSKIIRK
CYF_CITSI       ITFPILSPNPATNKDAYFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATSAGIVSKIIRK
CYF_POPAL       ITFPILSPDPAAKKDTHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_POPTR       ITFPILSPDPAAKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_MANES       ITFPILSPDPAAKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_PELHO       IAFPILSPNPETNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVSNATAAGIVSKIIRK
CYF_SOYBN       ITFPILSPDPTTKRDVHFLKYPIYVGGNRGRGQIYLDGSKSNNNVYNATAAGMVKKIIRK
CYF_PHAVU       ITFPILSPDPASKRDIHFLKYPIYVGGNRGRGQIYLDGSKSNNNVYNATAAGIVKKIIRK
CYF_LOTJA       ITFPILSPDPATNRDVNFLKYPIYVGGNRGRGQIYPDGSKSNNNVYNATTSGIINKIIRK
CYF_MORIN       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNNVYNATSAGIVSKIIRK
CYF_CUCSA       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNNVYNATAAGIVSKIIRK
CYF_OENEH       ITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_OENAR       ITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_OENBI       ITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_OENGL       ITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_OENPA       ITFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_EUCGG       VTFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGVVSKIIRK
CYF_DAUCA       ITFPILSPDPATTKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGIVGKIIRK
CYF_PANGI       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVGKIIRK
CYF_VITVI       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_SOLBU       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVSKIIRK
CYF_SOLLC       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVSKIIRK
CYF_SOLTU       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVSKIIRK
CYF_ATRBE       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_NICSY       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_TOBAC       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_NICTO       ITFPILSPDPATKKDVRFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_CUSEX       ITFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTFYSATAAGIVSKIIRK
CYF_IPOPU       ITFPILSPDPATKKDARFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_JASNU       IIFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIIRK
CYF_COFAR       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATGAGIVSKIIRK
CYF_HELAN       ITFPILSPDPATKKDIHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATASGIVSKILRK
CYF_LACSA       ITFPILSPDPATKKDIHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATASGIVSKILRK
CYF_SPIOL       ITFPILAPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNSTATGIVKKIVRK
CYF_AGRST       IVFPILSPDPATKKDAYFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVRKILRK
CYF_LOLPR       IVFPILSPDPATKKDAYFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVKKILRK
CYF_WHEAT       IVFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVRKILRK
CYF_HORVU       IVFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVRKILRK
CYF_ORYNI       IVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVRKILRK
CYF_ORYSA       IVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVRKILRK
CYF_ORYSI       IVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVRKILRK
CYF_ORYSJ       IVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVRKILRK
CYF_SACHY       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGTKSNNTVYNATSTGIVKKILRK
CYF_SACOF       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGTKSNNTVYNATSTGIVKKILRK
CYF_SORBI       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVKKILRK
CYF_MAIZE       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVKKILRK
CYF_CERDE       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATATGIVSKIVRK
CYF_CALFG       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSRIVRK
CYF_LIRTU       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVNRIVRK
CYF_CHLSC       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNARTAGIVSRIVRK
CYF_DRIGR       IVFPILSPDPATKKDVNFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATGAGIVSRIVRK
CYF_ACOCL       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGVVSRILRK
CYF_PHAAO       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATSAGIVSRIARK
CYF_DIOEL       IVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGIVSKIVRK
CYF_NYMAL       IVFPILSPDPATKKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASAAGIVSKIVRK
CYF_ILLOL       IVFPILSPDPATKKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATGAGLVSKIVRK
CYF_PIPCE       ILFPILSPDPAAKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGTITKILRK
CYF_LEMMI       IVFPILSPDPATSKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGVVSKIVRK
CYF_BUXMI       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIISKIIRK
CYF_PLAOC       ITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIISKIVRK
CYF_NANDO       ITFPILSPDPATKKDVYFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVSKIVRK
CYF_AMBTC       ILFPILSPDPATKKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASASGIISRIIRK
CYF_CUSGR       ITFPILSPNPANNRRAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVFNATASGRVKKIIRN
CYF_CUSOB       ITFPILSPNPATNRRAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVFNATASGRVKKIIRN
CYF_PINKO       LVFPILSPDPATDKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYSASATGRVSKILRK
CYF_PINTH       LVFPILSPDPSTDKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYSASATGRVSKILRK
CYF_CYCTA       IVFPILSPNPATNKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASTTGRVSKILRK
CYF_CRYJA       IVFPILSPNPATNKAAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASATGKVSKIVRK
CYF_MARPO       MVFPILSPDPATNKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASITGKVSKIFRK
CYF_PHYPA       MVFPILSPDPAVNKEANFLKYPIYLGANRGRGQIYPDGSKSNNTVYNASAAGTVSKIFRK
CYF_PSINU       IVFPLISPDPATNKEVHFLKYPIYLGGNRGRGQIYPDGSKSNNTIYNASIAGKVTKILRR
CYF_HUPLU       IVFPILSPDPALNKETHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASATGRVSKISRK
CYF_ANTAG       IIFPILAPNPATNKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASTTGIIKKVLRK
CYF_GNEPA       ILFPILSPDPANKKEIHFQKYPIYVGGNRGRGQIYPNGSKSNNTVYNASVTGRISQILRK
CYF_ADICA       IIFPVLSPDPGTNKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYTASATGKIKRITRK
CYF_ANGEV       IVFPILSPDPASNKESNFLKYPIYVGGNRGRGQIYPDGSRSNNTVYNASATGKVIKIFRK
CYF_CHAVU       ITFPILSPDPSINKQTNFLKYPIYVGGNRGRGQIYLDGSKSNNTIYSSSAEGQVVKIIRK
CYF_STAPU       LVFPILSPDPATNKKASFLKYPIYLGGNRGRGQVYPDGSKSNNNVFSASTAGTISQITRQ
CYF_ZYGCR       MVFPILAPDPSVNKQAYFLKYPIYLGGNRGRGQIYPDGSKSNNTVYNSPVTGTITSITKN
CYF_CHAGL       IIFPILSPDPNVNKESNFLKYPIYVGGNRGRGQVYPDGSKSNNNVFNSPATGKITKIVDN
CYF_CHLRE       MVVPILSPDPAKNKNVSYLKYPIYFGGNRGRGQVYPDGKKSNNTIYNASAAGKIVAITAL
CYF_TETOB       MVIPILSPDPATNKNVSFLKYPIYFGGNRGRGQVYPDGSKSNNTVYNSSVTGKISNIAPF
CYF_TUPAK       MVVPLISPNPATNKNVNYLKYPIYLGGNRGRGQLYPDGSKSNNNLYNASATGKITEITPT
CYF_CHLVU       MVFPILSPDPAKTKSISYLKYPIYVGGNRGRGQVYPDGSKSNNTIFTASAAGKITAIEPA
CYF_OLTVI       MVFPILSPDPAKDKSVSYLNYPVYLGGNRGRGQVYPDGSKSNNNVFGSPVAGTVSEIKAL
CYF_BIGNA       LVFPVLSPDYGPN--TAFLKSAVYVGGNRGRGQIYPNGEKSNNNLFASSSNGVVSEIKST
CYF_NEPOL       MVFPILAPNPATNKDVHFLKYPIYLGGNRGRGQVYPDGSKSNNNIFQAPVAGTITSITPG
CYF_OSTTA       MTFPLLSPDPATNKKVNYLTYPIYLGGNRGRGQVYPDGSKSNNTVYNAAAAGKIAAINPT
CYF_CHLAT       IVFPILSPDPAKDKGTHFFKYPIYVGGNRGRGQIYPDGSKSNNNVYNASTTGKIIQITAK
CYF_MESVI       IVFPILSPDPAKDKGTYFIKYPISVGANRGRGQVYPDGSKSNNTVYNASVSGTITDIIKE
CYF_CYAPA       IIFPILSPNPETNKNVKYLKYQLHVGGNRGRGQVSPTGEKTNNTIYNASVNGRISEITKL
CYF_CYACA       ITFPILAPDPQINKNTHFLKYSIYVGANKGRGQLYPSGEKSNNNPIPSNAEGRIEKIKPN
CYF_CYAM1       IHFPLKAPDPTTNKQVHFVKYSIYAGGNRGRGQLYPNGQKSNNAPVLASVNGVIEQIREN
CYF_PORPU       IIFPILSPDPAKDKQAHFFKYPIYVGGNRGRGQIYPTGDKSNNNLISASASGKINKIEAL
CYF_PYRYE       IVFPILSPDPAKDKKAHFFKYPIYVGGNRGRGQIYPTGDKSNNNIVSALSSGKINKIELL
CYF_GRATL       IIFPILSPDPSKDKNIHFLKYPIYIGANRGRGQVYPTGDKSNNNPIVSLNTGKVTKIISL
CYF_GUITH       LVFPVLSPNPAENKNVHFIKYPVYVGANRGRGQVNPTGEKSNNTVYTSPIDGQIVKLEKS
CYF_RHDSA       IIFPILAPNPADNKNVHFIKYPVFVGANRGRGQVNPTGDKSNNTLYSSPVEGRLTKIEKT
CYF_TRICV       LIFPVVSPDPEKDSDVKYLTYPLYAGGNRGRGQVYPTGEKSNINSFGAVQAGQISEITTS
CYF_THAPS       LIFPVVAPDPENNPDVKYLTYPFYAGGNRGRGQVYPTGERSNINSFGATQGGQITEITTT
CYF_PHATC       LIFPVMAPDPEKNSDIKYLTYPFYAGGNRGRGQVYPTGEKSNVNVFGANQSGQITEITVT
CYF_EMIHU       VTFPILAPDPAQDKSVHYLNYPIYVGANRGRGQVYPSGEKSNNNTFTSTAAGKVTAIEAG
CYF_NOSS1       IVFPVLSPNPANDKNIHFGKYSVHVGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQ
CYF_TRIV2       IVFPVLSPNPANDKNIHFGKYSVHVGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQ
CYF_MICAN       IVFPVLAPDPSQNKGIHFGKYAVHLGANRGRGQVYPTGEPSNNNAFKASTAGTISQISKT
CYF_SYNP2       IVFPVLSPDPKTDKNINYGKYAVHLGANRGRGQVYPTGELSNNNQFKASATGTITNIAVN
CYF_SYNY3       IVFPVLSPDPAKDKSINYGKFAVHLGANRGRGQIYPTGLLSNNNAFKAPNAGTISEVNAL
CYF_TRIEI       VVFPILSPDPATDKSIHFGKYAVHAGGNRGRGQVYPAGNKSNNTTYNVSASGKITDITFE
CYF_THEEB       IVFPILAPNPGTDKSIHFGKYAVHAGGNRGRGQVYPNGEKSNNNVFTAPIAGTITSITPN
CYF_ACAM1       IIFPVLSPDPATDPNIHFGKYSVHAGGNRGRGQIYPTGDKTNVNAVTSPAAGLVSSVSEN
CYF_PROMS       IVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTAGTINSIETI
CYF_PROM0       IVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSSSGTINSIETI
CYF_PROM2       IVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTSGTIDSIDII
CYF_PROM9       IVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTSGTINSIDTI
CYF_PROM5       IIFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVIFTSSSAGTINSIETI
CYF_PROMP       IVFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGEKSNNVIFTSSSAGTINSIETI
CYF_PROM1       IVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTITSIETN
CYF_PROMT       IVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTITSIETN
CYF_PROMA       IVFPILSPDPAKDKNIHFGKYSINVGGNRGRGQVYPTGEKSNNSIFTSTAAGLISTIEPN
CYF_PROM3       IVFPILSPDPATDSSIQFGKYSIHVGGNRGRGQILPTGEKTNNNAFTATEAGTITSIKAG
CYF_PROMM       IVFPILSPDPATDSSIQFGKYSIHVGGNRGRGQILPTGEKTNNNAFTATEAGTITSIKSG
CYF_SYNS3       IVFPVLAPDPATDSSISFGKYSIHVGGNRGRGQVYPTGEKSNNTVYTAPASGSVSAIEPG
CYF_SYNPW       IVFPVLSPDPATDSNIHFGKYSIHVGGNRGRGQVYPTGEKSNNTVFTAPSTGTVRSIEAG
CYF_SYNSC       IVFPVLSPDPATDSNIHFGKYQIHVGGNRGRGQVYPTGDKSNNTIYTAPASGTIASIEPG
CYF_SYNS9       IVFPVLSPDPATDSNIHFGKYQIHVGGNRGRGQVYPTGEKSNNTVFTAPAEGKVASIDAG
CYF_SYNPX       VVFPLLSPDPATDSNIHFGKYQLHVGGNRGRGQVYPTGEKSNNAVYTAPASGSVAAIEDG
CYF_SYNR3       LVFPILAPDPKTDSSISYGKTQIHVGGNRGRGQVYPTGEKSNNTVYTASVAGDITAITGG
CYF_SYNP6       IVFPVLSPDPAKDKNVFFGKYQIHVGGNRGRGQVYPTGQKSNNGVYTASAAGVIDAVTET
CYF_SYNE7       IVFPVLSPDPAKDKNVFFGKYQIHVGGNRGRGQVYPTGQKSNNGVYTASAAGVIDAVTET
CYF_SYNJB       IVFPVVAPDPKEDPSVAFMKYRVYIGANRGRGQLNPDGSLSNNNVFRAPATGRLVNIATL
CYF_SYNJA       IVFPVVAPDPKEDPSVAFMKYRVYIGANRGRGQINPDGSLSNNNVFRAPATGRLTSIATI
                : .*: :*:        : .  .  *.*:****:   *  :*         * :  :   

CYF_BRARR       EK------------------GGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPL
CYF_LOBMA       EK------------------GGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPL
CYF_ARAHI       EK------------------GGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPL
CYF_DRANE       EK------------------GGYEITIVDPSNERQVIDIIPRGLELLVSEGESIKLDQPL
CYF_ARATH       EK------------------GGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPL
CYF_CRUWA       EK------------------GGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPL
CYF_CAPBU       EK------------------GGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPL
CYF_OLIPU       EK------------------GGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPL
CYF_LEPVR       EK------------------GGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPL
CYF_NASOF       EK------------------GGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPL
CYF_BARVE       EK------------------GGYEITIVDASNGRQVIDIIPRGLELLVSEGESIKLDQPL
CYF_AETCO       EK------------------GGYEITIADASNGRQVIDIIPRGLELLVSEGESIKLDQPL
CYF_AETGR       EK------------------GVYEITIADASNGRQVIDIIPRGLELLVSEGESIKLDQPL
CYF_CARPA       EK------------------GGYEITIVDASDGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_GOSBA       EK------------------GGYEITITDALDGHQVVDIIPPGPELLVSEGESIKLDQPL
CYF_GOSHI       EK------------------GGYEITITDALDGHQVVDIIPPGPELLVSEGESIKLDQPL
CYF_CITSI       EK------------------GGYEITITDASNGREVVDIIPPGPELRVSEGQSIKLDQPL
CYF_POPAL       EK------------------GGYEITITDAPEGRQVIDSIPPGPELLVSEGESIKLDQPL
CYF_POPTR       EK------------------GGYEITITDAPEGRQVIDSIPPGPELLVSEGESIKLDQPL
CYF_MANES       EK------------------GGYEITITDASEGRQVIDIIPPGPELLVSEGESIKLDQPL
CYF_PELHO       ER------------------GGYEITIADASNGRQVVDIIPPGPELLVSEGESLKVDQPL
CYF_SOYBN       EK------------------GGYEITIVDALDGREVIDIIPPGPELLVSEGESIKLDQPL
CYF_PHAVU       EK------------------GGYEITIVDTLDEHEVIDIIPPGPELLVSEGESIKLDQPL
CYF_LOTJA       DK------------------GGYEITIVDASDGREVIDIIPPGPELLVSEGESIKLDQPL
CYF_MORIN       EK------------------GGYEITIVDASDGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_CUCSA       EK------------------GGYEITIVDAANGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_OENEH       EK------------------GGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPL
CYF_OENAR       EK------------------GGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPL
CYF_OENBI       EK------------------GGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPL
CYF_OENGL       EK------------------GGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPL
CYF_OENPA       EK------------------GGYEITITDASDGRQVVDIIPSGPELLVSEGESIKLDQPL
CYF_EUCGG       EK------------------GGYEITISDASDERQVVDIIPPGPELLVSEGESIKLDQPL
CYF_DAUCA       EK------------------GGYEITIADASDGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_PANGI       EK------------------GGYEITITDASDGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_VITVI       EK------------------GGYEITIADASDGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_SOLBU       EK------------------GGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_SOLLC       EK------------------GGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_SOLTU       EK------------------GGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_ATRBE       EK------------------GGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_NICSY       EK------------------GGYEITITDASDGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_TOBAC       EK------------------GGYEITITDASDGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_NICTO       EK------------------GGYEITIADASDGRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_CUSEX       EK------------------GGYEITITDASDSHQVVEIIPPGPELLVSEGEYLKFDQPL
CYF_IPOPU       EK------------------GGYEITITDASDSRQVVDIIPPGPELLVSEGESIKFDQPL
CYF_JASNU       ER------------------GGYEISITDPSDGRQVVDIIPPGPELLVSEGESIQFDQPL
CYF_COFAR       EK------------------GGYEITITD-TDGRQVVDIIPPGPELLVSEGEYIKLDQPL
CYF_HELAN       EK------------------GGYEITIADASDGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_LACSA       EK------------------GGYEITIADASDGRQVVDIIPPGPELLVSEGESIKFEQPL
CYF_SPIOL       EK------------------GGYEINIADASDGREVVDIIPRGPELLVSEGESIKLDQPL
CYF_AGRST       EK------------------GGYEISIVDASDGRQVIDTIPPGPELLVSEGESIKLDQPL
CYF_LOLPR       EK------------------GGYEISIVDASDGRQVIDTIPPGPELLVSEGESIKLDQPL
CYF_WHEAT       EK------------------GGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKLDQPL
CYF_HORVU       EK------------------GGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKIDQPL
CYF_ORYNI       EK------------------GGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPL
CYF_ORYSA       EK------------------GGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPL
CYF_ORYSI       EK------------------GGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPL
CYF_ORYSJ       EK------------------GGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPL
CYF_SACHY       EK------------------GGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKLDQPL
CYF_SACOF       EK------------------GGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKLDQPL
CYF_SORBI       EK------------------GGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKLDQPL
CYF_MAIZE       EK------------------GGYEISIVDASDGRQVIDIIPPGPELLFSEGESIKLDQPL
CYF_CERDE       EK------------------GGYEITIADTADGHQVVDIIPPGPELLVSEGESIKIDQPL
CYF_CALFG       EK------------------GGYEISIADASDGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_LIRTU       EK------------------GGYEITIADASDGHQVVDIIPPGPELLVSEGESIKLDQPL
CYF_CHLSC       EK------------------GGYEITIADASDGHQVVDIIPSGPELLVSEGESIKLDQPL
CYF_DRIGR       EK------------------GGYEITIADASDGHQVIDIIPPGPELLVSEGESIKLDQPL
CYF_ACOCL       EK------------------GGYEITIADASDGHQVVDIIPPGPELLVSEGESIKLDQPL
CYF_PHAAO       EK------------------GGYEITIVDASEGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_DIOEL       EK------------------GGYEITIIDASDGHQVVDIIPRGPELLVSEGESIKLDQPL
CYF_NYMAL       EKK-----------------GGYEITISDASNGHETVDIIPPGPELLVSEGEYIKLDQPL
CYF_ILLOL       EK------------------GGYEITIADASDGHQAVDIIPPGPELLVSEGEYIKLDQPL
CYF_PIPCE       EK------------------GGYEISIADASDGRQVVDNIPPGPELLVSEGESIKLDQPL
CYF_LEMMI       EK------------------KGYEIIITDPSDGREVVDIIPPGPELLVSEGESIKLDQLL
CYF_BUXMI       EK------------------GGYEITIADASDGHQVVNIIPPGPELLVSEGESIKLDQPL
CYF_PLAOC       EK------------------GGYEISIADASDGHQVVDIIPPGPELLVSEGESIKLDQPL
CYF_NANDO       EK------------------GGYELTIADASEGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_AMBTC       EK------------------GGYEITIANALDGRQVVDIIPPGPELLVSEGESIKLDQPL
CYF_CUSGR       QK------------------GGYEIIINDGSDSNEVVNLLPPGLEPLVSEGESIKLDQPL
CYF_CUSOB       EK------------------GGYEIIIKDGSDSNEVVNLLPPGLEPLVSEGDSIKLDQPL
CYF_PINKO       EK------------------GGYEITIDNKSDGGQVVDIVPPGPELLISEGELIKVDQPL
CYF_PINTH       EK------------------GGYEITIDNTSDGGQVVDIVPPGPELLISEGELIKVDQPL
CYF_CYCTA       EK------------------GGYEITIDNASDGRQVVDIVPPGPELLISEGEFIKVDQPL
CYF_CRYJA       EK------------------GGYQITIDNPSDGRQVVDFVPPGPELLVSEGEFIKADQSL
CYF_MARPO       EK------------------GGYEITIDDISDGHKVVDISAAGPELIISEGELVKVDQPL
CYF_PHYPA       EK------------------GGYEITIDTQ-DGRQIVDIVPAGPELIISEGELIKADQPL
CYF_PSINU       EK------------------GGYEITIEDTLEGRRVVDIVPPGPELIISEGEFIKIDQPL
CYF_HUPLU       EK------------------GGYEITVENTLDGRSVVDTVPPGPELIISEGESIKVDQPL
CYF_ANTAG       EK------------------GGYEIIIDNTLDGRQVIDIVPPGPELIISEGESIKVDQPL
CYF_GNEPA       EK------------------GGYEVTIENISQGRSVIDIIPPGPELLVSEGEFVKADQPL
CYF_ADICA       EGK-----------------GGYEIIIEESSGGREAIDVVPPGPELIVSEGEFVKADQPL
CYF_ANGEV       EKK-----------------GGYEITIEKTSDGRQVVDIVPPGPELIISEGEFLKVDQPL
CYF_CHAVU       EK------------------GGYEIFIDTI-DGRKITDIIPPGPEIIVSEGEFVKVDQPL
CYF_STAPU       KK------------------GGYEVIIKTT-DGREVTDIIPPGPELIVSEGESIKADQLL
CYF_ZYGCR       KK------------------GASTVTIITT-DNREVVELIPAGPTLLISEGDTVKADQPL
CYF_CHAGL       KK------------------AGFELSITTV-DGSSIVEIIPPGATFLVSEGDSVKIDQPL
CYF_CHLRE       SEKK----------------GGFEVSIEKA-NGEVVVDKIPAGPDLIVKEGQTVQADQPL
CYF_TETOB       D-KK----------------GGVEITIETA-NGDSIVEKIPAGPQVIVTQGQTVQPDQPL
CYF_TUPAK       G-KK----------------GGFDITIQTL-NGETVIDKVPAGPELIVTKDQTIQVDQPL
CYF_CHLVU       G-KK----------------GGYTLTIETA-NGESISEKLPPGPELVVNIGDIVGVDQAL
CYF_OLTVI       KSKK----------------GGYEVTITTA-SGNTVVEKIPGGPEVIVSEGEVVTVDQPL
CYF_BIGNA       KN------------------GGFEVVITTN-DGNSVVENIGSGATIIVQEGQQVKAEQPL
CYF_NEPOL       E-------------------KLTRVTLKTV-AGTEVVESIPAGPDIIVSVGQTVKADQPL
CYF_OSTTA       E-------------------KGTDVVIDKV-DGGSVTVAIPSGPDLLVSVGDTVAADQPI
CYF_CHLAT       PK------------------GGYILNIETP-DGATIEEKIPAGPELIVSEGQSVKADQPL
CYF_MESVI       KK-------------------AYKISIETK--DGTVVDTVPVGPELIVAKGDTVVTGQPI
CYF_CYAPA       EN------------------GGYEITITTK-NGESKIETIPAGPSLVVKKGQTIKADQPL
CYF_CYACA       ED------------------GGYEVIIKTK-DDETISQYVPIGLNLTIKEGQRIKAGEYI
CYF_CYAM1       E-----------------------VVIKTD-QGDLVSQAIPAGHTLLVKQGQKIQNEQPL
CYF_PORPU       EK------------------GGFIVHITST-KDSEVNQSIPAGVELKVREGETIQLDQAI
CYF_PYRYE       DK------------------GGFIIHVTNS-SNVESTQKISPGLELRVKEGDTIQLDQAL
CYF_GRATL       EK------------------GGYKIEIEKD-NGEIYTENIPQGLNLMVSQGSQVVANQNL
CYF_GUITH       DN-------------------VTSFSIKSK-TGDIITVKVPFGPDILVKEGQTLVADQQL
CYF_RHDSA       EKG------------------GYILTIQSK-SGDPLTINVPVGPELVVKEGQKVTADQAL
CYF_TRICV       EK------------------GESNITIINS-DGVKTSQIIPAGLTLTVKQGDSVKVDQSL
CYF_THAPS       EK------------------GESKITIVNS-DGATTSQTLSAGLKLLVKQGDIVKQDQPL
CYF_PHATC       EK------------------GESTILILNS-NGKQTSQVLPAGLILSIKQGQVVKADQPL
CYF_EMIHU       DK------------------GTTRVTIQTA-AGEAKEQTVPAGLKVSVKTGDVIQADQAL
CYF_NOSS1       EGEDGSVK---------------YLVDIKTESGEVVSDTIPAGPELIVSEGQAVTAGDAL
CYF_TRIV2       EGEDGSVK---------------YLVDIKTESGEVVSDTIPAGPELIVSEGQAVKAGDAL
CYF_MICAN       EAGG-------------------YEVTITSEAGPVV-ENIPAGPELIVSEGQAIEVGQFL
CYF_SYNP2       EAAG-------------------TDITISTEAGEVI-DTIPAGPEVIVSEGQAIAAGEAL
CYF_SYNY3       EAGG-------------------YQLILTTADGTET-VDIPAGPELIVSAGQTVEAGEFL
CYF_TRIEI       EYVG-------------------NQITIETPDSETVVDLVPPGPELLVAVGDTVEAGQVI
CYF_THEEB       PDGS-------------------TAVVITPENGEAVTETVPAGPELIVREGQTVVAGAAL
CYF_ACAM1       ------------------------SVTITTNDGQTVTESIPAGLEVVVSEGQAVADGAPL
CYF_PROMS       EDGS-------------------YQVNIENDNGEITTEAVPVGPQLIVKAQDKINVGDPL
CYF_PROM0       EDGS-------------------YKVNIEKENGEITTEAVPVGPQLIVKAQDKINAGDPL
CYF_PROM2       EDGS-------------------YKVNIENDNGEITTEEVPVGPQLIVKAQDKINAGDPL
CYF_PROM9       EDGS-------------------YKVNIENENGEITTEAVPVGPQLIVKAQDKINAGDPL
CYF_PROM5       EDGS-------------------YQINIENENGEITTEAVPVGPKLIVKEQDQITVGAPL
CYF_PROMP       EDGS-------------------YQINIENENGDIVTEAVPVGPKLIVKEQDQISAGDPL
CYF_PROM1       EDGT-------------------QIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKL
CYF_PROMT       EDGS-------------------QIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKL
CYF_PROMA       KDGG-------------------TNITIQTESGEAIIEEIPVGPSLVVKEGQTIDIGIPL
CYF_PROM3       KNGE-------------------SDIKLKTDSGKVISETIPAGPTLLVKVDDKVEAGAPL
CYF_PROMM       KNGE-------------------SDIKLKTDSGKVISETIPAGPSLLVKVDDKVEAGAPL
CYF_SYNS3       DNGA-------------------SVVTVKSADGAEITETVPVGPALLVSVGDVVEAGAPI
CYF_SYNPW       ENGA-------------------SVVTIASADGTELSETVPVGPALIVSVGDAVEAGAPI
CYF_SYNSC       DNGA-------------------SVVSIKAADGSSVSETIPVGPEVLVSVGDSIEAGTAL
CYF_SYNS9       DNGA-------------------SVVTIQAADGTSTSETIPVGPQLLVNVGDSVAAGDAI
CYF_SYNPX       DNGS-------------------SILTINTADGAAVTETIPVGPQLLVNVGDNVEAGAAL
CYF_SYNR3       DAGA-------------------SVVTIAGDDG-NVEETIPAGPALVVAVGDSVDAGEAL
CYF_SYNP6       ASG--------------------YDIVIRKADGSTVTDAVPAGPSPIVAVGSEVAAGAAL
CYF_SYNE7       ASG--------------------YDIVIRKADGSTVTDAVPAGPSPIVAVGSEVAAGAAL
CYF_SYNJB       DSDISDLPAELASLVPPEYELPGTRVLSFESESGIHNLVVPPGPELVVAVGDSVKEGDPV
CYF_SYNJA       ESDLSDLPPELAALVPPEYELPGTRVLSFETEGGLKHLVVPPGPELVVNIGDSVQEGDPV
                                                          *    .   . :     :

CYF_BRARR       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_LOBMA       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_ARAHI       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_DRANE       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_ARATH       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_CRUWA       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_CAPBU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_OLIPU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_LEPVR       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_NASOF       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_BARVE       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_AETCO       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_AETGR       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_CARPA       TSNPNVGGFGQGDAEIVLQDPSRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_GOSBA       TINPNVGGFGQGDAEIVLQDPLRVQGLLFFLASIVFAQIFLVLKKKQFEKVQVSEMNF-
CYF_GOSHI       TINPNVGGFGQGDAEIVLQDPLRVQGLLFFLASIVFAQIFLVLKKKQFEKVQVSEMNF-
CYF_CITSI       TSNPNVGGFGQADAEIVLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF-
CYF_POPAL       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_POPTR       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_MANES       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_PELHO       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLTSVLLAQIFLVLKKKQFEKVQLSEMNF-
CYF_SOYBN       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASIILAQIFLVLKKKQFEKVQLSEMNF-
CYF_PHAVU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASIILAQIFLVLKKKQFEKVQLFEMNF-
CYF_LOTJA       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASIIFAQIFLVLKKKQFEKVQLSEMNF-
CYF_MORIN       TSNPNVGGFGQGDAEIVLQDPLRVQGLLLFLASIILAQIFLVLKKKQFEKVQLSEMNF-
CYF_CUCSA       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_OENEH       TSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_OENAR       TSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_OENBI       TSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_OENGL       TSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_OENPA       TSNPNVGGFGQGDAEVVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_EUCGG       TSNPNVGGFGQGDAEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_DAUCA       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_PANGI       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_VITVI       TSNPNVGGFGQGDAEIVLQDPLRIQGLLFFLSSVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_SOLBU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_SOLLC       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_SOLTU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_ATRBE       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_NICSY       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_TOBAC       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_NICTO       TSNPNVGGFGQGDAEIVFQDPLRAQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_CUSEX       TSNPNVGGFGQGDGEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNL-
CYF_IPOPU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_JASNU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_COFAR       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_HELAN       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFAAVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_LACSA       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_SPIOL       TSNPNVGGFGQGDAEVVLQDPLRIQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_AGRST       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_LOLPR       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_WHEAT       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_HORVU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_ORYNI       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_ORYSA       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_ORYSI       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_ORYSJ       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_SACHY       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_SACOF       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_SORBI       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_MAIZE       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF-
CYF_CERDE       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_CALFG       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_LIRTU       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_CHLSC       TSNPNVGGFGQGGAEIVLQDPLRVQGLLFFLASIILAQIFLVLKKKQFEKVQLSEMNF-
CYF_DRIGR       TNNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_ACOCL       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLYEMNF-
CYF_PHAAO       TSNPNVGGFGQGDTEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLYEMNF-
CYF_DIOEL       TSNPNVGGFGQGDAEIVLQDPLRIQGLLFFLASVILAQIFLVLKKKQFEKVQLYEMNF-
CYF_NYMAL       TSNPNVGGFGQGDAEIVLQDPLRIQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_ILLOL       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_PIPCE       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVTLAQIFLVLKKKQFEKVQLSEMNF-
CYF_LEMMI       TSNPNVGGFGQGDAEIVLQDPSRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLFEMNF-
CYF_BUXMI       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_PLAOC       TSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_NANDO       TSNPNVGGFGQGDAEIVLQDPSRVQGLFFFFASVILAQIFLVLKKKQFEKVQLSEMNF-
CYF_AMBTC       TSNPNVGGFGQGDAEIVLQDPLRIQGLFLFLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_CUSGR       TSNPNVGGFGQDVAEVVLQDPSRVQVLLFFFASIILAQIFLVLKKKQFEKVQLTKINL-
CYF_CUSOB       TSNPNVGGFGQDVAEVVLQDPSRVQVLLFFFASIILAQIFLVLKKKQFEKVQLTKINL-
CYF_PINKO       TNNPNMGGFGQGDAEIVLQDPLRVKGLLLFLASVILAQIFLVLKKKQFEKVQLAEMNL-
CYF_PINTH       TNNPNLGGFGQGDAEIVLQDPLRVKGLLLFLASVILAQIFLVLKKKQFEKVQLAEMNL-
CYF_CYCTA       TNNPNVGGFGQGDAEIVLQDPLRVQGLLLLLASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_CRYJA       TNNPNVGGFGQENAEIVLQDPLRVQGLLLFLASVVLAQIFLVLKKKQFEKVQLVEMNF-
CYF_MARPO       TNNPNVGGFGQGDAEVVLQDPLRIQGLLLFFGSVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_PHYPA       TNNPNVGGFGQGDAEIVLQDPLRVQSLLVFFVSVTLAQIFLVLKKKQFEKVQLAEMNF-
CYF_PSINU       TNNPNLGGFGQGDTEIVLQNPLRIQGLLLFFVSVIMAQILLVLKKKQFEKVQLAEMNL-
CYF_HUPLU       TNNPNVGGFGQGDAEVVPQDPLRVQGLLLFLASVTIAQIFLVLKKKQFEKVQLAEMNF-
CYF_ANTAG       TNNPNVGGFGQGDAEIVLQDVLRVQGLLLFFASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_GNEPA       TNNPNVGGFGQINAEIVLQDPSRIQGLLGFLASVVLAQIFLVLKKKQFEKVQLAEMEF-
CYF_ADICA       TNNPNVGGFGQGEVEIVLQDPRRIQGLLAFFASVVLAQIFLVLKKKQFEKVQLAEMNF-
CYF_ANGEV       TNNPNVGGFGQGDAEIVLQDPLRIQGLLLFFASVVLAQIFLVLKKKQFEKVQLAEMNF-
CYF_CHAVU       TNNPNVGGFGQANTEIVLQNPLRMEGLILFFISVILAQVFLVLKKKQFEKVQIAEMNF-
CYF_STAPU       TNNPNVGGFGQADAEIVLQDPLRIQGLLVFFASVILAQIFLVLKKKQFEKVQLAEMNF-
CYF_ZYGCR       TNNPNVGGFGQADAEIVLQDPLRIQGLLVFFASVVLAQIFLVLKKKQFEKVQLAEMNF-
CYF_CHAGL       TTNPNVGGFGQADGEIVLQDPARLQGLLVFLFLVVLAQVFLVLKKKQYEKVQLAEMNF-
CYF_CHLRE       TNNPNVGGFGQAETEIVLQNPARIQGLLVFFSFVLLTQVLLVLKKKQFEKVQLAEMNF-
CYF_TETOB       TNNPNVGGFGQKDVEIVLQNPARIQGLLVFFATVLFAQVLLVLKKKQFEKVQLAEMNF-
CYF_TUPAK       TNNPNVGGFGQAEAEIVLQNPARVQGLIIFLITIFITQLFLVLKKKQVEKVQLAEMNF-
CYF_CHLVU       TTNPNVGGFGQGETEVVLQNPLRIQGLLVFFLFVLLAQVFLVLKKKQFEKVQLAEMNF-
CYF_OLTVI       TNNPNVGGFGQGEAELVLQNPARIQGLLLFLLATIGAQVFLVLKKKQFEKVQLAEMNF-
CYF_BIGNA       TTDPNVGGFGQSETEIGLQNPIRVQGLLLFSLFILLAQIFLVLKKKQFEKVQLFEMNF-
CYF_NEPOL       TNNPNVGGFGQAETEVVLQNPARVQGLIIFFAFVLIAQVFLVLKKKQFEKVQLSEMNF-
CYF_OSTTA       TNNPNVGGFGQGETEIVLQNPARLQGLVIFLGFVLIAQVFLVLKKKQFEKVQLSEMNF-
CYF_CHLAT       TKNPNVGGFGQTEGEIVLQNPARIQGLIAFFISVIIAQTFLVLKKKQFERVQLAEMNF-
CYF_MESVI       TDNPNVGGFGQMDTEVVLQNPVRIKWLIAFLILSTLGQVFLVLKKKQFERVQIAESNF-
CYF_CYAPA       TIDPNVGGFGQMDTEIVLQSAGRVQGLIAFFISVVLAQIFLVLKKKQFEKVQAAEMNF-
CYF_CYACA       TTDPNVGGFGQSEIEIVLQNPTRLISFIFFSISVLISQLFFVLKKKQFEKVQSLNQNF-
CYF_CYAM1       TMDPNVGGFGQAEKEIVLQNPTRLKTFIAFCVTVFIGQLAFVLKKKQVERVQASEMN--
CYF_PORPU       SKDPNVGGFGQNETEIVLQSPNRIKGMIAFFFVSVLAQIFFVLKKKQFEKVQAAEMNF-
CYF_PYRYE       NSDPNVGGFGQNETEIVLQSPNRIKGMIVFFFASVLAQIFFVLKKKQFEKVQAAEMNF-
CYF_GRATL       TDDPNVGGFGQTEIEIVLQSPSRIKGMIVFFFTVTIAQIFFVLKKKQWEKVQAAEINF-
CYF_GUITH       TNDPNVGGFGQVETEIVLQSPARVKGLIAFFFTVILAQILLVLKKKQFEKVQLAEMNF-
CYF_RHDSA       TVDPNVGGFGQTETEIVLQSPARVKGLIAFFFTVILAQILLVLKKKQFEKVQLAEMNF-
CYF_TRICV       NIDPNVGGFGQEETEIVLQNPLRIIGYLGFCFCVLLTQVLLIIKKKQFEKVQAAELNF-
CYF_THAPS       NIDPNVGGFGQEESEIVLQSSSRILGYLAFCFCLLLTQVLLVLKKKQYEKVQAAELNF-
CYF_PHATC       NIDPNVGGFGQEESEIVLQNPIRIYGYLAFCFSVLITQIMLVLKKKQFEKVQAAELNF-
CYF_EMIHU       SYNPNVGGFGQAETEVILQSPNRVKGMIAFFFTVTVAQILLVLKKKQFEKVQAAEMNF-
CYF_NOSS1       TNNPNVGGFGQLDAEIVLQDANRVGWLIAFVALVMLAQVMLVLKKKQVEKVQAA-EMNF
CYF_TRIV2       TNNPNVGGFGQLDAEIVLQDANRVGWLIAFVALVMLAQVMLVLKKKQVEKVQAA-EMNF
CYF_MICAN       TSNPNVGGFGQKDTEVVLQNPGRIKGLVLFLGGIMLCQILLVIKKKQVETVQAA-EMNF
CYF_SYNP2       TNNPNVGGFGQKDTEVVLQNPARIYGYMAFVAGIMLTQIFLVLKKKQVERVQAAGQLDF
CYF_SYNY3       TNNPNVGGFGQKDTEVVLQNPTRIKFLVLFLAGIMLSQILLVLKKKQIEKVQAA-ELNF
CYF_TRIEI       TNNPNVGGFGQADTEIVLQDANRVKWLMAFFALVMLAQIMLVLKKKQVEKVQAA-EMNF
CYF_THEEB       TNNPNVGGFGQKDTEIVLQDPNRIKWLLVFFAAITLSQILLVLKKKQVEKVQAA-EMSF
CYF_ACAM1       SSDPNVGGFGQKDTEIVLQSGTRIKWLMVFFSAIMISQTLLVLKKKQVEKVQAA-EMNF
CYF_PROMS       TNDPNVGGFGQLDAEVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI--
CYF_PROM0       TNDPNVGGFGQLDAEVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI--
CYF_PROM2       TNDPNVGGFGQLDAEVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI--
CYF_PROM9       TNDPNVGGFGQLDAEVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI--
CYF_PROM5       TSDPNVGGFGQLDAEVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI--
CYF_PROMP       TNDPNVGGFGQLDAEVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGV--
CYF_PROM1       TEDPNVGGFGQLDKEIVLQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI--
CYF_PROMT       TEDPNVGGFGQLDKEIVLQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI--
CYF_PROMA       TSDPNVGGFGQLDTEIVLQSPARVIGLIAFFAGVALTQILLVLKKKQVEKVQAAEGI--
CYF_PROM3       TSDPNSGGFGQLDTEVVLQNPVRIYGLLAFFVAVSLAQILLVLKKKQVEKVQAAEGI--
CYF_PROMM       TSDPNSGGFGQLDTEVVLQNPVRIYGLLAFFVAVSLAQILLVLKKKQVEKVQAAEGI--
CYF_SYNS3       TDDPNVGGFGQLDTEVVLQNPVRIYGMLAFFAAVALAQIMLVLKKRQIEKVQAAEGV--
CYF_SYNPW       TNDPNVGGFGQLDTEVVLQNPVRIYGLLAFFAAVALAQIMLVLKKKQFEKVQAAEGV--
CYF_SYNSC       TNDPNVGGFGQVDAEIVLQNPVRIYGLLAFFAAVALAQIMLVLKKRQIEKVQAAEGV--
CYF_SYNS9       TNDPNVGGFGQVDAEIVLQNPVRIYGLLAFFAAVAIAQIMLVLKKRQIEKVQAAEGNF-
CYF_SYNPX       TNDPNVGGFGQVDAEIVLQNPVRIYGLLAFFAAVALAQIMLVLKKRQIEKVQAAEGNF-
CYF_SYNR3       TDDPNVGGFGQMDAEVVLQNPVRLYGLLGFLAAVAIAQIMLVLKKKQIEKVQAAEGV--
CYF_SYNP6       TNDPNVGGFGQIDTEIVLQSSNRVLGVIAFFFAVMLAQIMLVLKKKQVEKVQAAELNF-
CYF_SYNE7       TNDPNVGGFGQIDTEIVLQSSNRVLGVIAFFFAVMLAQIMLVLKKKQVEKVQAAELNF-
CYF_SYNJB       TNNPNVGGFGQVERDLVLQSPDRVKWLVAFLAAITITQVLLVLKKKQVELIQAAEILG-
CYF_SYNJA       TNNPNVGGFGQVERDLVLQNPERVKWLVAFLAAVAITQLLLVLKKKQVELIQAAELLG-
                . :** *****   ::  *.  *    . :       *  :::**:* * :*