CLUSTAL format seed alignment for MF_00613

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSAE_CYAPA      -MVQRGSKVRILRKESYWYQEIGTVASIDQSG-IKYPVIVRFEKVNY-------SNVNSN
PSAE_PORPU      --MERGSKVKILRKESYWYQEIGTVAAMDKSG-IKYPVLVRFEKVNY-------NNVNTN
PSAE_GUITH      -MVKRGSKVRILRKESYWYQEVGTVATVDTSG-IRYPVVVRFEKVSY-------SGVNTN
PSAE_TRICV      -MISRGSKVRILRKESYWFNQVGTIATIDQSG-IRYPAVVRFENVNY-------SGTNTN
PSAE_CYACA      -MIKKGSQVRILRPESYWHNEIGTVATVDQSG-IRYPVIVRFDKVNY-------SGINTN
PSAE_NOSS1      -MVQRGSKVRILRPESYWFQDVGTVASVDQSG-IKYPVIVRFDKVNY-------AGINTN
PSAE_NOSS8      -MVQRGSKVRILRPESYWFQDVGTVASVDQSG-IKYPVIVRFEKVNY-------SGINTN
PSAE_MICDP      --VQRGSKVRILRPESYWFQDVGTVASIDQSG-IKYSVIVRFDKVNY-------SGINTN
PSAE_MASLA      -MVQRGSKVRILRPESYWFQDIGTVASIEQGGTIRYPVIVRFDKVNY-------AGVNTN
PSAE_GLOVI      MAIERGAKVRILRKESYWYREVGTVASVDKSEKTIYPVTVRFEKVNY-------SGINTN
PSAE_THEEB      -MVQRGSKVKILRPESYWYNEVGTVASVDQTPGVKYPVIVRFDKVNYTGYSGSASGVNTN
PSAE_PROMA      MAISRGDKVRVKRPESYWYNEIGKVASVDTSG-IKYPVVVRFEKVNYSAFSGVDGGNNTN
PSAE_PROMP      MAISRGDLVRVKRPESYWYNEIGKVASVDTTG-IKYNCVVRFEKVNYAGISGTEGGANTN
PSAE_PROMM      MAISKGDKVRIRREESYWHNEVGTVASVDTTG--KYGVLVRFEKTNYFGMQGTDNGNLTN
PSAE_SYNPX      MAISRGAKVRIKRPESYWFNEVGTVASIDTSG-IRYPVVVRFEKVNYTGIDGTDGGVNTN
PSAE_SYNP6      MAIARGDKVRILRPESYWFNEVGTVASVDQSG-IKYPVVVRFEKVNYNGFSGSDGGVNTN
PSAE_SYNP2      MAIERGSKVKILRKESYWYGDVGTVASIDKSG-IIYPVIVRFNKVNYNGFSGSAGGLNTN
PSAE_SYNY3      MALNRGDKVRIKRTESYWYGDVGTVASVEKSG-ILYPVIVRFDRVNYNGFSGSASGVNTN
                  : :*  *:: * ****. ::*.:*:::      *   ***:...*        .  :*

PSAE_CYAPA      NFSLDEVVEVEPPPSKKKA-
PSAE_PORPU      SFADNELIDLGK--------
PSAE_GUITH      NFSLDEVIEVNEK-------
PSAE_TRICV      NFALEELIEVSEVETKSKEA
PSAE_CYACA      NFAVNELVEIQTNSYKAK--
PSAE_NOSS1      NFAVDELIEVEAPKAKAKK-
PSAE_NOSS8      NFAEDELVEVEAPKAKPKK-
PSAE_MICDP      NFAEDELLEVAPPAAK----
PSAE_MASLA      NFAEYELVEVEAPKAKPKK-
PSAE_GLOVI      NFGVSELEEVEA--------
PSAE_THEEB      NFALHEVQEVAPPK-KGK--
PSAE_PROMA      NFAEAELEAV----------
PSAE_PROMP      NFAESELEKA----------
PSAE_PROMM      SFAESELDRA----------
PSAE_SYNPX      NFSEAELELA----------
PSAE_SYNP6      NFAEAELQVVAAAAKK----
PSAE_SYNP2      NFAEHELEVVG---------
PSAE_SYNY3      NFAENELELVQAAAK-----
                .*.  *: