CLUSTAL format seed alignment for MF_00614

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FEN_HYPBU        MGVN-IREVIPPEAI---QEI-DLAHLKYKVVAIDAYNALYQFLTAIRQPDGTP------
FEN_STAMF        MGVN-LKDLIPEEAK---MTIEDLRMLRGKIVVIDGYNALYQFLTAIRQPDGTP------
FEN_AERPE        MGVN-LRELIPPEAR---REV-ELRALSGYVLALDAYNMLYQFLTAIRQPDGTP------
FEN_THEPD        MGVD-IKELVEPVAK---EVE--LGFFSKKVIAIDAYNSLYQFLATIRQKDGTP------
FEN_IGNH4        MGVTALRELIPSKCK---KTL-ELKSLSNKSVALDAYNTLYQFLAAIRGEDGRP------
FEN_PYRAB        MGVP-IGELIPRK-------EIELENLYGKKIAIDALNAIYQFLSTIRQRDGTP------
FEN_PYRHO        MGVP-IGDLVPRK-------EIDLENLYGKKIAIDALNAIYQFLSTIRQRDGTP------
FEN_PYRFU        MGVP-IGEIIPRK-------EIELENLYGKKIAIDALNAIYQFLSTIRQKDGTP------
FEN_THEKO        MGVQ-IGELIPRK-------EIELESLYGKKVAIDAFNAMYQFLSTIRQRDGTP------
FEN_THEON        MGVQ-IGELIPRK-------EIELENLYGRRVAIDAFNAIYQFLSTIRQRDGTP------
FEN_THEGJ        MGVQ-IGELVPRK-------EIELENLYGKKVAIDAFNAMYQFLSTIRQRDGTP------
FEN_THESM        MGVP-IGELLPKK-------ELELENLNGRKVAIDAFNAIYQFLSTIRQKDGTP------
FEN_KORCO        MGVK-IGELIEDKV------ELELSDIAGKKIALDAFNAMYQFLAKVRQPDGTP------
FEN_METAC        MGTD-IGDLLQKR-------KIELSDLSNRVVAVDAFNTLHQFLSIIRQRDGSP------
FEN_METBF        MGTD-IGDLLQKR-------KIELSDLTNQVVAIDAFNTLHQFLSIIRQRDGNP------
FEN_METMA        MGTD-IGDLLQKR-------KIELSDLSNRVVAVDAFNTLHQFLSIIRQRDGSP------
FEN_METBU        MGTD-IGDLLLKD-------TIEIAGLSNKVVAIDAYNTLYQFLSIIRQRDGTP------
FEN_METAR        MGVD-LGGLVEPR-------EIELKELNNRTVAVDAYNTLYQFLSIIRQQDGAP------
FEN_METTP        MGVD-LGDILSKK-------KISLENLSGCWIAVDGFNTLYQFLSIIRQPDGTP------
FEN_ARCFU        MGAD-IGDLFERE-------EVELEYFSGKKIAVDAFNTLYQFISIIRQPDGTP------
FEN_SACS2        --MD-LADLVKDVKR-----ELSFSELKGKRVSIDGYNALYQFLAAIRQPDGTP------
FEN_SULTO        --MD-LAELVEEIKK-----ELSFAELKGKKISIDAYNALYQFLAAIRQPDGTP------
FEN_SULAC        --MD-LGEIVEDVKR-----EINLNEMKGKKISIDAYNTIYQFLAAIRQPDGTP------
FEN_NANEQ        MGVN-LKEIVDPVKK-----EIEFKQLFGKVIAIDAFNALYQFLFSIRQ-DGEP------
FEN_PYRAE        MGVTELGKLIGKEVR---R-EVKLESLSGKCIALDAYNALYQFLASIRQPDGTP------
FEN_PYRAR        MGVTELGKLIGKEAR---R-EVKLEALAGRCVALDAYNALYQFLASIRQPDGTP------
FEN_PYRIL        MGVTELGKLIGKDIR---R-EVKLENLAGKCIALDAYNSLYQFLASIRQPDGTP------
FEN_PYRNV        MGVTELGKLIGREAR---R-EIKLENLAGRCIALDAYNALYQFLASIRQPDGTP------
FEN_PYRCJ        MGVTELGKLIGKEAR---R-EIKLESLAGKCVALDAYNALYQFLASIRQPDGTP------
FEN_CALMQ        MGVTELGKLIPDNLR---R-RVSLEQLNGKLIALDAYNALYQFLASIRQPDGTP------
FEN_METKA        MGLAELRELIEPE-------ETDLRALAGREIAIDAFNALYQFLTTIMK-DGRP------
FEN_CENSY        MGLD-LKALVSRE-------PTRLESFATKVVAIDAYNAIYQFLATIRGPDGMQ------
FEN_NITMS        MGLN-LKDLVVRE-------KTTLEAFSNKVIAIDAYNAIYQFLASIRGPDGLQ------
FEN_METTH        MGVK-LRDVVSPRR-------IRLEDLRGRTVAVDAANTLYQFLSSIRQRDGTP------
FEN_METS3        MGVK-LKDIIQPEQ-------IDFKDLKGRAISIDAFNTLYQFLSTIRQRDGRP------
FEN_METST        MGVK-FKDITNPEP-------IEMKELEGKILTVDASNVIYKFLSSMRQTDGTP------
FEN_METMJ        MGVA-IRDILADCKE---T--LTWDDLSG-IAALDAHNALYQFLSIIRQPDGTP------
FEN_METB6        MGVA-LRDILADYKT---P--VTWEGLSG-VAAVDANNTLYQFLTIIRQPDGTP------
FEN_METPE        MGVA-LREVLTEYKH---P--RTWETLAG-TAAIDGNNALYQFLSIIRQPDGTP------
FEN_METHJ        MGVA-LRDILTDLKR---P--AETDELKG-VAAIDAFNALYQFLSIIRQPDGTP------
FEN_METLZ        MGVA-LRPLLAEYKE---S--PGWDGLGG-IAAVDAFNALYQFLSGIRQADGAP------
FEN_THEAC        MGTD-ISDIVVSHE-------TSLKDQGNQTFSIDTYNILYQLLSNVRQYDGMP------
FEN_THEVO        MGTD-ISDIVVSHQ-------TSLKDQANQVFAIDTYNILYQLLSNVRQYDGTP------
FEN_PICTO        MGVN-LSSILIKHE-------TSLKDNSGSIVSVDAYNIIYQFLSSIRGDDGEP------
FEN_METJA        MGVQ-FGDFIPKNI-------ISFEDLKGKKVAIDGMNALYQFLTSIRLRDGSP------
FEN_META3        MGVQ-FNDSIPKKN-------ISITDLKNKTVAIDSMNIIYQFLSSIRLRDGAP------
FEN1_LEIIN       MGILGLSKLLYDKSPNAIREQE-LKNFFGRRIAIDASMSIYQFIIAMKGFQDGQG---LE
FEN1_LEIMA       MGILGLSKLLYDKSPNAIREQE-LKNFFGRRIAVDASMSIYQFIIAMKGFQDGQG---LE
FEN1_LEIBR       MGILGLSKLLYDKSPNAIRERE-LKSFFGRRIAIDASMSIYQFIIAMKGFQDGQG---ME
FEN1_TRYB2       MGVLGLSKLLYDRTPGAIKEQE-LKVYFGRRIAIDASMAVYQFVIAMKGFQEGQS---VE
FEN1_TRYB9       MGVLGLSKLLYDRTPGAIKEQE-LKVYFGRRIAIDASMAVYQFVIAMKGFQEGQS---VE
FEN1_TRYCC       MGILGLSKLLYDRSPAAIRERE-LKNYFGRRIAIDASMTIYQFIIAMKGFQDGQG---ME
FEN1_ARATH       MGIKGLTKLLADNAPSCMKEQK-FESYFGRKIAVDASMSIYQFLIVVGRTGTEM------
FEN1_SOYBN       MGIKGLTKLLADNAPKSMKENK-FESYFGRKIAIDASMSIYQFLIVVGRSGTEM------
FEN11_ORYSI      MGIKGLTKLLADNAPKAMKEQK-FESYFGRRIAVDASMSIYQFLIVVGRTGMET------
FEN11_ORYSJ      MGIKGLTKLLADNAPKAMKEQK-FESYFGRRIAVDASMSIYQFLIVVGRTGMET------
FEN11_SORBI      MGIKGLTKLLADNAPKAMKEQK-FESYFGRKIAIDASMSIYQFLIVVGRTGMET------
FEN1_MAIZE       MGIKGLTKLLADNAPKAMKEQK-FESYFGRKIAVDASMSIYQFLIVVGRTGMET------
FEN11_PHYPA      MGIKGLTKLIADNAHGAVKEQK-FENYFGRKIAIDASMSIYQFLIVVGRSGSEL------
FEN1_OSTLU       MGIKGLTALMRDNAPGAIKEQK-FESYLDRRVAIDASMHIYQFMMVVGRQGEQQ------
FEN1_OSTTA       MGIKGLTALLSENAPGAMREQK-FTSYLDRRVAIDASMHIYQFMIAVGRTGEQT------
FEN1_MICCC       MGIKGLTKLLSDYAPGCMREQK-FEGYLDRKVAIDASMHIYQFMMVVGRSGEQQ------
FEN1_CHLRE       MGIHGLTKLLGDNAPGCIKETK-FENLFGRKVAVDASMHIYQFMVVVGRQGDQL------
FEN1_NAEGR       MGIKGLSQLILDEAKDSVKEDQ-LKNYFGRKVAIDASMAMYQFLIALKNTGMD-------
FEN1_BOVIN       MGIQGLAKLIADVAPSAIREND-IKSYFGRKVAIDASMSIYQFLIAVR-QGGDV------
FEN1_SHEEP       MGIQGLAKLIADVAPSAIREND-IKSYFGRKVAIDASMSIYQFLIAVR-QGGDV------
FEN1_HUMAN       MGIQGLAKLIADVAPSAIREND-IKSYFGRKVAIDASMSIYQFLIAVR-QGGDV------
FEN1_MACFA       MGIQGLAKLIADVAPSAIREND-IKSYFGRKVAIDASMSIYQFLIAVR-QGGDV------
FEN1_MOUSE       MGIHGLAKLIADVAPSAIREND-IKSYFGRKVAIDASMSIYQFLIAVR-QGGDV------
FEN1_RAT         MGIQGLAKLIADVAPSAIREND-IKSYFGRKVAIDASMSIYQFLIAVR-QGGDV------
FEN1_CHICK       MGIHGLAKLIADVAPSAIREND-IKSYFGRKVAIDASMSIYQFLIAVR-QGAEV------
FEN1A_XENLA      MGIHGLAKLIADVAPAAIKEHD-IKSYFGRKVAVDASMCIYQFLIAVR-QDGNT------
FEN1B_XENLA      MGIHGLAKLIADVAPAAIKEHD-IKSYFGRKVAVDASMCIYQFLIAVR-QDGNM------
FEN1_XENTR       MGIHGLAKLIADVAPAAIKEHD-IKSYFGRKVAVDASMCIYQFLIAVR-QDGNM------
FEN1_ANOFI       MGIHGLTKLIADQAPGAIKEQD-IKNYFGRKIAIDASMCLYQFLIAVR-QDGNV------
FEN1_XIPMA       MGIHGLAKLIADHAPGAIKEQD-IKNYFGRKIAIDASMCIYQFLIAVR-QDGNV------
FEN1_SALSA       MGIHGLAKLIADQAPSAIKEQD-IKNYFGRKIAIDASMCMYQFLVAVR-QDGNV------
FEN1_OSMMO       MGIHGLAKLIADQAPGAIKEQE-MKNFFGRKIAIDASMCIYQFLIAVR-QDGNV------
FEN1A_DANRE      MGIHGLAKLIADHAPSAIKEHE-IKSYFGRKIAIDASMCIYQFLIAVR-QDGNV------
FEN1_BRAFL       MGIQGLAKLIGDHAPGAMKENE-IKNYFGRKVAIDASMSIYQFLIAVR-QDGNM------
FEN1_NEMVE       MGIQGLAKLLGDIAPSGIKENE-IKNYFGRKIAIDASMSIYQFLIAVR-SDGSQ------
FEN1_TRIAD       MGIHGLAKLIADHAPSAIKENE-IKNYFGRKVAIDASMSIYQFLIAVR-SDGNV------
FEN1_AEDAE       MGIKGLSQLIADLAPFAVKEGE-IKNFFGRKVAIDASMCLYQFLIAVR-AEGAQ------
FEN1_ANOGA       MGIKGLSQLIADIAPFAVKEGE-IKQFFGRKVAIDASMCLYQFLIAVR-AEGAQ------
FEN1_GLOMM       MGILGLSKLIADICPQAIKESD-IKNYFGRKVAIDASMCLYQFLIAVR-AEGAQ------
FEN1_DROER       MGILGLSKLIADLAPQAIRESE-MKHFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROYA       MGILGLSKLIADLAPQAIRESE-IKNFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROSE       MGILGLSKLIADLAPQAIRESE-MKHFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROSI       MGILGLSKLIADLAPQAIRESE-MKHFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROME       MGILGLSKLIADLAPQAIRESE-MKHFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROPE       MGILGLSKLIADLAPQAIRESE-MKHFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROPS       MGILGLSKLIADLAPQAIRESE-MKHFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROAN       MGILGLSKLIADLAPQAIRESE-IKNFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROWI       MGILGLSKLIADLAPQAIRESE-IKNFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROGR       MGILGLSKLIADLAPLAIRESE-IKNFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROMO       MGILGLSKLIADLAPLAIRESE-IKNFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_DROVI       MGILGLSKLIADLAPQAIRESE-IKNFFGRKVAIDASMCLYQFLIAVR-SEGAQ------
FEN1_MONBE       MGIHDLSKVIADKAPDAIKETE-IKNLFDRKVAIDASMSIYQFLIAIR-SEGSN------
FEN1_CAEBR       MGIKGLSQVIADHAPSAIKVQE-IKAFFGRKVAIDASMCLYQFLIAIR-QDGSQ------
FEN1_CAEEL       MGIKGLSQVIADNAPSAIKVNE-MKAFFGRTVAIDASMCLYQFLIAVR-QDGSQ------
FEN1_BRUMA       MGVKDLSKVIGDHSPNSIRLKE-FKGYFGRKVAVDASMCLYQFLIAVR-QDGSQ------
FEN1_AJECH       MGIKHLYQIIQENAPDAVKAGE-IKNHFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_AJECN       MGIKHLYQIIQENAPDAVKAGE-IKNHFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_AJEDR       MGIKHLYQVIQENAPDAVKAGE-IKNHFGRKVAIDASMSIYSFLVAVR-SDGQQ------
FEN1_UNCRE       MGIKHLYQIISENAPDAVKSGE-IKNQFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_ASPFU       MGIKHLFQVIQENAPDAIKAGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_ASPFC       MGIKHLFQVIQENAPDAIKAGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_NEOFI       MGIKHLFQVIQENAPDAIKAGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_ASPCL       MGIKHLFQVIQENAPDAVKSGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_ASPFN       MGIKHLYQVIAENAPDAIKAGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_ASPTN       MGIKQLYQVISENAPDAIKAGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_EMENI       MGIKHLYQVIAENAPDAIKAGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_ASPNC       MGIKQLYQVISENAPDAIKAGD-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_PENRW       MGIKHLYQVISENAPDAIKTGE-IKNHFGRKVAIDASMSIYSFLIAVR-SEGQQ------
FEN1_TALMQ       MGIKHLYQVISENAPDAVKTGE-IKNHFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_TALSN       MGIKHLYQVISENAPDAVKTGE-IKNHFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_ARTOC       MGIKSLYQIISENAPDAIKAGE-IKNQFGRKVAIDAYVKTAQRYRAST-DE-EQ------
FEN1_PHANO       MGIKHLYQLIQEHSPDAIKTGE-IKNQFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_PYRTR       MGIKHLYQLIEEHTPEAVKKGE-IKNQFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_NEUCR       MGIKQLFSVIKDEAPDAIKEGE-IKNQFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_SORMK       MGIKQLFSIIKDEAPAAIKEGD-IKNQFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_FUSV7       MGIKQLFQIIKEEAPDAIKEGE-IKNQFGRKVAIDASMSIYSFLIAVR-SDGQQ------
FEN1_MAGO7       MGIKQLFTIIKENAPAAIKTGE-IKNQFGRKVAIDASMSIYSFLIAVR-SNGEM------
FEN1_COPCI       MGIKGLTGLLNEHAPNSIKEHD-IKTLFGRKVAIDASMSIYQFLIAVRQRDGEM------
FEN1_COPC7       MGIKGLTGLLNEHAPNSIKEHD-IKTLFGRKVAIDASMSIYQFLIAVRQRDGEM------
FEN11_LACBS      MGIKGLTGLLSQHAPKAIQEHE-IKTLFGRKVAIDASMSIYQFLIAVRQKDGEL------
FEN12_LACBS      MGIKGLTGLLSQHAPKAIK--E-IKTLFGRKVAIDASMSIYQFLIAVRQKDGEL------
FEN1_CRYNJ       MGIKGLTGLLSENAPKCMKDHE-MKTLFGRKVAIDASMSIYQFLIAVRQQDGQM------
FEN1_USTMA       MGIKGLTALISDEAPGAIKEME-IKTYFGRKVAIDASMSLYQFLIAVRQNDGQQ------
FEN1_SCHJY       MGIKGLSQVIADNCPSAVRHND-IKNYFGRKVAIDASMSLYQFLIQVRGQDGQQ------
FEN1_SCHPO       MGIKGLAQVLSEHAPASVKHND-IKNYFGRKVAIDASMSLYQFLIQVRSQDGQQ------
FEN1_ASHGO       MGIKGLNSIIQQQVPSAIRPRE-MKQFFGRRVAIDASMSLYQFLIAVRQADGVQ------
FEN1_KLULA       MGIKNLATLISEQVPNAIKSRD-IKYFHGRKVAIDASMSLYQFLIAVRQQDGVQ------
FEN1_YEAST       MGIKGLNAIISEHVPSAIRKSD-IKSFFGRKVAIDASMSLYQFLIAVRQQDGGQ------
FEN1_YEAS7       MGIKGLNAIISEHVPSAIRKSD-IKSFFGRKVAIDASMSLYQFLIAVRQQDGGQ------
FEN1_YEAS2       MGIKGLNAIISEHVPSAIRKSD-IKSFFGRKVAIDASMSLYQFLIAVRQQDGGQ------
FEN1_YEAS8       MGIKGLNAIISEHVPSAIRKSD-IKSFFGRKVAIDASMSLYQFLIAVRQQDGGQ------
FEN1_YEAS1       MGIKGLNAIISEHVPSAIRKSD-IKSFFGRKVAIDASMSLYQFLIAVRQQDGGQ------
FEN1_VANPO       MGIKGLNAIISEHVPSAVRKSD-IKTFFGRKVAIDASMSLYQFLIAVRQQDGGQ------
FEN1_CANGA       MGIKGLNSIITEHVPSAIRKSD-IKAFFGRKVAIDASMSLYQFLIAVRQQDGGQ------
FEN1_ZYGRC       MGIKGLNAIISEHVPSAVRKSD-IKAFFGRKVAIDASMSLYQFLIAVRQQDGAQ------
FEN1_LACTC       MGIKGLNAIISEHVPSAVRKSE-IKNFFGRKVAIDASMSLYQFLIAVRQQDGVQ------
FEN1_CANAW       MGVKGLNQLIKEHSPSAYKEFQ-LKNLFGRKVAIDASMCLYQFLIAVRQSDGQQ------
FEN1_CANAL       MGVKGLNQLIKEHSPSAYKEFQ-LKNLFGRKVAIDASMCLYQFLIAVRQSDGQQ------
FEN1_CANDC       MGVKGLNQLIKEHSPSAYKEFQ-LKNLFGRKVAIDASMCLYQFLIAVRQSDGQQ------
FEN1_CANTT       MGVKGLNKLIKEHSPNAYKEYQ-LKNLFGRKVAIDASMCLYQFLISVRQSDGQQ------
FEN1_LODEL       MGVKGLNQLIKEHSPHAYKEFE-LKNLFGRKVAIDASMCLYQFLIAVRQSDGQQ------
FEN1_PICST       MGVKGLNQLIKEHSPGAFKEFQ-LKNLFGRKVAIDASMCLYQFLIAVRQSDGQQ------
FEN1_CLAL4       MGVKGLNQLIKEHAPDAFKEYQ-LKNLFGRKVAIDASMCLYQYLIAVRQQDGQQ------
FEN1_PICGU       MGVKGLNQLIKEHAPEAFREFQ-LKNLFGRKVAIDASMCLYQYLIAVRQSDGQQ------
FEN1_DEBHA       MGVKGLNQLIKEHAPEAFKEFQ-LKNLFGRKIAIDASMCLYQFLIAVRQAEGQQ------
FEN1_KOMPG       MGIKGLNALINEHSPKAFRNGE-MKTFFGRKVAIDASMCLYQFLIAVRQQDGQQ------
FEN1_YARLI       MGIKGLNKLLMEHCPAALRSSE-IKNFGGRKVAIDASMSLYQFVIAVRQADGQQ------
FEN1_DICDI       MGIKKLTDLIEDNAPTSIKTNI-LKNYFGRIIAIDASTSLYQFLIAMNADVSSA------
FEN1_POLPP       MGIKNLTSLIEENAPSAIKSND-LKSYSGRIVAIDASTSMYQFLIAINTEMGAA------
FEN11_PARTE      MGIHQLMQFLKEKAPNCFRTLM-LDYFAGRTIGCDASMAMYQFLIQTQSAGQTQI---IE
FEN12_PARTE      MGIHQLMQFLKEKAPNCFRTLM-LDYFAGRTIGCDASMAMYQFLIQTQSAGLTQI---IE
FEN1_TETTS       MGIHKLMDLLKEKAPGCIKTSD-LKFYAGRMIACDASMAMYQFLATTSSASDFQI---QN
FEN1_PHATC       MGIKGLAKLLSDEAPDCIREVE-LKSLHGRKIAIDASMAIYQFLIAVRSGGPNQQ--ATM
FEN1_THAPS       MGIKGLAKLLSDEAPLSLKEVP-LSHLHGRKLAIDASMAIYQFLIAVRSGGPGGQNAAMM
FEN1_PHYIT       MGIKGLMKLLQEEAPSCIKEVEKMSALAGHAVAIDASMALYQFLIAIRSADGGGP--SQA
FEN1_ENTDS       MGIKGLSKLLARYAPKSMKEGK-IDQYSGRVIAIDASILVYQFISAVRDTTGAT------
FEN1_ENTHI       MGIKGLSKLLARYAPKSMKEGK-IDQYSGRVIAIDASILVYQFISAVRDTTGAT------
FEN1_ENCCU       MGIKQLSKLLRENSKRGIRERP-LVYYSSKKVAIDASMSMYQFLIAVR-SGGAT------
FEN1_ENTBH       MGIKRLSKLIKTYCSEGVQNRE-LKYYSGYKIAIDASMCIYQFLVAVR-AEGQS------
FEN1_PLABA       MGIKGLTKFIADTAPNAIKEIK-IENLMGRVVAIDASMSLYQFIIAIRDGDQYGN-----
FEN1_PLAYO       MGIKGLTKFIADTAPNAIKEIK-IENLMGRVVAIDASMSLYQFIIAIRDGDQYGN-----
FEN1_PLACH       MGIKGLTKFIADTAPNAIKEIK-IENLMGRVVAIDASMSLYQFIIAIRDGDQYGN-----
FEN1_PLAKH       MGIKGLTKFIADAAPNAIKEIK-IENLMGRVVAIDASMSLYQFIIAIRDSEQYGN-----
FEN1_PLAVS       MGIKGLTKFIADAAPNAIKEIK-IENLMGRVVAIDASMSLYQFIIAIRDSEQYGN-----
FEN1_PLAFA       MGIKGLTKFIADAAPNAIKEIK-IESLMGRIIAIDASMSLYQFIIAIRDSEQYGN-----
FEN1_PLAF7       MGIKGLTKFIADAAPNAIKEIK-IESLMGRIIAIDASMSLYQFIIAIRDSEQYGN-----
FEN1_CRYMR       MGIKGLARFLVDNAPKSIQQQS-IDSLIGRIIAIDASMWMYQFLAAIREGSQWGN-----
FEN1_CRYPI       MGIKGLTKFLADNAPKSIQQQG-IGSLLGKRVAIDASMWIYQFLAAIREGSQWGN-----
FEN1_GIAIC       MGIRGLAKLIEEVAPAAVSKRL-IQHYCNKVIAIDASVMLYQFITTITSGDGTA------
FEN1_THEAN       MGIKGLIPFLSEKVPSSISELS-LECLSGESLAIDASAALYQFTIAIRDSSYFSS-----
FEN1_THEPA       MGIKGLIPFLSEKVPSSISELS-LESLSGESLAIDASAALYQFTIAIRDSSYFSS-----
FEN1_BABBO       MGIKGLIGFLSDAAPGCISEVT-LESLSGTSIAIDASTALYQFTIAIREGSYLSS-----
FEN_HALMA        MGNADLRSLAALSDVS-------FDDLGGSVVAVDAHNWLYRYLTTTVKFTSESK-----
FEN_NATPD        MGNADLRTLAAIEPKP-------FDELGGSVVAVDAHNWLYRYLTTTVKFTRSEA-----
FEN_HALWD        MGNAALRQLAALESVA-------FDDISGSVIAVDAHNWLYRYLTTTVKFTSDAA-----
FEN_HALSA        MGNADLRQLAAIEETP-------FADLEGSVVAVDAHNWLYKYLTTTVQWTGADV-----
FEN_HALS3        MGNADLRQLAAIEETP-------FADLEGSVVAVDAHNWLYKYLTTTVQWTGADV-----
                      :                            *                         

FEN_HYPBU        LMDSKGRITSHLSGLFYRTINLMEHGIKIVYVFDGKPPEMKYLEIERRKRVKSEAVKKYE
FEN_STAMF        LMDSQGRITSHLSGLFYRTINILENGIKPAYVFDGKPPEIKAKEIEKRRKIREDASKKYE
FEN_AERPE        LLDREGRVTSHLSGLFYRTINLVEEGIKPVYVFDGKPPEMKSREVEERLRRKAEAEARYR
FEN_THEPD        LLDAQGNVTSHLNGLFYRTINYIELGIKPVYVFDGRPPELKQKELERRYQIKVEAEKKYR
FEN_IGNH4        LMDSKGRVTSHLSGLFYRTINMLENGIKVAYVFDGAPPKLKTREIERRQKLKQEAEKKYE
FEN_PYRAB        LMDSKGRITSHLSGLFYRTINLMEAGIKPVYVFDGKPPAFKKKELEKRREAREEAEIKWK
FEN_PYRHO        LMDSKGRITSHLSGLFYRTINLMEAGIKPAYVFDGKPPEFKRKELEKRREAREEAELKWK
FEN_PYRFU        LMDSKGRITSHLSGLFYRTINLMEAGIKPVYVFDGEPPEFKKKELEKRREAREEAEEKWR
FEN_THEKO        LMDSQGRITSHLSGFFYRTINLMEAGIKPAYVFDGKPPDFKKRELEKRREAREEAEEKWY
FEN_THEON        LMDSQGRITSHLSGLFYRTINLMEAGIKPAYIFDGKPPDFKKRELEKRREAREEAEEKWY
FEN_THEGJ        LMDSKGRITSHLSGFFYRTINLMEAGIKPAYVFDGEPPAFKKKELEKRREAREEAEEKWH
FEN_THESM        LMDSKGRITSHLSGLFYRTINLMEAGIKPAYVFDGKPPEFKKKELEKRAETREEALEKWE
FEN_KORCO        LMTSKGEITSVHSGIFYRTANFLKEGIIPIYVFDGEKPSFKSRAIEERVRAREEAELKWK
FEN_METAC        LVNSRGKVTSHLSGLLYRTASLVEAGIKPVFIFDGKPPDLKSETLSRRKEVRETSLEKWE
FEN_METBF        LVNSRGKVTSHLSGLLYRTASLIEVGIKPVFIFDGKPPDLKSETLNRRKEVRESSLEKWE
FEN_METMA        LVNSQGKVTSHLSGLLYRTASLVEAGIKPVFVFDGKPPEMKTGTLNRRKEIRESSKEKWE
FEN_METBU        LKDSRGQITSHLSGILYRLTSLIEAGVKPIFVFDGKPPDFKSDTLAKRHEVRESATAKWE
FEN_METAR        LADDRGNVTSHLSGIIYRVTNLVEEGMKPVFVFDGKPPSFKAETIKARAEVREAARQMYE
FEN_METTP        LMDASGRVTSHLSGLLYRMTNLIEVGIRVAFVFDGTPPELKAGTLAARAQMKEAAEIQLQ
FEN_ARCFU        LKDSQGRITSHLSGILYRVSNMVEVGIRPVFVFDGEPPEFKKAEIEERKKRRAEAEEMWI
FEN_SACS2        LMDSQGRVTSHLSGLFYRTINILEEGVIPIYVFDGKPPEQKSEELERRRKAKEEAERKLE
FEN_SULTO        LMDSQGRVTSHLNGLFYRTISILEEGIIPIYVFDGKPPEQKAQELERRKKVKEEAEKKLE
FEN_SULAC        LIDSKGRITSHLNGLFYRTISIIESGIIPIFVFDGKPPEKKSEEIERRKRAKEEAEKKLE
FEN_NANEQ        LRDSKGRITSHLSGLFYRTINLLEYGIKPIYVFDGTPPKFKIVAWEKRKKHKEQLESKYK
FEN_PYRAE        LMDRAGRITSHLSGLFYRTINLLEAGIRPVYVFDGKPPEFKLAEIEERRKTREKAMEEVL
FEN_PYRAR        LMDRAGRITSHISGLFYRTINLMEAGIKPVYVFDGKPPEFKLAEIEERRKAKEKATEELV
FEN_PYRIL        LMDRVGRITSHLSGLFYRTINLMEAGIKPVYVFDGKPPEFKLAEIEERRKVKEKAMEEVL
FEN_PYRNV        LMDRQGRVTSHLSGLFYRTINLMEAGIKPVYVFDGKPPEFKLAEIEARRRVKEKAMEEVV
FEN_PYRCJ        LMDRAGRITSHLSGLFYRTINLLEAGVKPVYVFDGKPPEFKLLEIEQRKKAKEKALEEVE
FEN_CALMQ        LMDSQGRVTSHLSGLLYRTINLLEYGIKPVYVFDGKPPELKLIEIEKRRRVREKAVEDWI
FEN_METKA        LMDSRGRITSHLNGLLYRTVNLVEEGIKPVYVFDGEPPDLKRETLERRRERKEEAMEKLR
FEN_CENSY        LTDARGRVTSHLSGLLYRNASFLSMGIKPVYVFDGRPPTLKSAEIERRRNVKKGAAVKYA
FEN_NITMS        LSDSEGRITSHLSGLLYRNVNFLSLGIKPVYVFDGKPPSLKTAEIERRKQIKMDATIKYE
FEN_METTH        LMDSRGRVTSHLSGILYRTAAVMEREIRVIYVFDGRSHHLKGETVSRRADIRKKSEVEWK
FEN_METS3        LSDSNGNITSHLSGILYRNSSMIEKDIKPIYVFDGTPSYLKQETIDQRRQTREESEKKWK
FEN_METST        LRDLNGHITSHLNGIMFQTSTLIEKDIKPVYVFDGKAPDLKKETQEERINIKKESEKKYL
FEN_METMJ        LMNGAGRITSHLSGILFRTVNFLEKGIRPVFVFDGKPPEFKQETINERREHRARADEAWK
FEN_METB6        LMDAKGRVTSHLSGILFRMVNFLEKGIKPVFVFDGKPPELKQETNAERKKLRDEAGEKYK
FEN_METPE        LMNSEGRITSHLSGVFFRTLRFLEKGIRPVYIFDGKPPALKQETIESRREVRREAGVQWE
FEN_METHJ        LMDDSGRITSHLSGIFFRTANFLTQGIRPVFIFDGKSPEMKGRTIQERRDVREESKEKWD
FEN_METLZ        LMDGQGRITSHLSGLLFRNANLIEKNITPIYVFDGKPPVFKASTLSKRREVRENAADAWE
FEN_THEAC        LMDSHGNVTSHLYGIFYRTINLLENRIRPVYVFDGKPSPLKNRTISERQMMKEKAKAELE
FEN_THEVO        LMDSSGNVTSHLYGIFYRTVNLVENGIKPIFVFDGKPSPLKNRTLEIRQLAKEKAKAELE
FEN_PICTO        LKDSNGNITSHLSGIFYRTSNLLENNIKPVYVFDGKPFHLKSETLRERSLIKEKNIMKLE
FEN_METJA        LRNRKGEITSAYNGVFYKTIHLLENDITPIWVFDGEPPKLKEKTRKVRREMKEKAELKMK
FEN_META3        LRNSKGEITSPYNGIFYKTIYLLNNEITPIWVFDGKPPELKLKTREERRKVKEKASKDYE
FEN1_LEIIN       LTNEKGDVTSHLNGLFARTLRMIDEGIKPIYVFDGKPPKLKADELEMRRQKAAEAEREFE
FEN1_LEIMA       LTNEKGDVTSHLNGLFARTLRMIDEGIKPIYVFDGKPPKLKADELEMRRQKAAEAERAFE
FEN1_LEIBR       LTNEQGDVTSHLNGLFARTLRMIDEGIKPIYVFDGKPPKLKADELETRRQKAAEAEREFE
FEN1_TRYB2       LTNEAGDVTSHLSGIFFRTLRMIDEGLRPIYVFDGKPPTLKASELESRRQRAEDAKHEFE
FEN1_TRYB9       LTNEAGDVTSHLSGIFFRTLRMIDEGLRPIYVFDGKPPTLKASELESRRQRAEDAKHEFE
FEN1_TRYCC       LTNEAGEVTSHLNGLFARTLRMVDEGLRPIYVFDGKPPTLKASELQERRQRAEEAQQLFD
FEN1_ARATH       LTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPELKRQELAKRYSKRADATADLT
FEN1_SOYBN       LTNEAGEVTSHLQGMFSRTIRLLEAGIKPVYVFDGKPPDLKKQELAKRYSKRAEATEDLS
FEN11_ORYSI      LTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDLKKQELAKRYSKREDATKELT
FEN11_ORYSJ      LTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDLKKQELAKRYSKREDATKELT
FEN11_SORBI      LTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDMKKEELAKRFSKREDATNDLK
FEN1_MAIZE       LTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDMKKQELAKRYSKRDDATKDLT
FEN11_PHYPA      LTNDAGEVTSHLQGMFNRTIRVLEAGLKPVYVFDGQPPDLKKRELAKRFARREDAAEDLV
FEN1_OSTLU       LTNEAGEVTSHLQGMLNRTCRMLEAGIKPIYVFDGKPPVMKGGELAKRKDKREEAEAALK
FEN1_OSTTA       LTNEAGEVTSHLQGMLMRTSRMLEAGIKPVYVFDGKPPTMKGGELAKRKDKREEAEAALK
FEN1_MICCC       LTNEAGEVTSHLQGMFTRTLRMLKAGIKPVYVFDGKPPTMKGGELAKRKDKREAAESALE
FEN1_CHLRE       LTNEAGEITSHLQGMFFRTAKMLEAGIKPVYVFDGKPPQLKQDQLAQRTERRADANEALE
FEN1_NAEGR       LTDKDGEVTNHLQGLLARTTKMLEYGIKPCYVFDGKPPQLKSGELEKRKERQKEAMEQFA
FEN1_BOVIN       LQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQ
FEN1_SHEEP       LQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQ
FEN1_HUMAN       LQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQ
FEN1_MACFA       LQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQ
FEN1_MOUSE       LQNEEGETTS-LMGMFYRTIRM-ENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQ
FEN1_RAT         LQNEEGETTSHLMGMFYRTIRMMENGIKPVYIFDGKPPQLKSGELAKRSERRAEAEKQLQ
FEN1_CHICK       LQNEEGETTSHLMGMFYRTIRMVENGIKPVYVFDGKPPQLKSGELAKRTERRSEAEKHLQ
FEN1A_XENLA      LQNEEGETTSHLMGMFYRTIRMVEHGIKPVYVFDGKPPQMKSGELAKRSERRAEAEKLLE
FEN1B_XENLA      LQNEEGETTSHLMGMFYRTIRMLEHGIKPVYVFDGKPPQMKSGELAKRSERRAEAEKLLE
FEN1_XENTR       LQNEDGETTSHLMGMFYRTIRMIEHGIKPVYVFDGKPPQMKSGELAKRSERRAEAEKLLE
FEN1_ANOFI       LQNEDGETTSHLMGMFYRTIRMLEHGIKPVYVFDGKPPQLKSAELEKRGEKRAEAEKMLA
FEN1_XIPMA       LQSEDGETTSHLMGMFYRTIRMLENGIKPVYVFDGKPPQLKSAELEKRGERRAEAEKMLA
FEN1_SALSA       LQNENGETTSHLMGMFYRTIRMLEHGIKPVYVFDGKPPQLKSGELEKRGERRAEAEKLLA
FEN1_OSMMO       LQNEDGETTSHLMGMFYRTIRMLENGIKPVYVFDGKPPQLKSGELEKRGERRAEAEKLLA
FEN1A_DANRE      LQNEDGETTSHLMGMFYRTIRMLESGIKPVYVFDGKPPQLKSGELEKRVERRAEAEKLLA
FEN1_BRAFL       LTNDAGEATSHLMGMFYRTIRMVDNGIKPVYVFDGKPPNMKSGELAKRAERREEAQKALE
FEN1_NEMVE       LTNEAGETTSHLMGLFYRTIRMVENGIKPVYVFDGKPPQLKSGELAKRTERREEAQKALS
FEN1_TRIAD       LTNEAGETTSHLMGLFYRTIRMMENGIKPVYVFDGKPPRLKSGELARRQERREEAQKQAS
FEN1_AEDAE       LTSVDGETTSHLMGTFYRTIRLLENGIKPVYVFDGKPPDLKSGELTKRAEKREEAQKALD
FEN1_ANOGA       LTSVDGETTSHLMGTFYRTIRLLENGIKPVYVFDGKPPDLKSGELNKRAERREEAQKALD
FEN1_GLOMM       LTNVDGETTSHLMGMFYRTIRLLENGIKPVYVFDGKPPISKSGELAKRAERREDAQKALE
FEN1_DROER       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROYA       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROSE       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROSI       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROME       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROPE       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROPS       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROAN       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROWI       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALK
FEN1_DROGR       LAAVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGAPPDMKSGELAKRAERRDEAEKALK
FEN1_DROMO       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKAGELAKRAERREEAEKALK
FEN1_DROVI       LATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGQPPDLKSGELAKRAERREEAEKALK
FEN1_MONBE       LVNEAGEATSHLSGLFYRTIRMVNHGIKPLYVFDGKPPTMKSGELLKRGARRKEAQANLE
FEN1_CAEBR       MQSEDGETTSHLMGMFYRTIRMIDNGIKPVYVFDGKPPDMKSGELEKRTERRAEAEKALT
FEN1_CAEEL       LQSEDGETTSHLMGMLNRTVRMFENGVKPVYVFDGKPPDMKGGELEKRSERRAEAEKALT
FEN1_BRUMA       LQTESGETTSHLLGMFYRTIRMIDNGIKPVYVFDGKPPQMKTSELEKRTERRTEAEKQRN
FEN1_AJECH       LTSETGETTSHLMGMFYRTLRIVDNGIKPVYVFDGAPPKLKSGELAKRFMRKSEAAEAHE
FEN1_AJECN       LTSETGETTSHLMGMFYRTLRIVDNGIKPVYVFDGAPPKLKSGELAKRFMRKSEAAEAHE
FEN1_AJEDR       LMSETGETTSHLMGMFYRTLRIVENGIKPVYVFDGAPPKLKSGELAKRFMRKSEAAEAHE
FEN1_UNCRE       LMNESGETTSHLMGLFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRIARKQEAAEQHE
FEN1_ASPFU       LMSESGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRTARKAEATEAHE
FEN1_ASPFC       LMSESGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRTARKAEATEAHE
FEN1_NEOFI       LMSESGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRTARKAEATEAHE
FEN1_ASPCL       LMSESGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRTARKAEATEAHE
FEN1_ASPFN       LMSDTGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRTARKAEATEAHE
FEN1_ASPTN       LMSDTGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRTARKTEATEAHE
FEN1_EMENI       LMSDTGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRSARKHEATEAHE
FEN1_ASPNC       LMSDTGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRFARKSEATEAHE
FEN1_PENRW       LMSESGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRVARKAEATEAHE
FEN1_TALMQ       LMSEAGETTSHLMGMFYRTLRIVDNGIKPLYVFDGAPPKMKGGELAKRSARKREAHEAHE
FEN1_TALSN       LMSDAGETTSHLMGMFYRTLRIVDNGIKPLYVFDGAPPKLKGGELAKRSARKREAHEAHE
FEN1_ARTOC       LTNESGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRTMRKAEAQEAAE
FEN1_PHANO       LMSETGETTSHLMGLFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRFQRKSEAHAAAE
FEN1_PYRTR       LMSETGETTSHLMGLFYRTMRMVDNGIKPLYVFDGAPPKLKSGELAKRFQRKTEAHAAAE
FEN1_NEUCR       LMNEAGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRFQRKQEATEGLE
FEN1_SORMK       LMNEAGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRFQRKQEATEGLE
FEN1_FUSV7       LMNDSGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELAKRFQRKQEATEGLE
FEN1_MAGO7       LTNEDGQTTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELARRYQRKQEALEGLE
FEN1_COPCI       LTNDAGETTSHLMGFFYRTIRIVENGIKPAYVFDGKPPELKKGVLSKRFEKREEAKEEGE
FEN1_COPC7       LTNDAGETTSHLMGFFYRTIRIVENGIKPAYVFDGKPPELKKGVLSKRFEKREEAKEEGE
FEN11_LACBS      LTNDAGETTSHLMGLFYRTLRIVENGIKPAYIFDGKPPELKKGVLSKRLERREEAKEEGE
FEN12_LACBS      LTNDAGETTRYLMGLFYRTLRIVENGIKPAYIFDGKPPELKKGVLSKRLERREEAKEEGE
FEN1_CRYNJ       LMNESGDVTSHLMGFFYRTIRMVDHGIKPCYIFDGKPPELKGSVLAKRFARREEAKEGEE
FEN1_USTMA       LMTESGETTSHLLGFFYRTLRMIDYGIKPMYVFDGTPPDLKKELLQKRFGRREEAREQEE
FEN1_SCHJY       LMNDQGETTSHLMGMFYRTLRMVDNGLKPCYVFDGKPPTLKSGELAKRASRQQKAREERE
FEN1_SCHPO       LMNEQGETTSHLMGMFYRTLRIVDNGIKPCFVFDGKPPTLKSGELAKRVARHQKAREDQE
FEN1_ASHGO       LASADGETTSHLMGMFYRTLRMVDHGLKPCYVFDGKPPVLKAHELDKRTERRKETEQKLA
FEN1_KLULA       LAGEDGETTSHLMGMFYRTLRMIDHGIKPCYVFDGSPPELKKYELDKRKVRREDTEAKLK
FEN1_YEAST       LTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLA
FEN1_YEAS7       LTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLA
FEN1_YEAS2       LTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLA
FEN1_YEAS8       LTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLA
FEN1_YEAS1       LTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLA
FEN1_VANPO       LTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPVLKSHELSKRTARREETEKKLQ
FEN1_CANGA       LSTETGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPVLKSHELDKRTSRREETEKKLA
FEN1_ZYGRC       LSTESGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPILKSFELKKRSDKRVDTEKKLE
FEN1_LACTC       LASESGETTSHLMGIFYRTLRMIDNGIKPCYVFDGKPPVLKSHELSKRSARRATTEEKLK
FEN1_CANAW       LTNEDGETTSHLSGMFYRTIKMVENNIKPVYVFDGKPPVLKGGELEKRLLRREEAQKQKT
FEN1_CANAL       LTNEDGETTSHLSGMFYRTIKMVENNIKPVYVFDGKPPVLKGGELEKRLLRREEAQKQKT
FEN1_CANDC       LTNEDGETTSHLSGMFYRTIKMVENNIKPVYVFDGKPPVLKGGELEKRLLRREEAQKQKT
FEN1_CANTT       LTNDDGETTSHLSGIFYRTIKMVENNIKPVYVFDGKPPVLKGGELEKRLLRREEAQKQKD
FEN1_LODEL       LTNDEGETTSHLSGIFYRTIRMVENNIKPVYVFDGKPPVLKGGELEKRLLKREEAQKQID
FEN1_PICST       LTNESGETTSHLSGMFYRTIRMVENNIKPVYVFDGKPPVLKGGELEKRLLKREEAQKQID
FEN1_CLAL4       LTSEDGETTSHLSGMFYRTIRLVESGLKPMYVFDGKPPVLKGGELEKRLLKRQDALKQIE
FEN1_PICGU       LTSEDGETTSHLSGMFYRTIRLVENGIKPMYVFDGKPPVLKGGELEKRMIRKKEALKQQE
FEN1_DEBHA       LTNDEGETTSHLSGMFYRTIRLVENSIKPVYVFDGKPPVLKGGELEKRLLRREEAIKQRE
FEN1_KOMPG       LANEEGETTSHLMGFFYRTIRMVGYGIKPCYVFDGKPPVLKGGELEKRLKRREEAEKQRL
FEN1_YARLI       LTNENGETTSHLMGMFYRTLRMVDNGIKPVYVFDGKPPVLKSGELAKRKERREEALKKIE
FEN1_DICDI       LTNQLGETTSHLQGMFYRTIKLISRGIKPIYVFDGSAPVLKSGELAKRQARRKEAKENLK
FEN1_POLPP       LMNANGETTSHLQGMFYRTIKLMTRGIKPIYVFDGKAPVLKSGELAKRYARRKEAEQQLE
FEN11_PARTE      LTDKDGNRTGHLVGLFNRTLQFLENGIKPVWVFDGKPPLLKSGELARRKKLKEEAQVKTE
FEN12_PARTE      LTDKEGNRTGHLVGLFNRTLQFLENGIKPVWVFDGKPPLLKSGELARRKKLKEEAKVKTE
FEN1_TETTS       LTDKDGNKTGHLVGLLNRTVMLIENGLKPVWVFDGKPPQFKSGELARRQKAKDEAAEKQK
FEN1_PHATC       LTNAEGETTSHIQGMFNRTIRYMTEGIRPVFVFDGKPPDVKSHELIKRREKREKAQAALA
FEN1_THAPS       LTNADGETTSHIQGIFNRTIRFISEGIRPVYVFDGKPPQFKSGELLKRREKRLKAEQALK
FEN1_PHYIT       LTNADGEVTSHLQGMFSRTIRMMENGLKPVYVFDGKPPVMKSGELAKRSDRRQEAQKALE
FEN1_ENTDS       MVDEFGETTSHIIGTFYRTIKLIESGIKPVYVFDGKPPEMKDGELNKRKENAQKAQEQLD
FEN1_ENTHI       MVDEFGETTSHIIGTFYRTIKLIESGIKPIYVFDGKPPEMKDGELHKRKENAQKAQEQLD
FEN1_ENCCU       LGNE-DSPTSHLVGFFYRTIRMVELGITPVYVFDGVPPEIKMKELEKRKERRAAADREYR
FEN1_ENTBH       LSWG-DSTTSHISGIFYRSIRWIENGIIPVFVFDGIPPEEKIHEFEKRTKRRQDINAKLQ
FEN1_PLABA       LMNESGETTSHISGLMSRTIKLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLI
FEN1_PLAYO       LMNESGETTSHISGLMSRTIKLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLI
FEN1_PLACH       LMNEAGETTSHISGLMSRTIKLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLL
FEN1_PLAKH       LTNESGETTSHISGLMSRSIKLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLK
FEN1_PLAVS       LTNESGETTSHISGLMSRSIKLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLK
FEN1_PLAFA       LTNESGETTSHISGLMSRSIRLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLK
FEN1_PLAF7       LTNESGETTSHISGLMSRSIRLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLK
FEN1_CRYMR       LTNEAGESTSHISGMLSRTIRLLEAGIKPVFVFDGEPPELKMEELMKRKERREKAQQELE
FEN1_CRYPI       LTNSSGESTSHINGMLSRTTRLLEAGIKPVFVFDGAPPEMKKDELTKRDERREKALAELE
FEN1_GIAIC       LANSSGEVTSHLVGLLAKVIRLAEAGIKPIFVFDGKPPEDKQGELEKRRQAREAAELEQQ
FEN1_THEAN       LVNSKGESTSHIYGLMNRCSKLLEYGIKPVFVFDSKPPELKSKTLDKRRQKREEAKTDFK
FEN1_THEPA       LVNSKGESTSHIYGLMNRCSKFLEYGIKPVFVFDSKPPELKTKTLEKRRQQREEANASLK
FEN1_BABBO       LTNSKGESTSHIAGLLNRCIRLLELGIRPVFVFDSTPPEAKSQTLAKRKLLREEAESSLE
FEN_HALMA        YTTSNGEEVANLIGVVQGLPKFFEHDMTPVFVFDGAVTDLKDDEVEKRREQRQKYESELE
FEN_NATPD        YTTADGEEVANLIGVVQGLPKFFEHDVTPVFVFDGGVSDLKADEVEKRRDQRERYEAQLE
FEN_HALWD        YTTESGVEVANLIGVVQGLPKFFEHDLTPVFVFDGGVTELKDEEVQERRVAREEAVELQA
FEN_HALSA        YTTSDGTEVANLVGAVQGLPKFFEHGLTPVFVWDGGVTELKDDEIADRREQRERYEEQLD
FEN_HALS3        YTTSDGTEVANLVGAVQGLPKFFEHGLTPVFVWDGGVTELKDDEIADRREQRERYEEQLD
                      .  .    * .          :   :::*.     *      *            

FEN_HYPBU        EAVKKG-----------DTKAARRYAQMAARLTDEMVEDAKKLLDAMGVPWVQAPAEGEA
FEN_STAMF        EALRKG-----------DIEAARRYAMMSAKLTDEMVQDAKKLLDAMGIPWIQAPAEGEA
FEN_AERPE        RAVEAG-----------EVEEARKYAMMAARLTSDMVEESKELLDAMGMPWVQAPAEGEA
FEN_THEPD        EAIERG-----------DLEEARIYAQQTSRLTAAMVHDAKLLLRYMGVPYVEAPSEGEA
FEN_IGNH4        EAVRRG-----------DVEEARKYAQMSAKLTKEMVEEAKRLLEAMGVPWVQAPSEGEA
FEN_PYRAB        EALAKG-----------DIEEARKYAQRATKVNEMLIEDAKKLLQLMGIPIVQAPSEGEA
FEN_PYRHO        EALAKG-----------NLEEARKYAQRATKVNEMLIEDAKKLLQLMGIPIIQAPSEGEA
FEN_PYRFU        EALEKG-----------EIEEARKYAQRATRVNEMLIEDAKKLLELMGIPIVQAPSEGEA
FEN_THEKO        EALEKG-----------DLEEAKKYAMRATRVNEELINDAKKLLELMGIPVVQAPSEGEA
FEN_THEON        EALERG-----------DLEEAKKYAMRATRVNEGLINDAKTLLELMGIPVIQAPSEGEA
FEN_THEGJ        EALERG-----------EIEEAKKYAMRATKLNETLIEDAKKLLGLMGVPVVQAPSEGEA
FEN_THESM        IALARG-----------ELEEAKKYAQRASKINEILIEDAKKLLELMGIPWVQAPSEGEA
FEN_KORCO        EALEIG-----------DLEEARKYAQAALNITGDIVEDCKTILKLMGVPIVQAPSEGEA
FEN_METAC        NAKAEG-----------DLEAAYKYAQASSRVDQEIVEDSKYLLGIMGIPWIQAPCEGEA
FEN_METBF        NAKVEG-----------DLEAAYKYAQASSKVDQEIVEDSKYLLSIMGIPWIQAPCEGEA
FEN_METMA        NAKAEG-----------NLEAAYKYAQASSKVDQDIIEDSKYLLDIMGIPWIQAPCEGEA
FEN_METBU        DAKAQG-----------LEEEAYKYAQASSKVTREMIDDSVRLLELMGIPYVKAPSEGEA
FEN_METAR        AAKAAG-----------SAE-AYKYAQASTSINRQIVDDAKVLLGYMGIPFIVAPSEGEA
FEN_METTP        EAIATG-----------VDS--FRYAQATARINSEILHDSIRLLDAMGIPYVQAPSEGEA
FEN_ARCFU        AALQAG-----------DKD-AKKYAQAAGRVDEYIVDSAKTLLSYMGIPFVDAPSEGEA
FEN_SACS2        RAKSEG-----------KIEELRKYSQAILRLSNIMVEESKKLLRAMGIPIVQAPSEGEA
FEN_SULTO        QAKTEGSI---------KTSELKKYAQMSIRLTNEMAEESKELLKAMGIPVVQAPSEGEA
FEN_SULAC        KAKLEG-----------EYREIRKYAQAAVRLSNEMVEESKKLLDAMGIPVVQAPGEGEA
FEN_NANEQ        EALKKG-----------NIQEAIKYAKSLGKLDSYMVEEAKKLLEAMGIPYVQAPSEGEA
FEN_PYRAE        RAIKEG-----------RREDVAKYAKRAVFITSEMVDEAKRLLSYMGVPWVQAPSEGEA
FEN_PYRAR        RAIKEG-----------RRDEVAKYAKRAIFLTNEMVEDAKKLLTYMGVPWVQAPSEGEA
FEN_PYRIL        KAIKEG-----------RKEDVAKYMKRAVFLTSDMVEDAKKLLTYMGVPWVQAPSEGEA
FEN_PYRNV        KAIREG-----------KRDDVAKYMKRVIFLTNEMVEDAKRLLTYMGVPWVQAPSEGEA
FEN_PYRCJ        KAIREG-----------RREDVAKYAKRAIFLTSEMVEDAKKLLTYMGIPWVQAPSEGEA
FEN_CALMQ        KAVEEG-----------KKSEARKYAQRALFITSDMVDEAKRLLDSMGVPWVQAPSEGEA
FEN_METKA        RAKTKE-----------ERE---KYARQVARLDESLVEDAKRLLDLMGIPWVQAPSEGEA
FEN_CENSY        AAVDAG-----------NMDDARKYAQQTTSMRDGMVDDSKQILKLFGIPYIDAPSEGEA
FEN_NITMS        KAIADG-----------NMEDARKYAQQTTSMKDGMVKESKQLLTYFGIPYIEAPSEGEA
FEN_METTH        RALEEG-----------DIDRAKKYAVRSSRMSSEILESSKRLLELLGIPYVQAPGEGEA
FEN_METS3        EALAKQ-----------DTQEARKYAMRSSKLSPYIIESSKKLLTMMGIPYIEAYGEGEA
FEN_METST        EAKEVG-----------DVVAARKYAARTTHLNKEIIKSSKKLLDLMGIPYVQARTEGEA
FEN_METMJ        TALREG-----------DMEEAYKQASASARIDSHTIASSRELLDLLGIPWVQAPSEGEA
FEN_METB6        EAVERG-----------DEEEAYRQARSATRVDETIIATSKELLDLLGIPYVQAPSEGEA
FEN_METPE        AALARG-----------DQEEAYKQARASSRVTPEIIATSKELLTLMGVPCVQAPSEGEA
FEN_METHJ        QAKKEG-----------DLAGAFRYAMSSTAIDAYILSSARQLIQLMGLPVVDAPSEGEA
FEN_METLZ        KALKEG-----------DEESARKYAMASSKIDAFIIDSSKELLSALGIAWIQAPEEGEA
FEN_THEAC        EAIERG-----------E-EDLRQYYSRINYITPQIVDDTKKLLDYMGIPYVDAPSEGEA
FEN_THEVO        EAISRG-----------E-ENLKQYYSRINYITPQIVNDTKELLTYMGIPYVDAPSEGEA
FEN_PICTO        EAIASN-----------DDAKIRSLSSRINYITDDIVNESKTLLNLMGLPYVQAPSEGEA
FEN_METJA        EAIKKE-----------DFEEAAKYAKRVSYLTPKMVENCKYLLSLMGIPYVEAPSEGEA
FEN_META3        IAKREE-----------NIEDMQKYAKRINYLEPNTVDNCKKLLKLMGIPYIDAPSEGEA
FEN1_LEIIN       KAKDAG-----------DDEMMEKMSKRTVRVSRDQIDESKKLLRLMGIPVIQAPSEAEA
FEN1_LEIMA       KAKDAG-----------DDEMMEKMSKRTVRVSRDQIDESKKLLRLMGIPVIQAPSEAEA
FEN1_LEIBR       KAKDAG-----------DDEMMEKMSKRTVRVSREQIEESKKLLQLMGVPVIQAPSEAEA
FEN1_TRYB2       KAKEEG-----------DDEAMEKMSKRMVRVGRDQMEEVKTLLRLMGIPVVQAPSEAEA
FEN1_TRYB9       KAKEEG-----------DDEAMEKMSKRMVRVGRDQMEEVKTLLRLMGIPVVQAPSEAEA
FEN1_TRYCC       TAKEEG-----------NDELMEKMSKRTVRVSREQLEEAKKLLQLMGIPVVQAPSEAEA
FEN1_ARATH       GAIEAG-----------NKEDIEKYSKRTVKVTKQHNDDCKRLLRLMGVPVVEATSEAEA
FEN1_SOYBN       EALETA-----------NKEDIEKFSKRTVKVTKQHNDDCKRLLRLMGVPVVEAPSEAEA
FEN11_ORYSI      EAVEEG-----------DKDAIEKFSKRTVKVTKQHNEECKRLLRLMGVPVVEAPCEAEA
FEN11_ORYSJ      EAVEEG-----------DKDAIEKFSKRTVKVTKQHNEECKRLLRLMGVPVVEAPCEAEA
FEN11_SORBI      EAVEAG-----------DKDAVEKLSKRTVKVTAQHNDDCKRLLRLMGVPVVEAPSEAEA
FEN1_MAIZE       EAVEVG-----------DKDAIEKLSKRTVKVTRQHNEDCKRLLRLMGVPVVEAPSEAEA
FEN11_PHYPA      TAKETG-----------NEADVEKYSKKTVKVTKQHNEDCRKLLRLMGVPVVEAPSEAEA
FEN1_OSTLU       AAREAG-----------NQEEVEKLSKRTVRVSKQHSQEVMKLASLLGVPVFEAPCEAEA
FEN1_OSTTA       AAREAG-----------NQEEVEKLSKRTVRVSKEQSMEVMKLAQLLGIPAFEAPCEAEA
FEN1_MICCC       KAKEAG-----------DQEEIEKLSKRTVRVSKVHSEEVMKLARFLGLPVFEAPCEAEA
FEN1_CHLRE       KAKEAG-----------DQEAIEKYSKRSVRVTREHNDECKRLLRLMGVPVVEAPTEAEA
FEN1_NAEGR       LAQEEG-----------DEEKMVMWNKRTTRMTKEQSNDGKKLLRLMGVPVVEAPGEAEA
FEN1_BOVIN       EAQAAG-----------AEAEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEA
FEN1_SHEEP       QAQAAG-----------AETEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEA
FEN1_HUMAN       QAQAAG-----------AEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEA
FEN1_MACFA       QAQAAG-----------AEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEA
FEN1_MOUSE       QAQEAG-----------MEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEA
FEN1_RAT         QAQEAG-----------AEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEA
FEN1_CHICK       EAQEAG-----------EEANIEKFSKRLVKVTQQHTDECKKLLMLMGIPYVEAPGEAEA
FEN1A_XENLA      AAEEAG-----------EVENIEKFTKRLVKVTKQHNEECKKLLTLMGIPYVDAPCEAEA
FEN1B_XENLA      AAEEAG-----------EVENIEKFNKRLVKVTKQHNEECKKLLSLMGIPYVDAPCEAEA
FEN1_XENTR       AAEEAG-----------EVENIEKFNKRLVKVTKQHNEECKKLLTLMGVPYVDAPCEAEA
FEN1_ANOFI       QAQELG-----------EQENIDKFSKRLVKVTKQHNDECKKLLTLMGVPYIEAPCEAEA
FEN1_XIPMA       KAQELG-----------EQENIDKFSKRLVKVTKQHNDDCKKLLTLMGVPYIEAPCEAEA
FEN1_SALSA       QAQEAG-----------EQENIDKFSKRLVKVTQQHNDECKKLLTLMGVPYIEAPCEAEA
FEN1_OSMMO       QAQEAG-----------EQENIDKFSKRLVKVTRQHNDECKKLLTLMGVPYVEAPCEAEA
FEN1A_DANRE      QAQEAG-----------EQENIDKFSKRLVKVTKQHNEECKKLLSLMGVPYIEAPCEAEA
FEN1_BRAFL       KAEEAG-----------EAEDVNKFQKRLVKVTKEHNAECKKLLTLMGIPYVDAPCEAEA
FEN1_NEMVE       KAEEAG-----------DTENIDKFSRRLVRVTKEHNEECKQLLKLMGIPYVEAPCEAEA
FEN1_TRIAD       EAEKEG-----------DADNIDKFTRRTVRMTPEHCEEGKKLLKLMGVPVVQAPCEAES
FEN1_AEDAE       KATEAG-----------VTEDIDKFNRRLVKVTKQHSNEAKELLKLMGVPYVDAPCEAEA
FEN1_ANOGA       KATEAG-----------ATEDIEKFNRRLVKVTKHHANEAKELLRLMGVPYVEAPCEAEA
FEN1_GLOMM       KATEAG-----------NEADMDKFNRRLVKVTKEHANEAKELLKLMGVPYVEAPCEAEA
FEN1_DROER       AATDAG-----------DDAGIEKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEA
FEN1_DROYA       AATDAG-----------DDAGIEKFNRRLVRVTKEHANEAKELLTLMGVPYVDAPCEAEA
FEN1_DROSE       AATDAG-----------DDAGIEKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEA
FEN1_DROSI       AATDAG-----------DDAGIEKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEA
FEN1_DROME       AATDAG-----------DDAGIEKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEA
FEN1_DROPE       AATDAG-----------DDAEIEKFNRRLVRVTKEHAREAKELLSLMGVPYVDAPCEAEA
FEN1_DROPS       AATDAG-----------DDAEIEKFNRRLVRVTKEHAREAKELLSLMGVPYVDAPCEAEA
FEN1_DROAN       AATEAG-----------DDAEIEKFNRRLVRVTKEHAREAKELLKLMGVPYVEAPCEAEA
FEN1_DROWI       AATEAG-----------DEAEIEKFNRRLVRVTKEHAREAKELLKLMGVPYVDAPCEAEA
FEN1_DROGR       AATEAG-----------DEAQIEKFNRRLVRVTKEHSREAKELLKLMGVPYVDAPCEAEA
FEN1_DROMO       VATDAG-----------DEAEIEKFNRRLVRVTKEHSNEAKELLKLMGVPYVDAPCEAEA
FEN1_DROVI       AATEAG-----------DEAEIDKFNRRLVRVTKEHSREAKELLKLMGVPYVDAPCEAEA
FEN1_MONBE       EATEQG-----------DTEQMEKFSRRLVHVTREHNEQCRQLLTLMGIPFIIAPTEAEA
FEN1_CAEBR       EAKEKG-----------DAKEAEKFERRLVKVTKQQNEEVKQLLGLMGIPVVEAPCEAEA
FEN1_CAEEL       EAKEKG-----------DVKEAEKFERRLVKVTKQQNDEAKRLLGLMGIPVVEAPCEAEA
FEN1_BRUMA       DAVELG-----------DETSVNKFEKRLVKVTKEQSEEAKRLVTLMGIPVLDAPCEAEA
FEN1_AJECH       EAKEVG-----------TAEEVEKFSRRTVRVTREHNEECKKLLKLMGVPYIDAPTEAEA
FEN1_AJECN       EAKEVG-----------TAEEVEKFSRRTVRVTREHNEECKKLLKLMGVPYIDAPTEAEA
FEN1_AJEDR       EAKEVG-----------TAEDVEKFSRRTVRVTREHNEECKKLLKLMGVPYINAPTEAEA
FEN1_UNCRE       EAKETG-----------TTEDVEKFSRRTVRVTREHNEECKKLLKLMGIPYINAPTEAEA
FEN1_ASPFU       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECKKLLKLMGIPYIDAPTEAEA
FEN1_ASPFC       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECKKLLKLMGIPYIDAPTEAEA
FEN1_NEOFI       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECKKLLKLMGIPYIDAPTEAEA
FEN1_ASPCL       EAKETG-----------TAEEIEKFSRRTVRVTREHNAECKKLLKLMGVPYIDAPTEAEA
FEN1_ASPFN       EAKETG-----------TAEDVEKFSRRTVRVTRDHNAECKKLLKLMGIPYIDAPTEAEA
FEN1_ASPTN       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECKKLLKLMGIPYIDAPTEAEA
FEN1_EMENI       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECKKLLKLMGIPYIDAPTEAEA
FEN1_ASPNC       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECKKLLKLMGIPYIDAPTEAEA
FEN1_PENRW       EAKETG-----------TAEDIEKFSRRTVRVTREHNAECKKLLELMGIPFINAPTEAEA
FEN1_TALMQ       EAKETG-----------TAEDMEKFSRRTVRVTREHNEECKKLLKLMGVPYIDAPTEAEA
FEN1_TALSN       EAKETG-----------TAEDMEKFSRRTVRVTREHNEECKKLLKLMGVPYIDAPTEAEA
FEN1_ARTOC       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECKRLLKLMGIPYIDAPTEAEA
FEN1_PHANO       EAKETG-----------TAEDVEKFSRRTVRVTREHNEECRRLLKLMGIPFIIAPTEAEA
FEN1_PYRTR       EAKETG-----------TAEDVEKFSRRTVRVTREHNEECQRLLKLMGIPYIVAPTEAEA
FEN1_NEUCR       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECQKLLKLMGIPYIVAPTEAEA
FEN1_SORMK       EAKETG-----------TAEDVEKFSRRTVRVTREHNAECQKLLKLMGIPYIVAPTEAEA
FEN1_FUSV7       EAKETG-----------TAEDIEKFSRRTVRVTREHNAECQRLLKLMGIPYIIAPTEAEA
FEN1_MAGO7       EARETG-----------TAEDVEKFSRRTVRVTREHNEECRQLLKLMGIPYIIAPTEAEA
FEN1_COPCI       EAKEIG-----------TAEDVDRFSRRTVKVTKQHNEECQKLLRLMSVPCVIAPSEAEA
FEN1_COPC7       EAKEIG-----------TAEDVDRFSRRTVKVTKQHNEECQKLLRLMGVPCVIAPSEAEA
FEN11_LACBS      EAKETG-----------TVEDVDRFSRRTVKVTREHNEECRRLLRLMGIPVVIAPSEAEA
FEN12_LACBS      EAKETG-----------TVEDVDRFSRRTVKVTREHNQECQRLLRLMGIPVVIAPSEAEA
FEN1_CRYNJ       EAKETG-----------TAEDVDKLARRQVRVTREHNEECKKLLSLMGIPVVTAPGEAEA
FEN1_USTMA       EQKDVA-----------DAEKMDQLARRQVRPTRQHNEEVRHLLKLMGIPCVIAPSEAEA
FEN1_SCHJY       EAKEVG-----------TAEMVDKFAKRTVRVTRQHNDEAKKLLELMGIPYVNAPCEAEA
FEN1_SCHPO       ETKEVG-----------TAEMVDRFAKRTVKVTRQHNDEAKRLLELMGIPFVNAPCEAEA
FEN1_ASHGO       ELTEQA--------------EIMKHERRLVKVEQWHVAEAKKLLGLMGIPYVDAPGEAEA
FEN1_KLULA       EATEQA--------------EIIKHERRLVKVLPWHNEEAQKLLSLMGIPYVVAPAEAEA
FEN1_YEAST       EATTEL--------------EKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEA
FEN1_YEAS7       EATTEL--------------EKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEA
FEN1_YEAS2       EATTEL--------------EKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEA
FEN1_YEAS8       EATTEL--------------EKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEA
FEN1_YEAS1       EATTEL--------------EKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEA
FEN1_VANPO       EATDQA--------------EKMKQERRLVKVSKEHNDEAKQLLELMGIPYITAPCEAES
FEN1_CANGA       EATEEA--------------EKMKHERRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAEA
FEN1_ZYGRC       EAVDQA--------------EKLKQERRLVKVSPEHNDEAKYLLKLMGIPYIVAPCEAEA
FEN1_LACTC       EAVEEA--------------EKLKHERRLVKVTPEHNEEAKKLLRLMGLPYVEAPCEAEA
FEN1_CANAW       ALGDEG-----------TVEEVLKFEKRLVRVTREQNEEAKKLLQLMGIPCVDAPCEAEA
FEN1_CANAL       ALGDEG-----------TVEEVLKFEKRLVRVTREQNEEAKKLLQLMGIPCVDAPCEAEA
FEN1_CANDC       ALGDEG-----------TVEEVLKFEKRLVRVTREQNEEAKKLLELMGIPCVDAPCEAEA
FEN1_CANTT       ALKDEG-----------TVEDHLKFEKRLVRVSREQNEEAKKLLELMGIPIVEAPCEAEA
FEN1_LODEL       NLKDDA-----------SVSDMTKYQKRLVRVSRDQNDEAKKLLELMGIPYVNAPCEAEA
FEN1_PICST       SIKDTG-----------TVAEVMKFEKRLVRVSREQNDEAKKLLELMGIPYVNAPCEAEA
FEN1_CLAL4       DLKETG-----------TVEELMKYEKRTVRASREQNDEAKKLLELMGIPYIVAPSEAEA
FEN1_PICGU       DIKDTA-----------TVEEMVRYEKRSVRVTKEQNNEAKKLLELMGIPYVDAPCEAEA
FEN1_DEBHA       NIKDEG-----------TIEDMVRYEKRTVRVTREQNDEAKKLLELMGVPYVNAPCEAEA
FEN1_KOMPG       DMKETG-----------TLADIAKFERRTVRVTREQNDQAKKLLELMGIPYVDAPCEAEA
FEN1_YARLI       ELKQQVEDGEEGEETKEAQEDVTRFEKRTVRVTPEQNDEAKKLLTLMGIPIVEAPCEAEA
FEN1_DICDI       EATEVG-----------TNEEVQKFAKRVITVTRKQNEDCIKLLTLMGVPIVKAPCEAEA
FEN1_POLPP       EANEVG-----------NSEDVQKFQKRTISASRKQNEECKKLLELMGVPIVQAPCEAEA
FEN11_PARTE      LALEQG-----------DMQQALLQHQRTTTISSVMKEDAIKMLKLMGCPVIIAPCEAEA
FEN12_PARTE      LALEQG-----------DMQQALLQNQRTTTISSIMKEDAIKMLQLMGCPVIIAPCEAEA
FEN1_TETTS       TAIETG-----------DMQEALKQEQRNLHITKEMKADAIKLLQLVGVPVILAPCEAEA
FEN1_PHATC       VASEEG-----------NVEEQDKQSKRLVRAGTKENEDCRKLLTLMGVPVVTAPCEAEA
FEN1_THAPS       AAEESG-----------NIEEQDKQSKRLVRAGTKENEDCIKLLTLMGVPVIRAPCEAEA
FEN1_PHYIT       EATEKG-----------NAEDIDRFNKRLVRATPQHNEDCKELLRLMGVPHITAPCEAEA
FEN1_ENTDS       KALEEG-----------DKEQAKKLMKRTARMTKEQSDEVKKLLQLMGIPCVEANCEAEG
FEN1_ENTHI       KALEEG-----------DKEQAKKLMKRTARMTKEQSDEVKKLLQLMGIPCIEANCEAEG
FEN1_ENCCU       EASEVG-----------DKELMEMYDKRKTKVTGVHVDECKRLLGLMGIPFETAPSEAEA
FEN1_ENTBH       DAIEQQ-----------DQVLVSKYDRMNVKMEKSHIEECQKTLRLLNIPYVIAPSEAEA
FEN1_PLABA       KAKEE------------NLEEIKKQSGRTVRVTKKQNEEAKKLLTLMGIPVIESPCEAEA
FEN1_PLAYO       KAKAEG-----------NLEEIKKQSGRTVRVTKKQNEEAKKLLTLMGIPVIESPCEAEA
FEN1_PLACH       KAKEEG-----------NLEEIKKQSGRTVRVTKKQNEEAKKLLTLMGIPVIESPCEAEA
FEN1_PLAKH       KAKEEG-----------NLEEIKKQSGRTVRVTKKQNEEAKKLLTLMGIPVVEAPCEAES
FEN1_PLAVS       KAKEEG-----------NLEEIKKQSGRTVRVTRKQNEEAKKLLTLMGIPVVEAPCEAES
FEN1_PLAFA       KAKEEG-----------NLEEIKKQSGRTVRVTRKQNEEAKKLLTLMGIPIIEAPCEAES
FEN1_PLAF7       KAKEEG-----------NLEEIKKQSGRTVRVTRKQNEEAKKLLTLMGIPIIEAPCEAES
FEN1_CRYMR       KAQEEG-----------DTETIRKQLIRTIKITKEQSDDVKYMLKLLGIPVIEATSEAEA
FEN1_CRYPI       KAQEIG-----------DEELIKKQSVRTIHVTKKQVEDVKKLLGFLGMPCIDAPSEAEA
FEN1_GIAIC       KAEEEG-----------NLERAKQLSRRTVKVTQQHCKQAERLLDTLGIPYVVAAGEAEA
FEN1_THEAN       KAISEG-----------DKESAKKLVGRTVKVTKDMNDSAKKLLRLMGIPVIEALEEAEA
FEN1_THEPA       KAISEG-----------DKESVKKLVGRTVKVSKEMNESAKKLLRLMGVPVIEALEEAEA
FEN1_BABBO       KAIEED-----------DKEAIRKYVGRTVRITQKENESAKKLLRLVGVPVIEAAEEAEA
FEN_HALMA        AAREAG-----------DSTRVAKLDSRTQRLTDTIVDTTRDLLELLDVPIVDAPAEGEG
FEN_NATPD        AAKERDET---------DAAEIAALESRTQRLTDTIVETTRELLARLDVPVVEAPAEGEA
FEN_HALWD        AAEERG-----------DELAASRLEARTQRLTETIHETTRGLLNRLDVPIIEAPAEGEA
FEN_HALSA        DAREAG-----------DAAEAARLDARTQRLTPTIHETTRELFDLLDIPQVEAPAEGEA
FEN_HALS3        DAREAG-----------DAAEAARLDARTQRLTPTIHETTRELFDLLDIPQVEAPAEGEA
                                                               .. .   :  *.*.

FEN_HYPBU        QAAFMARRGDAWAA-----ASQDYDSLLFGSPRLVRNLAITGRRKLPRKD---VYVEIKP
FEN_STAMF        QAAYIVSKGDAWAS-----ASQDYDSLLFGSPRLIRNLTISGKRKLPRKN---VYIEIKP
FEN_AERPE        QAAYMARKGDAWAT-----GSQDYDSLLFGSPRLVRNLAITGRRKLPGRD---QYVEIKP
FEN_THEPD        QAAYMVKKGDAWAS-----GSQDFDSLLFGSPRLVRNLAITGKRKLPRKD---VYVEVKP
FEN_IGNH4        QAAYMAAKGDVWAS-----ASQDYDSLLFGSPRLVRNLAVSGRRKLPNKN---VYVEVKP
FEN_PYRAB        QAAYMAGKGDVYAS-----ASQDYDSLLFGTPRLVRNLTITGKRKMPGKD---IYVEIKP
FEN_PYRHO        QAAYMASKGDVYAS-----ASQDYDSLLFGAPRLIRNLTITGKRKMPGKD---VYVEIKP
FEN_PYRFU        QAAYMAAKGSVYAS-----ASQDYDSLLFGAPRLVRNLTITGKRKLPGKN---VYVEIKP
FEN_THEKO        QAAYMAAKKAVYAS-----ASQDYDSLLFGAPRLVRNLTITGRRKLPGKN---VYVEVKP
FEN_THEON        QAAYMAAKKKVYAS-----ASQDYDSLLFGAPKLVRNLTITGRRKLPGKN---VYVEVKP
FEN_THEGJ        QAAYMAAKKRVYAS-----ASQDYDSLLFGAPRLVRNLTITGRRKLPGKN---VYVEVKP
FEN_THESM        QAAYMASKGDVWAS-----ASQDYDSLLFGTPKLVRNLTITGKRKLPGKD---VYIEVKP
FEN_KORCO        QAAHMAMKGDVWAT-----ASQDYDSLLFGAPRLIRNLTITGKRKLPGKE---VYVDINP
FEN_METAC        QAAHMVLKKDADYV-----ASQDYDSFLFGAPKVVRNMAVTGKRKLPGKN---VYVDVEL
FEN_METBF        QAAHMVLKKDADYV-----ASQDYDSFLFGAPTVIRNLAVTGKRKLPGKH---VYVDVEL
FEN_METMA        QAAHMVLKKDADCV-----ASQDYDSFLFGAPTVVRNLAATGKRKLPGKN---VYVDVEL
FEN_METBU        QASYMVQKGDADYI-----GSQDYDSFLFGAPQVVRNLTITGKRKLPKKN---IYVDVKP
FEN_METAR        QAAYMVSRGAADYV-----GSQDYDSLLFGAPRVVRNIAITGKRKVPRKN---IYMDVKP
FEN_METTP        QAAFMAIRGDVDYV-----ASQDYDSLLFGAPRVVRNLAITGRRKMPRKN---IYIDVPP
FEN_ARCFU        QAAYMAAKGDVEYT-----GSQDYDSLLFGSPRLARNLAITGKRKLPGKN---VYVDVKP
FEN_SACS2        EAAYLNKLGLSWAA-----ASQDYDAILFGAKRLVRNLTITGKRKLPNKD---VYVEIKP
FEN_SULTO        EAAYINILGLSWAT-----ASQDYDSLLFGAKRLIRNLTLSGKRKLPGKD---VYVEIKP
FEN_SULAC        EAAYINSIDLSWAA-----ASQDYDSLLFGAKRLVRNITISGKRKLPNKD---VYVEIKP
FEN_NANEQ        EAAYLTKKGVSDYC-----GSQDYDSLLFGSPRVVRNITISEKRKLPGKN---IYVEVKP
FEN_PYRAE        QAAYMARKGHCWAV-----GSQDYDSLLFGSPKLVRNLAVSPKRKI--GE---EVIELTP
FEN_PYRAR        QAAYMARRGHCWAV-----GSQDYDSLLFGSPRLVRNLATSPKRKV--GD---EVVELSP
FEN_PYRIL        QAAHMAKRGHCWAV-----GSQDYDSLLFGSPRLVRNLAVSPRRKI--GE---EVIELSP
FEN_PYRNV        QAAHMAKRGHCWAV-----GSQDYDSLLFGSPRLVRNLAVSPKRRS--GE---EVVEVSP
FEN_PYRCJ        QAAHMAKRGHCWAV-----GSQDYDSLLFGSPRLVRNLAVSPKRKV--GE---EVVELSP
FEN_CALMQ        QAAYMASKGIVWAA-----GSQDYDSFLFGAPRLVRNLTISGRRKLPGRD---EYVEVTP
FEN_METKA        QCAYMARCGDVWAT-----GSQDYDSLLFGSPRLVRNITIVGKRKHPHTG---EIIEVKP
FEN_CENSY        TAAYLTQTGDAYAS-----ASQDFDSVLFGAKRLVRNFTNSGRRKIPNRN---MYVDVQP
FEN_NITMS        TAAHLTNTGQAYAS-----ASQDFDSILCGAKRLVRNFTNSGRRKIPNKN---TYIDIVP
FEN_METTH        QASYMVKMGDAWAV-----ASQDYDCLLFGAPRVVRNLTLS-------------GKLEDP
FEN_METS3        QAAYLVENGDAWAV-----ASQDYDCLLFGAKRVVRNLAIN-------------SNLGDL
FEN_METST        QASYMVSQNDAWAV-----VSQDYDCLQFGATRMIRNLKLSK------------SNSKNL
FEN_METMJ        QAAYMARQGKVTYA-----VSQDYDSLLFGSPVLVRNLTVSGRRKTRGR-----TITVNP
FEN_METB6        QAAFMVQRGDARFA-----VSQDYDTLLFGAPLLMRNLTVSGKRKIRGR-----AVTVNP
FEN_METPE        QAASMAASGAVTYA-----VSQDYDSLLFGAPLLVRNLTVSSKRRVQGR-----TIAVQP
FEN_METHJ        QGAYMVLKGDADYV-----VSQDYDTLLFGTPVLVRNLTISGKRRLHGR-----QITVQP
FEN_METLZ        QSSFMTKNGDVTYA-----VSQDYDSLLFGAPDLVRNITVSGKKRIRGK-----VLSVYP
FEN_THEAC        QASYMTKK-NVDGV-----ISQDYDCLLFGARKILRNFAIYGRRKVPRKN---IYKTVYP
FEN_THEVO        QASYMTRK-DADGV-----ISQDYDCLLFGAKKILRNFAIYGRRKVPRKN---VYRTVYP
FEN_PICTO        QASYMTLKGDVNAV-----VSQDYDCLLFGAKRILRNFTVYGRRRIAGTS---RTINVNP
FEN_METJA        QASYMAKKGDVWAV-----VSQDYDALLYGAPRVVRNLTTT---------------KEMP
FEN_META3        QCAHMIKNGDAYCV-----VSQDYDALLYGAPRTVRNITAS---------------NKPL
FEN1_LEIIN       QCAELVKKGKAW-----AVGTEDMDALTFGSTVMLRHLNISDAKK------------RPI
FEN1_LEIMA       QCAELVKKGKAW-----AVGTEDMDALTFGSTVMLRHLNISDAKK------------RPI
FEN1_LEIBR       QCAELVKKGKAW-----AVGTEDMDALTFGSTVMLRHLNISDAKK------------RPI
FEN1_TRYB2       QCAELVKKNKAW-----AVGTEDMDALAFGSRVMLRHLTYGEAKK------------RPI
FEN1_TRYB9       QCAELVKKNKAW-----AVGTEDMDALAFGSRVMLRHLTYGEAKK------------RPI
FEN1_TRYCC       QCAELVKKKKAW-----AVATEDMDALTFGAPVMLRHLTYSEAKK------------RPI
FEN1_ARATH       QCAALCKSGKVY-----GVASEDMDSLTFGAPKFLRHLMDPSSRK------------IPV
FEN1_SOYBN       QCAALCKAGKVY-----GVVSEDMDSLTFGAPKFLRHLMDPSSKK------------IPV
FEN11_ORYSI      ECAALCINDMVY-----AVASEDMDSLTFGAPRFLRHLMDPSSKK------------IPV
FEN11_ORYSJ      ECAALCINDMVY-----AVASEDMDSLTFGAPRFLRHLMDPSSKK------------IPV
FEN11_SORBI      ECAALCKNDKVF-----AVASEDMDSLTFGAPRFLRHLMDPSSKK------------IPV
FEN1_MAIZE       ECAALCINDKVF-----AVASEDMDSLTFGAPRFLRHLMDPSSKK------------IPV
FEN11_PHYPA      ECASLCKAEKVF-----AVASEDMDSLTYGSTRFLRHLMEPTSRK------------LPV
FEN1_OSTLU       SCAAMCKAGLVW-----AVATEDMDTLTFAAPRLARNLMAPKSQD------------KPV
FEN1_OSTTA       TCAAMCKAGLVW-----AVGTEDMDTLTFAAPRVARNLMAPKSAE------------KPV
FEN1_MICCC       TCAALCKAGLVY-----AAASEDMDTLCFSTPKLARNLMAPSSQE------------KPI
FEN1_CHLRE       QCAEMAKSGLVY-----GLATEDMDALTFGAPRVIRHLMAPSSQN------------VPV
FEN1_NAEGR       QCAELCKGGLVY-----ATATEDMDALTYATPVLARHLTFSEARK------------QPI
FEN1_BOVIN       SCAALVKAGKVY-----AAATEDMDCLTFGSPVLMRHLTASEAKK------------LPI
FEN1_SHEEP       SCAALVKAGKVY-----AAATEDMDCLTFGSPVLMRHLTASEAKK------------LPI
FEN1_HUMAN       SCAALVKAGKVY-----AAATEDMDCLTFGSPVLMRHLTASEAKK------------LPI
FEN1_MACFA       SCAALVKAGKVY-----AAATEDMDCLTFGSPVLMRHLTASEAKK------------LPI
FEN1_MOUSE       SCAALAKAGKVY-----AAATEDMDCLTFGSPVLMRHLTASEAKK------------LPI
FEN1_RAT         SCAALAKAGKVY-----AAATEDMDCLTFGSPVLMRHLTASEAKK------------LPI
FEN1_CHICK       SCATLVKAGKVY-----AAATEDMDCLTFGSPVLMRHLTASEAKK------------LPI
FEN1A_XENLA      TCAALVKAGKVY-----AAATEDMDALTFGTPVLLRHLTASEAKK------------LPI
FEN1B_XENLA      TCAALVKAGKVY-----AAATEDMDALTFGTPVLLRHLTASEAKK------------LPI
FEN1_XENTR       TCAALVKAGKVY-----AAATEDMDALTFGTPVLLRHLTASEAKK------------LPI
FEN1_ANOFI       TCAALVKAGKVF-----ATATEDMDGLTFGTNVLLRHLTASEAKK------------LPI
FEN1_XIPMA       SCAALVKEGKVF-----ATATEDMDGLTFGTNVLLRHLTASEAKK------------LPV
FEN1_SALSA       SCAALVKAGKVF-----ATATEDMDGLTFGTGVLLRHLTASEAKK------------LPI
FEN1_OSMMO       SCAALVKAGKVF-----ATATEDMDGLTFGTGVLLRHLTASEAKK------------LPI
FEN1A_DANRE      SCAALVKAGKVY-----ATATEDMDGLTFGTTVLLRHLTASEAKK------------LPI
FEN1_BRAFL       QCAELAKKGKVY-----AAGTEDMDVLTFGTNIMLRHLTFSEARK------------MPI
FEN1_NEMVE       QCAALVKSGKVY-----ATGTEDMDALTFGTTVMLRHLTFSEAKK------------MPI
FEN1_TRIAD       QCAALVKAGKVY-----ATGTEDMDALTFGSNVMLRHLTFSEARK------------MPI
FEN1_AEDAE       QCAALVKGGKVY-----ATATEDMDALTFGSNILLRHLTFSEARK------------MPV
FEN1_ANOGA       QCAALVRAGKVY-----ATATEDMDALTFGSNILLRHLTFSEARK------------MPV
FEN1_GLOMM       QCAALVKAGKVY-----ATATEDMDALTFGSGILLRHLTFSEARK------------MPV
FEN1_DROER       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROYA       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROSE       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROSI       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROME       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROPE       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROPS       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROAN       QCAALVKAGKVY-----ATATEDMDALTFGSTKLLRYLTYSEARK------------MPV
FEN1_DROWI       QCAALVKAGKVY-----ATATEDMDALTFGSSKLLRYLTYSEARK------------MPV
FEN1_DROGR       QCAALVKAGKVY-----ATATEDMDALTFGSCKLLRYLTYSEARK------------MPV
FEN1_DROMO       QCAALVKAGKVY-----ATATEDMDALTFGSCKLLRYLTYSEARK------------MPV
FEN1_DROVI       QCAALVKAGKVY-----ATATEDMDALTFGSCKLLRYLTYSEARK------------MPV
FEN1_MONBE       QCAELVKGGKVF-----ATATEDMDALTFGTTVLLRHMTFSEARK------------MPI
FEN1_CAEBR       QCANLVKAGKVY-----GTATEDMDALTFGSCVLLRHLLAPEAKK------------IPI
FEN1_CAEEL       QCAHLVKAGKVF-----GTVTEDMDALTFGSTVLLRHFLAPVAKK------------IPI
FEN1_BRUMA       QCAALAKAGKVF-----ATVSEDMDALTFGSPILLRQMIASEAKK------------LPV
FEN1_AJECH       QCAVLARAGKVY-----AAASEDMDTLCFDSPILLRHLTFSEQRK------------EPI
FEN1_AJECN       QCAVLARAGKVY-----AAASEDMDTLCFDSPILLRHLTFSEQRK------------EPI
FEN1_AJEDR       QCAVLARAGKVY-----AAASEDMDTLCFDSPILLRHLTFSEQRK------------EPI
FEN1_UNCRE       QCAVLARAGKVY-----AAASEDMDTLCFDSPILLRHLTFSEQRK------------EPI
FEN1_ASPFU       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_ASPFC       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_NEOFI       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_ASPCL       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_ASPFN       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_ASPTN       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_EMENI       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_ASPNC       QCAVLARAGKVY-----AAASEDMDTLCFETPILLRHLTFSEQRK------------EPI
FEN1_PENRW       QCAVLARAGKVY-----AAASEDMDTLCFESPILLRHLTFSEQRK------------EPI
FEN1_TALMQ       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_TALSN       QCAVLARAGKVY-----AAASEDMDTLCFEAPILLRHLTFSEQRK------------EPI
FEN1_ARTOC       QCAVLAKEGKVF-----GAASEDMDTLCFAAPVLLRHLTFSEQRK------------EPI
FEN1_PHANO       QCATLARGGKVY-----AAASEDMDTLTFNTPILLRHLTFSEQRK------------EPI
FEN1_PYRTR       QCAALARGGKVY-----AAASEDMDTLTFDTPILLRHLTFSEQRK------------EPI
FEN1_NEUCR       QCAVLARAGKVY-----AAASEDMDTLCFNAPILLRHLTFSEQRK------------EPI
FEN1_SORMK       QCAVLARAGKVY-----AAASEDMDTLCFHTPILLRHLTFSEQRK------------EPI
FEN1_FUSV7       QCAVLAQAGKVY-----AAASEDMDTLCFNSPILLRHLTFSEQRK------------EPI
FEN1_MAGO7       QCAVLARAGKVF-----AAASEDMDTLCFDSPILLRHLTFSEARK------------EPI
FEN1_COPCI       QCAELARGGKVY-----AAGSEDMDTLTFNAPILFRHLTFSEAKK------------QPI
FEN1_COPC7       QCAELARGGKVY-----AAGSEDMDTLTFNAPILFRHLTFSEAKK------------QPI
FEN11_LACBS      QCAELARGGKVY-----AAGSEDMDTLTFNAPILFRHLTFSEAKK------------QPI
FEN12_LACBS      QCAELARGGKVYIALYYAAGSEDMDTLTFNAPILFRHLTFSEAKK------------QPI
FEN1_CRYNJ       QCAELARAGKVY-----AAGSEDMDTLTFNSPILLRHLTFSEAKK------------MPI
FEN1_USTMA       QCAELARAGKVY-----AAGSEDMDTLTFGTPILLKHLTASEQKK------------LPV
FEN1_SCHJY       QCAALARAGKVY-----AAASEDMDTMCFQAPILLRHLTFSEQRK------------EPI
FEN1_SCHPO       QCAALARSGKVY-----AAASEDMDTLCFQAPVLLRHLTFSEQRK------------EPI
FEN1_ASHGO       QCAELAKKGKVF-----AAASEDMDTLCYRTPYLLRHLTFSEARK------------EPI
FEN1_KLULA       QCAELAKSGKVF-----AAASEDMDTLCYQTPVLLRHLTFSEARK------------LPI
FEN1_YEAST       QCAELAKKGKVY-----AAASEDMDTLCYRTPFLLRHLTFSEAKK------------EPI
FEN1_YEAS7       QCAELAKKGKVY-----AAASEDMDTLCYRTPFLLRHLTFSEAKK------------EPI
FEN1_YEAS2       QCAELAKKGKVY-----AAASEDMDTLCYRTPFLLRHLTFSEAKK------------EPI
FEN1_YEAS8       QCAELAKKGKVY-----AAASEDMDTLCYRTPFLLRHLTFSEAKK------------EPI
FEN1_YEAS1       QCAELAKKGKVY-----AAASEDMDTLCYRTPFLLRHLTFSETKK------------EPI
FEN1_VANPO       QCAELAKCGKVY-----AAASEDMDTLCYRTPYLLRHLTFSEAKK------------EPI
FEN1_CANGA       QCAELAKKGKVY-----AAASEDMDTLCYRTPYLLRHLTFSEARK------------EPI
FEN1_ZYGRC       QCAQLAKDGKVY-----AAASEDMDTLCYKTPYLLRHLTFSEAKK------------EPI
FEN1_LACTC       QCAELAKAGKVY-----AAASEDMDTLCYRTPFLLRHLTFSEAKK------------EPI
FEN1_CANAW       QCAELARGGKVY-----AAASEDMDTLCYEPPFLLRHLTFSEARK------------MPI
FEN1_CANAL       QCAELARGGKVY-----AAASEDMDTLCYEPPFLLRHLTFSEARK------------MPI
FEN1_CANDC       QCAELARGGKVY-----AAASEDMDTLCYEPPFLLRHLTFSEARK------------MPI
FEN1_CANTT       QCAELARGGKVY-----AAASEDMDTLCYEPPQLLRHLTFAEARK------------IPI
FEN1_LODEL       QCAELARGGKVF-----AAASEDMDTLCYEPPQLLRHLTFAEARK------------MPI
FEN1_PICST       QCAELARTGKVF-----AAASEDMDTLCYEPPYLLRHLTFAEARK------------MPI
FEN1_CLAL4       QCAELARAGKVF-----AAASEDMDTLCYEPKYLLRHLTVAEARK------------MPI
FEN1_PICGU       QCAELAVAGKVF-----AAASEDMDTLCYSPPYLLRHLTFAEARK------------MPI
FEN1_DEBHA       QCAELARGGKVF-----AAASEDMDTICYQPPFLLRHLTFSEARK------------MPI
FEN1_KOMPG       QCAELAKGGKVY-----AAASEDMDTLCYETPYLLRHMTTAEARK------------LPV
FEN1_YARLI       QCAKLAEAGKVY-----AAASEDMDTLCFGSPVLLRHLTFSEAKK------------MPI
FEN1_DICDI       QCAEIVKKGKAW-----ATGSEDMDSLTLGSTVLLRRLFFSEAKK------------MPI
FEN1_POLPP       QCAELCKGGKAW-----ATGSEDMDSLTLGTTILLRRLTFSEARK------------LPI
FEN11_PARTE      QCAELCRAGKIY-----ATATEDMDALTFRTPVLLRGFN---TKK------------EPI
FEN12_PARTE      QCAELCRAGKIY-----ATATEDMDALTFRTPVLLRGFN---TKK------------EPI
FEN1_TETTS       QCAALAKAKKVF-----ATVTEDMDALTFATPFLLRNLN---SKK------------EPI
FEN1_PHATC       QAAALCKAGLVY-----ATGTEDMDALTFATPILVRKLTFANASK------------SMV
FEN1_THAPS       QAAALARSGKVY-----AAATEDMDALTFRSPVMVRKMTFANASK------------SDV
FEN1_PHYIT       SCAALAKGGRVY-----AAGTEDMDALTFGVPVLYRRLTVSPAKK------------IPI
FEN1_ENTDS       TCAALVKAGKCY-----ATATEDMDALTLGSEYVVRKFSASDNKK------------EPI
FEN1_ENTHI       TCAALVKAGKCY-----ATATEDMDALTLGSEHVVRKFSANDNKK------------DPI
FEN1_ENCCU       YCALLCKKKAVY-----GVATEDMDALTFGSPVVLRNFNGTQSKR------------LPV
FEN1_ENTBH       YCAWLCKSKFVD-----AVATEDMDSLCFGSPLLLRNFNTALSQK------------LPV
FEN1_PLABA       QCAFLTKYEMAH-----ATATEDADALVFGTKILIRNLNANASSN-KNKNKNSSKRGYIL
FEN1_PLAYO       QCAFLTKYEMAH-----ATATEDADALVFGTKILIRNLNANASSN-KNKNKNSSKRGYIL
FEN1_PLACH       QCAFLTKYDMAH-----ATATEDADALVFGTKILIRNLNANASSN-KNKNKNSSKRGYIL
FEN1_PLAKH       QCAFLTKYNLAH-----ATATEDADALVFGTKILIRNLNANASSTSQNKNKNSSKRGYIL
FEN1_PLAVS       QCAFLTKYNLAH-----ATATEDADALVFGTKILIRNLNANASSANQNKNKNSSKRGYIL
FEN1_PLAFA       QCAFLTKYNLAH-----ATATEDADALVFGTKILIRNLNANATSN-QNKNKNNSKRGYIL
FEN1_PLAF7       QCAFLTKYNLAH-----ATATEDADALVFGTKILIRNLNANATSN-QNKNKNNSKRGYIL
FEN1_CRYMR       QCAELCKEGLVY-----GVATEDADSLTFGTPLVIRHLNFSDG---KFSD-SKGNSKNSL
FEN1_CRYPI       QCAELCKDGLVY-----GVVTEDADSLTFGTPIQIKQLNFSESSN-KITDKSPSKQKNGM
FEN1_GIAIC       QCVAMAKERVCE-----GVASSDLDVLAFGSPCLIRNLAQGGDRE--------------I
FEN1_THEAN       QCAYLVTKNLCH-----FVASEDTDTLVFGGWFLLRNVTSSANKK--------------I
FEN1_THEPA       QCAYLVTKNLCR-----FVASEDTDTLVFGGAFLLRNVASSSSKK--------------I
FEN1_BABBO       QCAYLCQRGFVT-----AVGSEDADALVFRCGVLLKNLTAS-NKP--------------V
FEN_HALMA        QASVMARRGD-VDYVG----TEDYDALLFGAPMTLRQITSKGDPE---------------
FEN_NATPD        QAAHMARRGD-ADYVG----SEDYDALLLGAPYTLRGLTSNGDPE---------------
FEN_HALWD        QAAEMAIRGD-VDYVG----SEDYDTLLFGAPYTVRQLTSKGDPE---------------
FEN_HALSA        QAAYMTRTDDAVDYAG----SDDYDCLLLGSPVTLRQLTSSGHPE---------------
FEN_HALS3        QAAYMTRTDDAVDYAG----SDDYDCLLLGSPVTLRQLTSSGHPE---------------
                     :               :.* * .        : .                      

FEN_HYPBU        ELIELDKLLKALGIT-REQ-LVALGILIGTDYNPDGVKGIGPKTALKMVKAHRDPVKLLQ
FEN_STAMF        EIIELKKLLEKLGLT-REQ-LIYVAILIGTDYNPDGVKGIGPKKALQLVKAYKTLDKILK
FEN_AERPE        EIIELEPLLSKLGIT-REQ-LIAVGILLGTDYNPGGVRGYGPKTALRLVKSLGDPMKVLA
FEN_THEPD        EIVELEELLRVHGIT-HQQ-LVVIGILVGTDYAPEGARGIGVKKALKLVKELKDPEKIFR
FEN_IGNH4        EEITLKCVLEELGIT-REQ-LVAIAVLIGTDYTP-GVKGVGPKTALRYVKSYGDLERVLT
FEN_PYRAB        ELIVLEEVLKELKIT-REK-LIELAILVGTDYNPGGIKGIGPKKALEIVKYSKDP---LA
FEN_PYRHO        ELVVLDEVLKELKIT-REK-LIELAILVGTDYNPGGVKGIGPKKALEIVRYSRDP---LA
FEN_PYRFU        ELIILEEVLKELKLT-REK-LIELAILVGTDYNPGGIKGIGLKKALEIVRHSKDP---LA
FEN_THEKO        ELVVLEEVLKELGID-REK-LIELAILVGTDYNPGGIKGIGPKKALTIVKRTKDP---LA
FEN_THEON        ELIVLEEVLKELSID-REK-LIEMAILVGTDYNPGGIKGIGPKKALTIVKRTKDP---LK
FEN_THEGJ        ELIVLEEVLRELGID-REK-LIELAILVGTDYNPGGIKGIGPKKALTIVKRSKDP---LK
FEN_THESM        ELILLEDVLKELKLT-REK-LIELAILVGTDYNPGGIKGLGPKKALEIVKYSKDP---LS
FEN_KORCO        ELIELESVLKRNGIS-REQ-LIMIGILVGTDYNLGGVKGIGVKRALELVKKYKRPEDLFS
FEN_METAC        EVIELEETLRALEIN-RDQ-LIDIAICVGTDYNK-GLEKVGPKTALKLIKKHGD---IHA
FEN_METBF        ELIELEETLGVLGIN-REQ-LIDIAICVGTDFNK-GLEKVGPKTALKLIKKHGD---IHA
FEN_METMA        EMIELEETLDSLGIN-RDQ-LIDIAICVGTDYNK-GLEKVGPKTALKLIKKHGN---IHA
FEN_METBU        EVLSLVDSLGELGIT-RQQ-LIDIAMCVGTDYNT-GLENIGPKRALKLVKEHGD---IKV
FEN_METAR        EVIELQEVLATLGLT-REE-LIDMAILVGTDYNP-GIFKVGPKTALKLVKKHGDN--MPA
FEN_METTP        EVIILEEELTRLGIS-REQ-LIDIGIMCGTDYNR-GLPKVGPKRALKLIREHGC---LEA
FEN_ARCFU        EIIILESNLKRLGLT-REQ-LIDIAILVGTDYNE-GVKGVGVKKALNYIKTYGD---IFR
FEN_SACS2        ELIETEILLKKLGIT-REQ-LIDIGILIGTDYNPDGIRGIGPERALKIIKKYGKIEKAME
FEN_SULTO        ELIELDTLLKKLGLT-REQ-LIDIGIIVGTDYNPDGIKGYGVKTAYRIIKKYGSLEKAIE
FEN_SULAC        ELIELESLLKKLGIN-REQ-LIDIAILIGTDYNPDGVKGIGVKTALRIIKKYNNIENAIE
FEN_NANEQ        EVIELEAVLNYWKIT-REQ-LIAIAMLLGTDYN-EKVPGIGPKTAIEIVKRFGDPIKVIE
FEN_PYRAE        EIIELDAVLRALRLKNREQ-LIDLAILLGTDYNPDGVPGVGPQKALKLIWEFGSLEKLLE
FEN_PYRAR        EIIELDAVLKSLRLRSREQ-LIDLAILLGTDYNPDGVPGIGPQRALKLIWEFGSLEKLLD
FEN_PYRIL        EIIELDAVLKSLRLKNREQ-LIDLAILLGTDYNPDGVPGVGPQKALKLVWEFGGLEKMLE
FEN_PYRNV        EVVELDSVLKALKLKGREQ-LIDVAILLGTDYNPDGVPGVGPQKALKLVLEFGSLEKMLD
FEN_PYRCJ        ELIELDAVLKSLKLKGREQ-LIDLAILLGTDYNPEGVPGVGPQKALKLIWEFGSLEKLLQ
FEN_CALMQ        ELIELNDVLKALRLRDRGQ-LIDLAILLGTDYNPEGIPGIGPQRALRLIQEYGSLDKLMN
FEN_METKA        EIMRLEDVLDQLGLESREQ-LVDLAILLGTDYNPDGVPGIGPKRALQLIRKYGSLDELKD
FEN_CENSY        EIIETEKTLTTLDLT-REQ-LVDVGILIGTDFNPDGFERIGPKTALKLVHEHGRLEDIPR
FEN_NITMS        EIIETQKTLDSLELT-REE-LIDVGILIGTDFNPNGFERVGPKTALKMIKQHSKLEEIPQ
FEN_METTH        EIIELESTLRELSIS-HTQ-LVDMALLVGTDFNEG-VKGIGARRGLKLIREKGDIFKVIR
FEN_METS3        EYYNLKRVLDELDIN-REQ-LIDMGILIGTDFSEG-LKGVGAKTALKLAK-KGELENKLA
FEN_METST        ELISLEKTLKELNLT-REQ-LVDVAMLVGTDFNKG-VYGIGAKKGIKLIHKYGTLEKALE
FEN_METMJ        ERIVLSSFLDRLGVT-REQ-LVKIGILVGTDFNPG-IRGVGGKTALKIVR-NGEFESVIA
FEN_METB6        ERLVLSEVLSGLSLT-REQ-LVEVGILVGTDFNPG-AAGVGAKTALKIVK-SGGFAQKLA
FEN_METPE        ESIRLDEVLGGLGIT-REQ-LIEAGILIGTDFNPG-IRGVGPKTALKIVK-KDGFADMIA
FEN_METHJ        ERIVLSDVLSTLDIT-REQ-LIEIAILTGTDFNPG-IRGIGAKTGLKKIK-SGEFDSIIR
FEN_METLZ        ERLRLEEVLTGLSVT-QEE-LIQIALLIGTDYNSG-VPGVGPKTAVKIVR-EGKFYDRIG
FEN_THEAC        EYIILDEVLSANQIN-QDQ-LIGIGILVGTDFNEG-IKGIGAKKALALIKKEGDIKSVLK
FEN_THEVO        EYVMLDEVLKKNGIN-QDQ-LIEIGILVGTDFNEG-IKGIGAKKALALIKKEGNIKAVLN
FEN_PICTO        EIIDLNENLSNLGIS-REQ-LIYIGILTGTDFNPG-VKGIGAKTALSLIKKYNDIYSVIK
FEN_METJA        ELIELNEVLEDLRIS-LDD-LIDIAIFMGTDYNPGGVKGIGFKRAYELVR-SGVAKDVLK
FEN_META3        ELMEIEDILKPLDIS-IDD-LIDMAILIGTDYNIGGIKGIGPKKALTIIK-NKKMNEYIK
FEN1_LEIIN       AEIHLDEVLQITGLSMGQ--FVDLCILLGCDYVPK-VPGIGPQKAWEGIQRYGSIESFLE
FEN1_LEIMA       VEIHLDEVLQTTGLSMDQ--FVDLCILLGCDYVPK-VPGIGPQKAWEGIQRYGSIESFLE
FEN1_LEIBR       AEIHLDEVLQATGLSMDQ--FVDLCILLGCDYVPK-VPGIGPQRAWEGIQRYGNIESFLE
FEN1_TRYB2       AEYHLDEILEASGFSMQQ--FIDLCILLGCDYVPR-ISGIGPHKAWEGIKKYGSLEAFIE
FEN1_TRYB9       AEYHLDEILEASGFSMQQ--FIDLCILLGCDYVPR-ISGIGPHKAWEGIKKYGSLEAFIE
FEN1_TRYCC       AEFHLDEILGITGLTMTQ--FIDLCILLGCDYVPK-IPGIGPQKAWEGIKKHGDIETLLQ
FEN1_ARATH       MEFEVAKILEELQLTMDQ--FIDLCILSGCDYCDS-IRGIGGQTALKLIRQHGSIETILE
FEN1_SOYBN       MEFEVAKILEELNMTMDQ--FIDLCILSGCDYCDS-IRGIGGLTALKLIRQHGSIENIPE
FEN11_ORYSI      MEFEVAKVLEELELTMDQ--FIDLCILSGCDYCDS-IKGIGGQTALKLIRQHGSIESILE
FEN11_ORYSJ      MEFEVAKVLEELELTMDQ--FIDLCILSGCDYCDS-IKGIGGQTALKLIRQHGSIESILE
FEN11_SORBI      MEFDVAKVLEELELTMDQ--FIDLCILCGCDYCDS-IKGIGGQTALKLIRQHGSIESILE
FEN1_MAIZE       MEFDVAKVLEELELTMDQ--FIDLCILCGCDYCDS-IKGIGGQTALKLIRQHGSIESILE
FEN11_PHYPA      LEFDIAKVLEGLGLNMDQ--FVDLCILCGCDYCDT-IRGIGPQTALKMIRQHGSLEIVLE
FEN1_OSTLU       LEFDYDKVLAGLGLTPEQ--FIDMCILCGCDYCDT-IRGIGPKTALKLIKEHGSIEKILE
FEN1_OSTTA       LEFDYEKTIAGLGLTADQ--FIDLCILCGCDYTDT-IRGVGPKTALKLIKEHGSIEKILE
FEN1_MICCC       LEFDFDKLLAGLELTWDQ--FIDVCILCGCDYCDS-IKGIGPVNALKYIKQYGNIEGLLE
FEN1_CHLRE       QEFDREVALRELELTDDQ--FIDLCILMGCDYCGT-IRGIGAVRALQMIKKHGSIEGMLK
FEN1_NAEGR       QEFTFKQVIEGLGVTVDQ--FIDICILCGCDYTDS-IKGIGPKKALAMIKKYGNIENLLK
FEN1_BOVIN       QEFHLSRILQELGLNQEQ--FVDLCILLGSDYCES-IRGIGPKRAVDLIQKHKSIEEIVR
FEN1_SHEEP       QEFHLSRILQELGLNQEQ--FVDLCILLGSDYCES-IRGIGPKRAVDLIQKHKSIEEIVR
FEN1_HUMAN       QEFHLSRILQELGLNQEQ--FVDLCILLGSDYCES-IRGIGPKRAVDLIQKHKSIEEIVR
FEN1_MACFA       QEFHLSRILQELGLNQEQ--FVDLCILLGSDYCES-IRGIGPKRAVDLIQKHKSIEEIVR
FEN1_MOUSE       QEFHLSRVLQELGLNQEQ--FVDLCILLGSDYCES-IRGIGAKRAVDLIQKHKSIEEIVR
FEN1_RAT         QEFHLSRVLQELGLNQEQ--FVDLCILLGSDYCES-VRGIGPKRAVDLIQKHKSIEEIVR
FEN1_CHICK       QEFHLNRVLQDLGLTWEQ--FVDLCILLGCDYCES-IRGIGPKRAVELIKQHKTIEEIIQ
FEN1A_XENLA      QEFHLNRVIQDIGITHEQ--FVDLCILLGSDYCET-IRGIGPKRAIDLIRQHKTIDEIID
FEN1B_XENLA      QEFHLNRVFQDIGINHEQ--FVDLCILLGSDYCET-IRGIGPKRAIDLIRQHKTIEEIID
FEN1_XENTR       QEFHLNRVMQDMGVSHEQ--FVDLCILLGSDYCET-IRGIGPKRAIDLIRQHKSIEEIVD
FEN1_ANOFI       QELHYSRILQDIGLTNEQ--FIDLCIPLGCDYCGT-IKGIGPKRAIDLIKQHGSIEEILE
FEN1_XIPMA       QEFHFNRILQDIGLTSEQ--FIDLCILLGCDYCGT-IKGIGPKRAIDLIRQHGSIEEILE
FEN1_SALSA       QEFQFTRLLQDINLTHEQ--FIDLCILLGCDYCGT-IKGIGPKRAIDLIRQHGSIEEILE
FEN1_OSMMO       QEFHFSRILQDIGLSHEQ--FIDLCILLGCDYCGT-IKGIGPKRAMDLIRQHGSIEEILD
FEN1A_DANRE      QEFHFSRILQDMELTHQQ--FIDLCILLGCDYCGT-IKGIGPKRAIDLIKQHGSIEEILE
FEN1_BRAFL       KEYYYDRLLAELDLTQDQ--FIDLCILLGCDYCDS-IRGIGPKRAIELIRQYKSIEEILK
FEN1_NEMVE       KEFHLQNVLSEAGLSQDE--FIDLCILLGCDYCDS-IKGIGPKRSVDLIRQHRSIDKILE
FEN1_TRIAD       QEFHLKNALQELNFSMEQ--FIDLCILLGCDYCDS-IKGVGPKRAVGLIEKYKSIEDIVK
FEN1_AEDAE       QEFNYDKILQGLELTRDE--FIDLCILLGCDYCDS-IRGIGPKKAVELINKHRTIEKILE
FEN1_ANOGA       QEFAYEKVLKGFELTQDE--FIDLCILLGCDYCDT-IRGIGPKKAIELINKHRSIEKILE
FEN1_GLOMM       KEFSYAKVLDGFGLTSQE--FIDLCILLGCDYCDG-IRGIGPKRATELMNSYKDIETILE
FEN1_DROER       KEFSYDKLLEGLSINSRE--FIDLCILLGCDYCES-IKGIGPKRAIELINNYRDIETILD
FEN1_DROYA       KEFSYEKLLEGLSINSRE--FIDLCILLGCDYCES-IKGIGPKRAIELINNYRDIETILD
FEN1_DROSE       KEFSYDKLLEGLAINNRE--FIDLCILLGCDYCES-IKGIGPKRAIELINTYRDIETILD
FEN1_DROSI       KEFSYDKLLEGLAINNRE--FIDLCILLGCDYCES-IKGIGPKRAIELINTYRDIETILD
FEN1_DROME       KEFSYDKLLEGLAINNRE--FIDLCILLGCDYCES-IKGIGPKRAIELINTYRDIETILD
FEN1_DROPE       KEFSYDKLLEGLEVNNRE--FIDLCILLGCDYCES-IKGIGPKRAIELINNYRDIETILD
FEN1_DROPS       KEFSYDKLLEGLEVNNRE--FIDLCILLGCDYCES-IKGIGPKRAIELINNYRDIETILD
FEN1_DROAN       KEFSYEKLLDGLGVNNRE--FIDLCILLGCDYCES-IKGIGPKRAIELINNYRDIETILD
FEN1_DROWI       KEFTYEKLLQGLELNQRE--FIDLCILLGCDYCES-IKGIGPKRAIELINSYRDIETILD
FEN1_DROGR       KEFSYDKVLQGLELTSKE--FIDLCILMGCDYCES-IRGVGPKRAIELIKSYRDIETILE
FEN1_DROMO       KEFSYDKVLQGLELTSKE--FIDLCILMGCDYCDS-IKGIGPKRAIELIKTYRDIETILE
FEN1_DROVI       KEFSYDKVLQGLELTSKE--FIDLCILMGCDYCES-IKGVGPKRAIELIKSYRDIETILE
FEN1_MONBE       QEFRLQK--GGLEMSMEE--FIDMCILLGCDYCDS-IKGIGRQKAYQLIKEHKNIETVLK
FEN1_CAEBR       KEFHLARVLEEMQLTKDQ--FIDLCILLGCDYCGT-IRGIGPKKAVELIKQHKNIETVLE
FEN1_CAEEL       KEFNLSLALEEMKLSVEE--FIDLCILLGCDYCGT-IRGVGPKKAVELIRQHKNIETILE
FEN1_BRUMA       KEMNLNQVLKDFGMNMGQ--FVDLCILLGCDYVST-IRGIGPKKAFELIKKYECIENVLE
FEN1_AJECH       LEIHLDRVLEGLDMDRKQ--FVDLCILLGCDYLDP-IPKVGPNTALKLIRDHGSLEQVVE
FEN1_AJECN       LEIHLDRVLEGLDMDRKQ--FVDLCILLGCDYLDP-IPKVGPNTALKLIRDHGSLEQVVE
FEN1_AJEDR       LEIHLDRVLEGLDMDRKQ--FVDLCILLGCDYLDP-IPKVGPNTALKLIRDHGSLEKVVE
FEN1_UNCRE       LEIHLDRVLEGLGMDRKT--FVDLCILLGCDYLDP-IPKVGPNTALKLIRDHGSLEKVVE
FEN1_ASPFU       QEIHLNRALEGLGMDRKQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIREHGSLEKVVE
FEN1_ASPFC       QEIHLNRALEGLGMDRKQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIREHGSLEKVVE
FEN1_NEOFI       QEIHLNRTLEGLGMDRKQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIREHGSLEKVVE
FEN1_ASPCL       QEIHLNRVLEGLDMDRSQ--FIDMCILLGCDYLEP-IPKVGPNTALKLIREHGSLEKVVE
FEN1_ASPFN       LEIHLSRALEGLDMDRKQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIREFGSLEKVVE
FEN1_ASPTN       QEIHLSRALEGLDMDRAK--FIDLCILLGCDYLEP-IPKVGPNTALKLIRDHGSLEKVVE
FEN1_EMENI       QEIHLNRALEGLGMDRNQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIRDHGTLEKVVE
FEN1_ASPNC       QEIHLNRALEGLGMDRKQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIRDHGSLEKVLE
FEN1_PENRW       QEIHLDRALEGLDMDRAQ--FIDLCILLGCDYLEP-IPKVGATTALSLIKEHKSLEKVLE
FEN1_TALMQ       LEIHLDKALEGLGMDMAQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIREHGSLEKVVE
FEN1_TALSN       QEIHLDKALEGLGMDRKQ--FIDLCILLGCDYLEP-IPKVGPNTALKLIREHGSLEKVVE
FEN1_ARTOC       LEIHLDKVLEGLGMEMTQ--FVDLCILLGCDYLDP-IPKVGPNTALKMIRDHGTLEKVVE
FEN1_PHANO       LEIHLDKVLEGLEMEREQPQFIDLCILLGCDYLDP-IKGIGPSTALKLIRDHKTLEGVVA
FEN1_PYRTR       LEIHLDKVLEGLQMERKQ--FIDLCILLGCDYLDP-IKGIGPSTALKLIREHNDLEGVVE
FEN1_NEUCR       QEIHLEKVLEGLGMERKQ--FIDLCILLGCDYLDP-IPKVGPSTALKLIREHGTLEKVVE
FEN1_SORMK       QEIHTDKVLEGLGMDRKQ--FVDLCILLGCDYLDP-IPKVGPSTALKLIREHGTLEEVVE
FEN1_FUSV7       QEIHLEKVLEGLGMERKQ--FVDLCILLGCDYLDP-IPKVGPTTALKLIRDHGSLEKIVE
FEN1_MAGO7       QEIHVDKVLEGLDMDRKQ--FVDLCILLGCDYLDP-IPKVGPSTALKLIREHGSLETIVE
FEN1_COPCI       SEINLEAALKGLDMDMSQ--FVDLCILLGCDYLEP-IKGVGPKSALKLIREFGGLKEVVE
FEN1_COPC7       SEINLEAALKGLDMDMSQ--FVDLCILLGCDYLEP-IKGVGPKSALKLIREFGGLKEVVE
FEN11_LACBS      SEINLKEALEGLDMNMSQ--FIDLCILLGCDYLEP-IKGVGPKSALKLIREYGGLKGVVK
FEN12_LACBS      SEINLKEALEGPLYSFPT--FIDLCILLGCDYLEP-IKGVGPKSALKLIREYGGLKGVVK
FEN1_CRYNJ       SEIHLDVALRDLEMSMDQ--FIELCILLGCDYLEP-CKGIGPKTALKLMREHGTLGKVVE
FEN1_USTMA       HQVDLAKALEGLQMTMAQ--FIDLCILLGCDYLDP-IKGIGPKTALKLIREHKTLENVVH
FEN1_SCHJY       SEYSFEKTIEGLNFTIEQ--FVDLCILLGCDYCDP-IRGVGPARAVELIRQHGNLDNFVK
FEN1_SCHPO       SEYNIEKALNGLDMSVEQ--FVDLCILLGCDYCEP-IRGVGPARAVELIRQYGTLDRFVK
FEN1_ASHGO       HEIDTELVLQGLGLSQEQ--LVDLGIMLGCDYCES-IKGVGPVTALKLIKEHGSLENIVE
FEN1_KLULA       QEFDTDVIYNTLDLTQTQ--FIDLGIILGCDYCEG-IKGVGPVNALKLIKEHGSLEAIVE
FEN1_YEAST       HEIDTELVLRGLDLTIEQ--FVDLCIMLGCDYCES-IRGVGPVTALKLIKTHGSIEKIVE
FEN1_YEAS7       HEIDTELVLRGLDLTIEQ--FVDLCIMLGCDYCES-IRGVGPVTALKLIKTHGSIEKIVE
FEN1_YEAS2       HEIDTELVLRGLDLTIEQ--FVDLCIMLGCDYCES-IRGVGPVTALKLIKTHGSIEKIVE
FEN1_YEAS8       HEIDTELVLRGLDLTIEQ--FVDLCIMLGCDYCES-IRGVGPVTALKLIKTHGSIEKIVE
FEN1_YEAS1       HEIDTELVLRGLDLTIEQ--FVDLCIMLGCDYCES-IRGVGPVTALKLIKTHGSIEKIVE
FEN1_VANPO       HEIDTELVLKGLDLTLEQ--FVDLGIMLGCDYCDS-IKGVGPVTALKLIKEYGSLEKIIE
FEN1_CANGA       HEINTEIVLQGLELTIDQ--FIDLGIMLGCDYCDS-IKGVGPVTALKLMKEHGSLEKIVE
FEN1_ZYGRC       HEIDTELVLQGLELTQEQ--FVDLGIMLGCDYCES-IRGIGPVTALKLIKEHGSLEKIVE
FEN1_LACTC       HEINTEILLQGLELSIEQ--FIDLGIMLGCDYCDS-IRGVGPVTALKLIKEHKTLENIVE
FEN1_CANAW       DQIEYKDAIAGLDMTKEQ--FIDLCILLGCDYCES-IKGIGQATAFKLIKEHGSLDNIVE
FEN1_CANAL       DQIEYKDAIAGLDMTKEQ--FIDLCILLGCDYCES-IKGIGQATAFKLIKEHGSLDNIVE
FEN1_CANDC       DQIEYKDAIAGLDMTKEQ--FIDLCILLGCDYCES-IKGIGQATAFKLIKEHGSLDNIVE
FEN1_CANTT       DEISYKEAMAGLDMNKEQ--FVDLCILLGCDYCET-IRGVGPVTAYKLIKEHGSLEKIVE
FEN1_LODEL       DQITYKEAIQGLDMTKEQ--FIDLCILLGCDYCET-IKGVGPVTAYKLIKEHGSLDNIVK
FEN1_PICST       NQITYSEAIAGLEMTKPQ--FIDMCILLGCDYCET-IKGVGPVTAYKLIKEHGSLEKIIE
FEN1_CLAL4       DQIDYEAMLKGLDMDRST--FVDLCILLGCDYCET-IKGVGPVTAFKLIKEHGSLDNIVK
FEN1_PICGU       DQIDYKKAMEGLEMDKQT--FIDLCILLGCDYCET-IKGVGPVTAFKLIKEHGSLDNIVK
FEN1_DEBHA       DQIQYEKVLEALEMDRET--FIDLCILLGCDYCET-IRGVGPVTAFKLIKEHGSLDKIVE
FEN1_KOMPG       TEIDYAKVMEGLEMELPQ--FIDLCILLGCDYCET-IKGVGPVTAFKLIKEHGSIEKVVE
FEN1_YARLI       SEINFAKILEGLEMTHAQ--FIDLCILLGCDYADT-IRGVGPQTALKLMKEHGSLEKIVE
FEN1_DICDI       LEFELQSVLEGLGLTQDE--FIDLSILLGCDYCDS-IKGIGPKRAIELIQKHKSLEEVIK
FEN1_POLPP       MEIELEKVLDGLDLTHDQ--FVDLCILLGCDYCDT-IKGIGPKKSFDMITKHKNIQTVIQ
FEN11_PARTE      YEIIYDDMMKELEITYEQ--FVDLCILCGCDYTEK-IEGIGPGTAYKLIKEFKSIEGILE
FEN12_PARTE      YEIIYDDMIKELELTYEQ--FVDLCILCGCDYTEK-IEGIGPGTAYKLIKEYKSIEGILE
FEN1_TETTS       TEINYEKMLQELKLSHNE--FVDLCILCGCDYLGR-IEGVGPVNAFKLITEHKSLEKVLE
FEN1_PHATC       QTMNYNKVIEGLAISHDQ--FVDLCIMLGCDYCDT-IRGVGPKTALKLIREHGNIEKVIE
FEN1_THAPS       QQIFYDKAIEGLEITHDQ--FVDLCILLGCDYCDT-IKGIGPKTALKLIREHKNIETILK
FEN1_PHYIT       LEIRLERALQELEMTHEQ--FVDLCILCGCDYCDS-IRGVGPKKAYAGIKEHKSIENFLE
FEN1_ENTDS       REYSLSSILEETGFSMEQ--FIDLCILLGCDYCDT-IKGVGPITAFELIQQYKSIENVLK
FEN1_ENTHI       REYSLSSILEETGFTMEQ--FIDLCILLGCDYCET-IKGVGPITAFELIQQYKSIENILQ
FEN1_ENCCU       MEHNLPQILEDLSLDHSE--FIDLCILLGCDYCST-LKGIGPKKALGLIKKHRSIGNILK
FEN1_ENTBH       EEYNLHKILEGLQFTMEQ--FVDLCILLGCDYSAT-IRGVGMKRAFEYIKKYKSIDNLIG
FEN1_PLABA       TEINLEQVLKGLKLTMDE--FIDFCILCGCDYCDT-IKGIGSKTAYNLIKEYNCIENIIK
FEN1_PLAYO       TEINLEQVLKGLKLTMDE--FIDFCILCGCDYCDT-IKGIGSKTAYNLIKEYNCIENIIK
FEN1_PLACH       TEINLEQVLKGLKLTMDE--FIDFCILCGCDYCDT-IKGIGSKTAYNLIKEYNCIENIIK
FEN1_PLAKH       TEINLEQVLKGLNLNMNE--FIDFCILCGCDYCDT-IKGIGSKTAYNLIKEYNSIEKIIE
FEN1_PLAVS       TEINLEQVLKGLNLSMNE--FIDFCILCGCDYCDT-IKGIGSKTAYNLIKEYNSIEKIIE
FEN1_PLAFA       TEINLEQVLKGLNLTMDE--FIDFCILCGCDYCDT-IKGIGSKTAYNLIKEYNCIEKIIE
FEN1_PLAF7       TEINLEQVLKGLNLTMDE--FIDFCILCGCDYCDT-IKGIGSKTAYNLIKEYNCIEKIIE
FEN1_CRYMR       QVIKLSTVLSDLGLSMQQ--FVDLCILCGCDYCGT-IRGIGALTAYKLLKKHKDIETIIN
FEN1_CRYPI       QIIKLSLILSELDINMDQ--FIDLCILSGCDYCGT-IRGIGTSTAYKLLKKYHNIESILK
FEN1_GIAIC       VEINLNTVLKELGFSYDE--FLDLCILCGCDYANS-LEGIGPKTAYKLIVKHRSIEEVLA
FEN1_THEAN       VKVDLQKVLDGLEFNFDQ--FVDFCILCGCDYCDT-LEGVGPKTAYSLVKKYQSLEEIVR
FEN1_THEPA       LKVDLQKVLDGLEFNFDQ--FIDFCILCGCDYCDT-LEGVGPKTAYSLVKKYQNLEEIVN
FEN1_BABBO       VRVDLAKALELLELTHEQ--FTDFCILCGCDYCGT-LKGVGPKTAYNLIKKHGSISRILE
FEN_HALMA        -LMDFAATLEHHDLTWEQ--LVDAAILMGTDFNEG-ISGIGPKTAVKDLHEHGDLYTVLA
FEN_NATPD        -CMDFEATLSTHDLSWEG--LVDAAILMGTDFNEG-LSGVGPKTAVKLIHEHGDLRSVLA
FEN_HALWD        -LMDLQTTLKNQNLTREQ--LVDVAILCGTDFNDG-ISGIGPATAISAINDHGDLWSVLD
FEN_HALSA        -LMDFDATLAEHDLTWEQ--LVDVGILCGTDFNPG-IDGFGPTTALDAIGEHGDLWDVLA
FEN_HALS3        -LMDFDATLAEHDLTWEQ--LVDVGILCGTDFNPG-IDGFGPTTALDAIGEHGDLWDVLA
                                     :    :  * *:        *   .               

FEN_HYPBU        GLPRHEFPTDPL------------------------------------------------
FEN_STAMF        IIPKTEFPIEPE------------------------------------------------
FEN_AERPE        SVPRGEYDPDYLR-----------------------------------------------
FEN_THEPD        SVEWS-SDVPPE------------------------------------------------
FEN_IGNH4        ALGVD--DKELYL-----------------------------------------------
FEN_PYRAB        KFQRQ-SDVDLY------------------------------------------------
FEN_PYRHO        KFQRQ-SDVDLY------------------------------------------------
FEN_PYRFU        KFQKQ-SDVDLY------------------------------------------------
FEN_THEKO        KYQKE-SDVDLY------------------------------------------------
FEN_THEON        KYQKE-SEVDLY------------------------------------------------
FEN_THEGJ        KYQKD-SDVDLY------------------------------------------------
FEN_THESM        KYQKT-SEVDLY------------------------------------------------
FEN_KORCO        KVPWE-FDVDPI------------------------------------------------
FEN_METAC        VLREKDMEIEGLD-----------------------------------------------
FEN_METBF        VLREKGVEIKELD-----------------------------------------------
FEN_METMA        VIREKGMEIEALD-----------------------------------------------
FEN_METBU        VLKELGKDIEDLD-----------------------------------------------
FEN_METAR        ILDELGQTIENWE-----------------------------------------------
FEN_METTP        VLDALGESIENFR-----------------------------------------------
FEN_ARCFU        ALKALKVNIDHVE-----------------------------------------------
FEN_SACS2        YGEISKKDINFNID----------------------------------------------
FEN_SULTO        KGEIPKIKVNFNVE----------------------------------------------
FEN_SULAC        KGEIQLSKINFDIR----------------------------------------------
FEN_NANEQ        YYKIP------NGK----------------------------------------------
FEN_PYRAE        TVL---KGAYFPIDP---------------------------------------------
FEN_PYRAR        TVL---RGVTFPIDP---------------------------------------------
FEN_PYRIL        TVL---RGVYFPVDP---------------------------------------------
FEN_PYRNV        TVL---RGVSFPVDP---------------------------------------------
FEN_PYRCJ        TVL---KGVQFPVDP---------------------------------------------
FEN_CALMQ        TVL---KNAQFPVDP---------------------------------------------
FEN_METKA        TDIWPKIERHLPVEP---------------------------------------------
FEN_CENSY        IQDEL-GSVSYA------------------------------------------------
FEN_NITMS        IQEQL-EEIDYQ------------------------------------------------
FEN_METTH        DLEADIG-----GDP---------------------------------------------
FEN_METS3        KLQEESS-----HDI---------------------------------------------
FEN_METST        SLNETME-----VDA---------------------------------------------
FEN_METMJ        EKQPD-------FNP---------------------------------------------
FEN_METB6        EKCPG-------FDP---------------------------------------------
FEN_METPE        EKLPD-------FDP---------------------------------------------
FEN_METHJ        EKLPD-------FDP---------------------------------------------
FEN_METLZ        ESENA-------AEP---------------------------------------------
FEN_THEAC        HIGKNI------ENL---------------------------------------------
FEN_THEVO        KIGKNI------ENL---------------------------------------------
FEN_PICTO        IKNIGI------DNL---------------------------------------------
FEN_METJA        KEVEYY------------------------------------------------------
FEN_META3        -DIENY------------------------------------------------------
FEN1_LEIIN       SLDTTK------------------------------------------------------
FEN1_LEIMA       SLDTTK------------------------------------------------------
FEN1_LEIBR       SLDAAK------------------------------------------------------
FEN1_TRYB2       SLDGTR------------------------------------------------------
FEN1_TRYB9       SLDGTR------------------------------------------------------
FEN1_TRYCC       SLDAGR------------------------------------------------------
FEN1_ARATH       NLNKER------------------------------------------------------
FEN1_SOYBN       NLNKER------------------------------------------------------
FEN11_ORYSI      NINKDR------------------------------------------------------
FEN11_ORYSJ      NINKDR------------------------------------------------------
FEN11_SORBI      NLNKDR------------------------------------------------------
FEN1_MAIZE       NLNKDR------------------------------------------------------
FEN11_PHYPA      NLNKDR------------------------------------------------------
FEN1_OSTLU       EIDTEK------------------------------------------------------
FEN1_OSTTA       AIDTEK------------------------------------------------------
FEN1_MICCC       HLDKEK------------------------------------------------------
FEN1_CHLRE       ELDPAK------------------------------------------------------
FEN1_NAEGR       NIEGKH------------------------------------------------------
FEN1_BOVIN       RLDPNK------------------------------------------------------
FEN1_SHEEP       RLDPNK------------------------------------------------------
FEN1_HUMAN       RLDPNK------------------------------------------------------
FEN1_MACFA       RLDPSK------------------------------------------------------
FEN1_MOUSE       RLDPSK------------------------------------------------------
FEN1_RAT         RLDPSK------------------------------------------------------
FEN1_CHICK       HIDTKK------------------------------------------------------
FEN1A_XENLA      NIDLKK------------------------------------------------------
FEN1B_XENLA      NIDLKK------------------------------------------------------
FEN1_XENTR       NIDLKK------------------------------------------------------
FEN1_ANOFI       NIDSSK------------------------------------------------------
FEN1_XIPMA       NIDTSK------------------------------------------------------
FEN1_SALSA       NIDSSK------------------------------------------------------
FEN1_OSMMO       NIDLSK------------------------------------------------------
FEN1A_DANRE      NIDPNK------------------------------------------------------
FEN1_BRAFL       HIDTKK------------------------------------------------------
FEN1_NEMVE       NIDTSK------------------------------------------------------
FEN1_TRIAD       NISSEK------------------------------------------------------
FEN1_AEDAE       NLDTKK------------------------------------------------------
FEN1_ANOGA       HLDRQK------------------------------------------------------
FEN1_GLOMM       KIDRKK------------------------------------------------------
FEN1_DROER       NLDSSK------------------------------------------------------
FEN1_DROYA       NLDSSK------------------------------------------------------
FEN1_DROSE       NLDSSK------------------------------------------------------
FEN1_DROSI       NLDSSK------------------------------------------------------
FEN1_DROME       NLDSSK------------------------------------------------------
FEN1_DROPE       NLDTSK------------------------------------------------------
FEN1_DROPS       NLDTSK------------------------------------------------------
FEN1_DROAN       NLDTSK------------------------------------------------------
FEN1_DROWI       NLDTSK------------------------------------------------------
FEN1_DROGR       NIDTNK------------------------------------------------------
FEN1_DROMO       NIDTSK------------------------------------------------------
FEN1_DROVI       NIDTSK------------------------------------------------------
FEN1_MONBE       HLDPKK------------------------------------------------------
FEN1_CAEBR       NIDQTK------------------------------------------------------
FEN1_CAEEL       NIDQNK------------------------------------------------------
FEN1_BRUMA       TINQTK------------------------------------------------------
FEN1_AJECH       AIKSDP------------------------------------------------------
FEN1_AJECN       AIKSDP------------------------------------------------------
FEN1_AJEDR       AIQSDP------------------------------------------------------
FEN1_UNCRE       AMKNDP------------------------------------------------------
FEN1_ASPFU       AIENDP------------------------------------------------------
FEN1_ASPFC       AIENDP------------------------------------------------------
FEN1_NEOFI       AIENDP------------------------------------------------------
FEN1_ASPCL       AIESDP------------------------------------------------------
FEN1_ASPFN       HMESDP------------------------------------------------------
FEN1_ASPTN       YIQNDP------------------------------------------------------
FEN1_EMENI       SIEKDP------------------------------------------------------
FEN1_ASPNC       FMENDP------------------------------------------------------
FEN1_PENRW       FMKNDP------------------------------------------------------
FEN1_TALMQ       AIENDP------------------------------------------------------
FEN1_TALSN       AIESDP------------------------------------------------------
FEN1_ARTOC       TIESDP------------------------------------------------------
FEN1_PHANO       HIQSDQ------------------------------------------------------
FEN1_PYRTR       HIKSQS------------------------------------------------------
FEN1_NEUCR       WMKADP------------------------------------------------------
FEN1_SORMK       WMKADP------------------------------------------------------
FEN1_FUSV7       AMEKDP------------------------------------------------------
FEN1_MAGO7       KMKKG-------------------------------------------------------
FEN1_COPCI       HLREKAAARKAEAE------EEDEEEAEEPAPTSDVEMPDDEDGEKDSDDEEEAERRKKA
FEN1_COPC7       HLREKAAARKAEAE------EEDEEEAEEPAPTSDVEMPDDEDGEKDSDDEEEAERRKKA
FEN11_LACBS      HLRENS------------------------------------------------------
FEN12_LACBS      HLREKAATQKAAQAAVESDEESEHEEEDEPAPTSDVEMPDPV--EEDQDGEEEAEPKSSQ
FEN1_CRYNJ       HIRGKMAEKAEEIK----------AAADEEAEAEAEAEKYDSDPESEEGGETMINSDGEE
FEN1_USTMA       HLKEDG------------------------------------------------------
FEN1_SCHJY       DADKKK------------------------------------------------------
FEN1_SCHPO       EADRSK------------------------------------------------------
FEN1_ASHGO       FISSG--G----------------------------------------------------
FEN1_KLULA       KFENGDIS----------------------------------------------------
FEN1_YEAST       FIESGESN----------------------------------------------------
FEN1_YEAS7       FIESGESN----------------------------------------------------
FEN1_YEAS2       FIESGESN----------------------------------------------------
FEN1_YEAS8       FIESGESN----------------------------------------------------
FEN1_YEAS1       FIESGESN----------------------------------------------------
FEN1_VANPO       YIES-DSS----------------------------------------------------
FEN1_CANGA       YIESGEAN----------------------------------------------------
FEN1_ZYGRC       FIESGQAN----------------------------------------------------
FEN1_LACTC       YIESGQAN----------------------------------------------------
FEN1_CANAW       WIKNNK------------------------------------------------------
FEN1_CANAL       WIKNNK------------------------------------------------------
FEN1_CANDC       WIKNNK------------------------------------------------------
FEN1_CANTT       WIEKGN------------------------------------------------------
FEN1_LODEL       YLQENPD-----------------------------------------------------
FEN1_PICST       HINSNP------------------------------------------------------
FEN1_CLAL4       WIQENPE-----------------------------------------------------
FEN1_PICGU       WIEENPD-----------------------------------------------------
FEN1_DEBHA       YLTNNPD-----------------------------------------------------
FEN1_KOMPG       AIENNP------------------------------------------------------
FEN1_YARLI       HIEKNP------------------------------------------------------
FEN1_DICDI       HLDKSK------------------------------------------------------
FEN1_POLPP       NIDRTK------------------------------------------------------
FEN11_PARTE      HVQKVNAEREKNKQ----------------------------------------------
FEN12_PARTE      HVQKVNAEREKNNQ----------------------------------------------
FEN1_TETTS       HMEEVNKQSTKKQ-----------------------------------------------
FEN1_PHATC       TIDRKK------------------------------------------------------
FEN1_THAPS       HLNREK------------------------------------------------------
FEN1_PHYIT       VLQKNKSKG---------------------------------------------------
FEN1_ENTDS       HLSDK-------------------------------------------------------
FEN1_ENTHI       HLSDK-------------------------------------------------------
FEN1_ENCCU       NED---------------------------------------------------------
FEN1_ENTBH       I-----------------------------------------------------------
FEN1_PLABA       NIDQNK------------------------------------------------------
FEN1_PLAYO       NIDQNK------------------------------------------------------
FEN1_PLACH       NIDQNK------------------------------------------------------
FEN1_PLAKH       NIDKNK------------------------------------------------------
FEN1_PLAVS       NIDKNK------------------------------------------------------
FEN1_PLAFA       NIDQNK------------------------------------------------------
FEN1_PLAF7       NIDQNK------------------------------------------------------
FEN1_CRYMR       ELDKNK------------------------------------------------------
FEN1_CRYPI       NIDQTK------------------------------------------------------
FEN1_GIAIC       ADQGKL------------------------------------------------------
FEN1_THEAN       FKGGDYD-----------------------------------------------------
FEN1_THEPA       FKGGDYD-----------------------------------------------------
FEN1_BABBO       VRSETLE-----------------------------------------------------
FEN_HALMA        ARGEHID-----------------------------------------------------
FEN_NATPD        ARDDDIP-----------------------------------------------------
FEN_HALWD        ARDEFIQ-----------------------------------------------------
FEN_HALSA        AEGEHVA-----------------------------------------------------
FEN_HALS3        AEGEHVA-----------------------------------------------------
                                                                             

FEN_HYPBU        ------------------------------------------------------------
FEN_STAMF        ------------------------------------------------------------
FEN_AERPE        ------------------------------------------------------------
FEN_THEPD        ------------------------------------------------------------
FEN_IGNH4        ------------------------------------------------------------
FEN_PYRAB        ------------------------------------------------------------
FEN_PYRHO        ------------------------------------------------------------
FEN_PYRFU        ------------------------------------------------------------
FEN_THEKO        ------------------------------------------------------------
FEN_THEON        ------------------------------------------------------------
FEN_THEGJ        ------------------------------------------------------------
FEN_THESM        ------------------------------------------------------------
FEN_KORCO        ------------------------------------------------------------
FEN_METAC        ------------------------------------------------------------
FEN_METBF        ------------------------------------------------------------
FEN_METMA        ------------------------------------------------------------
FEN_METBU        ------------------------------------------------------------
FEN_METAR        ------------------------------------------------------------
FEN_METTP        ------------------------------------------------------------
FEN_ARCFU        ------------------------------------------------------------
FEN_SACS2        ------------------------------------------------------------
FEN_SULTO        ------------------------------------------------------------
FEN_SULAC        ------------------------------------------------------------
FEN_NANEQ        ------------------------------------------------------------
FEN_PYRAE        ------------------------------------------------------------
FEN_PYRAR        ------------------------------------------------------------
FEN_PYRIL        ------------------------------------------------------------
FEN_PYRNV        ------------------------------------------------------------
FEN_PYRCJ        ------------------------------------------------------------
FEN_CALMQ        ------------------------------------------------------------
FEN_METKA        ------------------------------------------------------------
FEN_CENSY        ------------------------------------------------------------
FEN_NITMS        ------------------------------------------------------------
FEN_METTH        ------------------------------------------------------------
FEN_METS3        ------------------------------------------------------------
FEN_METST        ------------------------------------------------------------
FEN_METMJ        ------------------------------------------------------------
FEN_METB6        ------------------------------------------------------------
FEN_METPE        ------------------------------------------------------------
FEN_METHJ        ------------------------------------------------------------
FEN_METLZ        ------------------------------------------------------------
FEN_THEAC        ------------------------------------------------------------
FEN_THEVO        ------------------------------------------------------------
FEN_PICTO        ------------------------------------------------------------
FEN_METJA        ------------------------------------------------------------
FEN_META3        ------------------------------------------------------------
FEN1_LEIIN       -------------------------HPVPADF----------------------------
FEN1_LEIMA       -------------------------HPVPADF----------------------------
FEN1_LEIBR       -------------------------HMVPPDF----------------------------
FEN1_TRYB2       -------------------------YVVPEEF----------------------------
FEN1_TRYB9       -------------------------YVVPEEF----------------------------
FEN1_TRYCC       -------------------------HSVPEGF----------------------------
FEN1_ARATH       -------------------------YQIPEEW----------------------------
FEN1_SOYBN       -------------------------YQIPDNW----------------------------
FEN11_ORYSI      -------------------------YQIPEDW----------------------------
FEN11_ORYSJ      -------------------------YQIPEDW----------------------------
FEN11_SORBI      -------------------------YQIPEDW----------------------------
FEN1_MAIZE       -------------------------YQIPEDW----------------------------
FEN11_PHYPA      -------------------------YQVPDPW----------------------------
FEN1_OSTLU       -------------------------YPPPQDW----------------------------
FEN1_OSTTA       -------------------------YPPPKDW----------------------------
FEN1_MICCC       -------------------------YPVPDDW----------------------------
FEN1_CHLRE       -------------------------YPVPEPF----------------------------
FEN1_NAEGR       -------------------------YQAPSEF----------------------------
FEN1_BOVIN       -------------------------YPVPENW----------------------------
FEN1_SHEEP       -------------------------YPVPENW----------------------------
FEN1_HUMAN       -------------------------YPVPENW----------------------------
FEN1_MACFA       -------------------------YPVPENW----------------------------
FEN1_MOUSE       -------------------------YPVPENW----------------------------
FEN1_RAT         -------------------------YPVPENW----------------------------
FEN1_CHICK       -------------------------YPLPENW----------------------------
FEN1A_XENLA      -------------------------YPVPENW----------------------------
FEN1B_XENLA      -------------------------YPIPENW----------------------------
FEN1_XENTR       -------------------------YPIPENW----------------------------
FEN1_ANOFI       -------------------------HPAPEDW----------------------------
FEN1_XIPMA       -------------------------HPAPEDW----------------------------
FEN1_SALSA       -------------------------HPAPEDW----------------------------
FEN1_OSMMO       -------------------------HPVPEDW----------------------------
FEN1A_DANRE      -------------------------HPAPEDW----------------------------
FEN1_BRAFL       -------------------------FPVPEDW----------------------------
FEN1_NEMVE       -------------------------HPPPENW----------------------------
FEN1_TRIAD       -------------------------FTVPENW----------------------------
FEN1_AEDAE       -------------------------YVVPENW----------------------------
FEN1_ANOGA       -------------------------YIVPEGW----------------------------
FEN1_GLOMM       -------------------------YTVPEDW----------------------------
FEN1_DROER       -------------------------YTVPENW----------------------------
FEN1_DROYA       -------------------------YTVPENW----------------------------
FEN1_DROSE       -------------------------YTVPENW----------------------------
FEN1_DROSI       -------------------------YTVPENW----------------------------
FEN1_DROME       -------------------------YTVPENW----------------------------
FEN1_DROPE       -------------------------YTVPENW----------------------------
FEN1_DROPS       -------------------------YTVPENW----------------------------
FEN1_DROAN       -------------------------YTVPENW----------------------------
FEN1_DROWI       -------------------------YTVPENW----------------------------
FEN1_DROGR       -------------------------YAVPENW----------------------------
FEN1_DROMO       -------------------------YIVPENW----------------------------
FEN1_DROVI       -------------------------YPVPENW----------------------------
FEN1_MONBE       -------------------------YVIPEDW----------------------------
FEN1_CAEBR       -------------------------YPPPADW----------------------------
FEN1_CAEEL       -------------------------YPPPEDW----------------------------
FEN1_BRUMA       -------------------------YPIPQDW----------------------------
FEN1_AJECH       ----------------------KKKYTIPEDW----------------------------
FEN1_AJECN       ----------------------KKKYTIPEDW----------------------------
FEN1_AJEDR       ----------------------KKKYTIPEDW----------------------------
FEN1_UNCRE       ----------------------KQKYTIPDDW----------------------------
FEN1_ASPFU       ----------------------KKKYVIPEYW----------------------------
FEN1_ASPFC       ----------------------KKKYVIPEYW----------------------------
FEN1_NEOFI       ----------------------KKKYVIPEDW----------------------------
FEN1_ASPCL       ----------------------KKKYVIPEDW----------------------------
FEN1_ASPFN       ----------------------KKKYVIPEDW----------------------------
FEN1_ASPTN       ----------------------KKKYVIPEDW----------------------------
FEN1_EMENI       ----------------------KQKYVIPESW----------------------------
FEN1_ASPNC       ----------------------KKKFVVPEDW----------------------------
FEN1_PENRW       ----------------------KKKFVVPEDW----------------------------
FEN1_TALMQ       ----------------------KKKYVIPDDW----------------------------
FEN1_TALSN       ----------------------KKKYVIPDDW----------------------------
FEN1_ARTOC       ----------------------KKKYVIPDDW----------------------------
FEN1_PHANO       -----------------------KKLTLPEDW----------------------------
FEN1_PYRTR       ----------------------SKKLTIPDDW----------------------------
FEN1_NEUCR       ----------------------KGRYQIPEDW----------------------------
FEN1_SORMK       ----------------------KGRYQIPEDW----------------------------
FEN1_FUSV7       ----------------------KKKYVLPEDW----------------------------
FEN1_MAGO7       ----------------------ELKYTVPEDW----------------------------
FEN1_COPCI       EAAKKKKAQEKAKSAKKGKGKGKGGIQIPDEW----------------------------
FEN1_COPC7       EAAKKKKAQEKAKSAKKGKGKGKGGIQIPDEW----------------------------
FEN11_LACBS      ---------------------GCRGMQIPDEW----------------------------
FEN12_LACBS      ATPKKKKASSKTKEKRKGK--GGGGMQIPEEW----------------------------
FEN1_CRYNJ       VPAPSKLKSPKKKAPAKKKKVASSGMQIPEFW----------------------------
FEN1_USTMA       ----------------------KKSVQIPDHW----------------------------
FEN1_SCHJY       -------------------------FPIPEDW----------------------------
FEN1_SCHPO       -------------------------YPIPEDW----------------------------
FEN1_ASHGO       ----------------------NAKWKVPENW----------------------------
FEN1_KLULA       ----------------------SGRWKIPEGW----------------------------
FEN1_YEAST       ----------------------NTKWKIPEDW----------------------------
FEN1_YEAS7       ----------------------NTKWKIPEDW----------------------------
FEN1_YEAS2       ----------------------NTKWKIPEDW----------------------------
FEN1_YEAS8       ----------------------NTKWKIPEDW----------------------------
FEN1_YEAS1       ----------------------NTKWKIPEDW----------------------------
FEN1_VANPO       ----------------------NSKWKIPNDW----------------------------
FEN1_CANGA       ----------------------N-KWKVPENW----------------------------
FEN1_ZYGRC       ----------------------N-KWKVPEDW----------------------------
FEN1_LACTC       ----------------------N-KWKVPENW----------------------------
FEN1_CANAW       -----------------------TKYTLPENW----------------------------
FEN1_CANAL       -----------------------TKYTLPENW----------------------------
FEN1_CANDC       -----------------------TKYTLPENW----------------------------
FEN1_CANTT       -----------------------TKYTVPENW----------------------------
FEN1_LODEL       ----------------------KTKYKVPENW----------------------------
FEN1_PICST       ----------------------TSKYKVPENW----------------------------
FEN1_CLAL4       ----------------------KTKYKVPENW----------------------------
FEN1_PICGU       ----------------------STKFKVPENW----------------------------
FEN1_DEBHA       ----------------------KTNFKVPEDW----------------------------
FEN1_KOMPG       ----------------------KSKQKIPENW----------------------------
FEN1_YARLI       ----------------------SGKLKVPENW----------------------------
FEN1_DICDI       -------------------------YPLPEFF----------------------------
FEN1_POLPP       -------------------------NPIPESF----------------------------
FEN11_PARTE      ----------------------NPKYTVPTKF----------------------------
FEN12_PARTE      ----------------------NPKYTVPSKF----------------------------
FEN1_TETTS       ------------------------KYTVPSSY----------------------------
FEN1_PHATC       -------------------------FVVPESWVPNEKKLDAQSDDDDEEGVESPSKEENN
FEN1_THAPS       -------------------------YVVPD------------------------------
FEN1_PHYIT       -------------------------VVIPDEWLGEN------------------------
FEN1_ENTDS       -------------------------YKVPENW----------------------------
FEN1_ENTHI       -------------------------YKVPENW----------------------------
FEN1_ENCCU       -------------------------LEVPGDW----------------------------
FEN1_ENTBH       -------------------------VDFPDDF----------------------------
FEN1_PLABA       -------------------------YQVPANF----------------------------
FEN1_PLAYO       -------------------------YQVPANF----------------------------
FEN1_PLACH       -------------------------YQVPDNF----------------------------
FEN1_PLAKH       -------------------------YQIPSNF----------------------------
FEN1_PLAVS       -------------------------YQVPSNF----------------------------
FEN1_PLAFA       -------------------------YQVPSNF----------------------------
FEN1_PLAF7       -------------------------YQVPSNF----------------------------
FEN1_CRYMR       -------------------------HPLPMSF----------------------------
FEN1_CRYPI       -------------------------NPIPGNF----------------------------
FEN1_GIAIC       -------------------------AEKALNW----------------------------
FEN1_THEAN       ------------------------------------------------------------
FEN1_THEPA       ------------------------------------------------------------
FEN1_BABBO       ------------------------------------------------------------
FEN_HALMA        ------------------------------------------------------------
FEN_NATPD        ------------------------------------------------------------
FEN_HALWD        ------------------------------------------------------------
FEN_HALSA        ------------------------------------------------------------
FEN_HALS3        ------------------------------------------------------------
                                                                             

FEN_HYPBU        -------------KIYEYFLNPP-----------------VTT-DYKLEWREPDEKKVFE
FEN_STAMF        -------------KIVEYFLNPP-----------------VST-DYKLEWRAPDESKIRE
FEN_AERPE        -------------KVYEYFLNPP-----------------VTD-DYKIEFRKPDQDKVRE
FEN_THEPD        -------------KILELFLHPE-----------------VTD-SYELTWKEPDKEKVIE
FEN_IGNH4        -------------EAYNFFLNPQ-----------------VTD-DYELVWRRPDPQKIIE
FEN_PYRAB        -------------AIKEFFLNPP-----------------TTD-DYSLKWKEPDEEGIIR
FEN_PYRHO        -------------AIKEFFLNPP-----------------VTN-EYSLSWKEPDEEGILK
FEN_PYRFU        -------------AIKEFFLNPP-----------------VTD-NYNLVWRDPDEEGILK
FEN_THEKO        -------------AIKEFFLNPP-----------------VTD-DYELKWREPDEEGILK
FEN_THEON        -------------AIKEFFLNPP-----------------VTD-DYELKWREPDEEGIIK
FEN_THEGJ        -------------AIKEFFLNPP-----------------VTD-DYELKWREPDEEGILK
FEN_THESM        -------------AIKEFFLNPP-----------------TTN-DYKLEWKLPDEESIIK
FEN_KORCO        -------------SIYEFFLNPP-----------------TTD-DYDTSLKRPMSDELLK
FEN_METAC        -------------RIRKLFTHPE-----------------VTE-DYEIKWTKPDSEKLIK
FEN_METBF        -------------RIRELFTHPD-----------------VTD-DYEIKWGKPDSEKLIK
FEN_METMA        -------------SIKELFTHPD-----------------VTD-DYEIKWGKPDSEKLIN
FEN_METBU        -------------AKRDFFMNPP-----------------VTD-DYELKWIKPDRAGVID
FEN_METAR        -------------AIKEFFLHPT-----------------VTD-DYQVKWGKPEPAKIKE
FEN_METTP        -------------EIRELFLHPA-----------------VTE-SYELRMRKPMVDEIVG
FEN_ARCFU        -------------EIRNFFLNPP-----------------VTD-DYRIEFREPDFEKAIE
FEN_SACS2        -------------EIRGLFLNPQ-----------------VVKPEEALDLNEPNGEDIIN
FEN_SULTO        -------------EIRSLFLKPQ-----------------VVEPKENLELVDCDSNKILD
FEN_SULAC        -------------EIRKLFITPE-----------------VKKPTERLELAECNEREIIE
FEN_NANEQ        -------------EIFEFFLNPP-----------------VIDFEPKWGK--PNKELIFK
FEN_PYRAE        ------------LEIKKFFLNPP-----------------VTD-QYATEVRDPDEAALKD
FEN_PYRAR        ------------VEIKRFFLNPP-----------------VTD-TYTTDVTKPDDAKLRD
FEN_PYRIL        ------------LEIKKFFLNPP-----------------VTD-EYSTDIKKPDEQKLID
FEN_PYRNV        ------------LEIKRFFLNPP-----------------VTE-EYALELKNVDERGLVN
FEN_PYRCJ        ------------LKIREFFLNPP-----------------VTD-QYSTELSTPDERKIVE
FEN_CALMQ        ------------FKIREFFLNPP-----------------VTQ-EVNVKFKEPNEDEVVR
FEN_METKA        ------------EKLRRLFLEPE-----------------VTD-DYELDWDEPDEEGLVE
FEN_CENSY        -------------EIRKIFLEPE-----------------SPG-NIEIEFGATDYDGITK
FEN_NITMS        -------------EIRKIFLNPE-----------------VAD-VKEIVFENVNYEGMSN
FEN_METTH        ------------QVLRRIFLEPEV----------------SEDYEIRWRK--PDVEGVIE
FEN_METS3        ------------SEVREIFLNHNV----------------NTNYKIRWKK--PAKNDIID
FEN_METST        ------------ELIREIFLNPNV----------------VHNYTIEFKR--PKKSQLLD
FEN_METMJ        ------------APIRDFFLNPPV----------------TDDYTLEWRT--PDVEGVVE
FEN_METB6        ------------APVADFFLKPPV----------------TTEYELAWGH--PCVEGIKK
FEN_METPE        ------------SPILQFFRSPPV----------------IANLSLDWQP--PDQAGIED
FEN_METHJ        ------------EPVRSFFLNPPV----------------TDSYTLDPGR--IDRDGIRA
FEN_METLZ        ------------DQLIGYFMDPPV----------------ERSYNIESRS--PDPDRVID
FEN_THEAC        ------------DEIIDFFKNPP-----------------VVDYDFKFRK--PDTDAIEH
FEN_THEVO        ------------DEIIDFFKNPP-----------------VVDVKYVFGK--PDPKKIEE
FEN_PICTO        ------------DEIIEFFMNPP-----------------HNDYEIKFNE--PDFDGIID
FEN_METJA        ------------DEIKRIFKEPKV----------------TDNYSLSLKL--PDKEGIIK
FEN_META3        ------------EEIKNIFKNPKV----------------VDYTKEDIKLKSPNIEGLKE
FEN1_LEIIN       ----------YYKEARAFFQNPE--------------VTP--AEEINIQFSEPDEVGLIQ
FEN1_LEIMA       ----------YYKEARAFFQNPE--------------VTR--AEEIDIQFSEPDEVGLIQ
FEN1_LEIBR       ----------CYREARAFFLNPE--------------VTR--AEEIDIRFSEPDEAGLIQ
FEN1_TRYB2       ----------NYKDARNFFLEPE--------------VTP--GEEIDIQFREPDEEGLIK
FEN1_TRYB9       ----------NYKDARNFFLEPE--------------VTP--GEEIDIQFREPDEEGLIK
FEN1_TRYCC       ----------HYEEARQFFLKPE--------------VTP--AEEIEIQFREPDEEGLVK
FEN1_ARATH       ----------PYNEARKLFKEPD--------------VIT-DEEQLDIKWTSPDEEGIVQ
FEN1_SOYBN       ----------PYQEARRLFKEPL--------------VIT-DEKELDIKWSSPDEEGLIT
FEN11_ORYSI      ----------PYQEARRLFKEPN--------------VTL-DIP--ELKWNAPDEEGLVQ
FEN11_ORYSJ      ----------PYQEARRLFKEPN--------------VTL-DIP--ELKWNAPDEEGLVE
FEN11_SORBI      ----------PYQEARRLFKEPN--------------VTL-DVP--ELKWTPPDEEGLIS
FEN1_MAIZE       ----------PYQEARRLFKEPN--------------VTL-DIP--ELKWTAPDEEGLIS
FEN11_PHYPA      ----------PYQEARRLFKEPL--------------VTP-PEKVPEFKWTAPDTEGLRQ
FEN1_OSTLU       ----------DFAGARELFKNPE--------------VMD-TTGIA-LSWKAPNEEGLID
FEN1_OSTTA       ----------EFAGARELFKNPE--------------VMD-VSGIN-LSWKAPDEEGLVE
FEN1_MICCC       ----------PYKEARVLFKNPE--------------VVQ-TDGLT-LKWTAPDEEAVVA
FEN1_CHLRE       ----------PHKESHEFFKNPE--------------VTP-SAEIPPLKWTAPDEEGLVQ
FEN1_NAEGR       ----------PYEEVRNIFKNPD--------------VTPSSELVDTMKWTEPDEEGLIE
FEN1_BOVIN       ----------LHKEAQQLFLEPE--------------VLDPES--VELKWSEPNEEELIK
FEN1_SHEEP       ----------LHKEAQQLFLEPE--------------VLDPES--VELKWSEPNEEELVR
FEN1_HUMAN       ----------LHKEAHQLFLEPE--------------VLDPES--VELKWSEPNEEELIK
FEN1_MACFA       ----------LHKEAHQLFLKPE--------------VLDPES--VELKWSEPNEEELVK
FEN1_MOUSE       ----------LHKEAQQLFLEPE--------------VVDPES--VELKWSEPNEEELVK
FEN1_RAT         ----------LHKEARQLFLEPE--------------VLDPES--VELKWSEPNEEELVK
FEN1_CHICK       ----------LHKEAQKLFLEPD--------------VINPDD--VELKWTEPNEEELVQ
FEN1A_XENLA      ----------LHKEAKHLFLEPE--------------VVDTDI--TELKWIEPDEEGLVA
FEN1B_XENLA      ----------LHKEARQLFLEPE--------------VIDADI--TELKWTEPDEEGLVA
FEN1_XENTR       ----------LHKEARQLFLEPE--------------VVDTES--TELKWIEPDEEGLVA
FEN1_ANOFI       ----------LYKEARGLFLKAE--------------VVDCST--VDLKWSEPDEEGLIQ
FEN1_XIPMA       ----------LYKEARNLFLKPE--------------VVDSST--VDLKWREPDEEALIQ
FEN1_SALSA       ----------LYKEARGLFLQPD--------------VVDCST--VDLKWSEPDEDALIQ
FEN1_OSMMO       ----------LYKEARGLFLTPD--------------VVDCSC--LELKWSEPDEEGLVQ
FEN1A_DANRE      ----------LYKEARGLFLEPE--------------VVDGTS--VDLKWNEPDEDGLIQ
FEN1_BRAFL       ----------PYDQARKLFKEPE--------------VTPADQ--VELKWVDPDEEGLVQ
FEN1_NEMVE       ----------LYKEARELFKNPE--------------VRNPEE--IELKWEEPNEEALVT
FEN1_TRIAD       ----------PYKDARMLFLNPD--------------VEKCED--MELKWTEPDADELVK
FEN1_AEDAE       ----------NYQQARVLFKEPE--------------VANPEE--VELKWGEPDEEGLVK
FEN1_ANOGA       ----------NYEQARKLFKEPE--------------VQDADT--IELKWSEPDEEGLVK
FEN1_GLOMM       ----------NYQIARELFVNPE--------------VADPSS--LELKWFDPDEDGLVR
FEN1_DROER       ----------NYKVARELFIEPE--------------VANAES--IDLKWVEPDEEGLVK
FEN1_DROYA       ----------NYKVARELFIEPE--------------VANADN--IDLKWVEPDEEGLVK
FEN1_DROSE       ----------NYKVARELFIEPE--------------VANADS--IDLKWVEPDEEGLVK
FEN1_DROSI       ----------NYKVARELFIEPE--------------VANADS--IDLKWVEPDEEGLVK
FEN1_DROME       ----------NYKVARELFIEPE--------------VADADS--IDLKWVEPDEEGLVK
FEN1_DROPE       ----------NYKVARELFIEPE--------------VADASA--IDLKWTEPDEEGLVK
FEN1_DROPS       ----------NYKVARELFIEPE--------------VADASA--IDLKWTEPDEEGLVK
FEN1_DROAN       ----------NYKIARELFIEPE--------------VANADA--IELKWTEPDEEGLVK
FEN1_DROWI       ----------NYKVARELFIEPE--------------VADASA--IDLKWTEPDEEGLVK
FEN1_DROGR       ----------NYKRARELFIEPD--------------VTDAST--IDLKWTDPDEDGLVQ
FEN1_DROMO       ----------NYQRARELFVEPE--------------VTDAST--IDLKWTAPDEDGLVQ
FEN1_DROVI       ----------NYKRARELFIEPD--------------VADASA--IDLKWTEPDEDGLVQ
FEN1_MONBE       ----------HFAEARELFLRPD--------------VTPAAE--CEFKWTTPDIDGLVK
FEN1_CAEBR       ----------PYKRARELFHEPE--------------VMKCDE--VELTWKDPDVEGIVK
FEN1_CAEEL       ----------PYKRARELFLNPE--------------VTKPEE--VELTWKEADVEGVIQ
FEN1_BRUMA       ----------QYKEARRLFLEPD--------------VMNCEN--LELVWKEPDVEGIVQ
FEN1_AJECH       ----------PYKEARELFFDPD--------------VRNADHPDCDFKWEAPDVEGLVK
FEN1_AJECN       ----------PYKEARELFFDPD--------------VRKADHPDCDFKWEAPDVEGLVK
FEN1_AJEDR       ----------PYKDARELFFDPD--------------VRKADHPDCNFKWEAPDVEGLVK
FEN1_UNCRE       ----------PYEQARDLFFEPD--------------VRPADHPECDFKWEAPDVEGLVK
FEN1_ASPFU       ----------PYQDARELFLHPD--------------VREADHPECDFKWEAPDVEALVE
FEN1_ASPFC       ----------PYQDARELFLHPD--------------VREADHPECDFKWEAPDVEALVE
FEN1_NEOFI       ----------PYQDARELFLHPD--------------VREADHPECDFKWEAPDVEALVE
FEN1_ASPCL       ----------PYQDARELFHHPD--------------VRAADHPECDFKWEAPDIEALVD
FEN1_ASPFN       ----------PYQDARELFLNPD--------------VREASHPDCDFKWEAPDIEGLVE
FEN1_ASPTN       ----------PYQDARELFLHPD--------------VRDANDPECDFKWEAPDIEGLVE
FEN1_EMENI       ----------PYQDARELFLNPD--------------VRDANDPECDFKWEAPDIEGLVD
FEN1_ASPNC       ----------PYEDARELFLNPD--------------VRDANDPECDFKWEAPDVPGLVD
FEN1_PENRW       ----------PYEDARELFTNPD--------------VRPADHPECDFKWEAPNVEGLIE
FEN1_TALMQ       ----------PYQEARELFFNPD--------------VRKADDPQCDFKWESPDVEGLVK
FEN1_TALSN       ----------PYKEARELFFNPD--------------VRKADDPQCDFKWESPDVEGLIQ
FEN1_ARTOC       ----------PYLQARDLFFNPD--------------VRPADAPECDFKWTAPDVEGLVR
FEN1_PHANO       ----------PFADARQLFLEPD--------------VCPADAPECDFKWEAPDIEGLVK
FEN1_PYRTR       ----------PFADARLLFLEPD--------------VRPADDPECDFKWEAPDVEGLVK
FEN1_NEUCR       ----------PFEDARTLFFEPD--------------VRPADDPLCDFKWDKPDIEGLIQ
FEN1_SORMK       ----------PFEDARALFFEPD--------------VRPADDPLCDFKWEKPDIEGLVQ
FEN1_FUSV7       ----------PYKDARDLFFEPD--------------VRKADDPECDVKWEKPDMEGLVQ
FEN1_MAGO7       ----------PFEDARDLFFNPA--------------VHPADHPDCNFKWEKPDVEGLVK
FEN1_COPCI       ----------PWEEAKQIFLKPD--------------VIPADQ--VELEWKNPDVEGLVQ
FEN1_COPC7       ----------PWEEAKQIFLKPD--------------VIPADQ--VELEWKNPDVEGLVQ
FEN11_LACBS      ----------PWEEAKKIFEKPD--------------VLPADE--VELEWTNPDVDGLVQ
FEN12_LACBS      ----------PWEEAKKIFKRP-----------------SHVH--RDLEWTNPDVDGLVQ
FEN1_CRYNJ       ----------PWEEAKQLFMKPD--------------VVNGDD--LVLEWKQPDTEGLVE
FEN1_USTMA       ----------PFQEARKIFESPD--------------VQKGVD--LDLKWEAPDVEAMVK
FEN1_SCHJY       ----------PYQDARRLFLEAE--------------VQEAKD--IELKWRAPDEQGIIK
FEN1_SCHPO       ----------PYEDARRLFLDAE--------------VLPGEE--IELKWKSPDADGIIQ
FEN1_ASHGO       ----------PYKEARALFLQPD--------------VLDAEG--VSLKWEEPKEEELIA
FEN1_KLULA       ----------QFKEARDLFMQPD--------------VIPSEE--VTLKWEEPKAEELIE
FEN1_YEAST       ----------PYKQARMLFLDPE--------------VIDGNE--INLKWSPPKEKELIE
FEN1_YEAS7       ----------PYKQARMLFLDPE--------------VIDGNE--INLKWSPPKEKELIE
FEN1_YEAS2       ----------PYKQARMLFLDPE--------------VIDGNE--INLKWSPPKEKELIE
FEN1_YEAS8       ----------PYKQARMLFLDPE--------------VIDGNE--INLKWSPPKEKELIE
FEN1_YEAS1       ----------PYKQARMLFLDPE--------------VIDGNE--INLKWSPPKEKELIE
FEN1_VANPO       ----------PYKDARELFLKPD--------------VINGNE--VELKWQPPNEKGLID
FEN1_CANGA       ----------PYKEARELFVKPD--------------VIDANE--IDLKWTPPKEDELIQ
FEN1_ZYGRC       ----------PYNEARQLFLNPD--------------VVNSQD--INLKWNPPDEEKLIE
FEN1_LACTC       ----------PFKEARQLFLDPD--------------VVKGSE--VDLKWSEPQEQELVD
FEN1_CANAW       ----------PFDEARQLFMNPE--------------VTNASE--ISLKWKEPDVDGLIE
FEN1_CANAL       ----------PYDEARQLFMNPE--------------VTNASE--INLKWKEPDVDGLIE
FEN1_CANDC       ----------PYDEARQLFMNPE--------------VTNANE--ISLKWKEPDVDGLIE
FEN1_CANTT       ----------PYAEARELFLNPE--------------VKKASD--ISLKWKEPDVEGLIE
FEN1_LODEL       ----------PYNEARQLFMKPE--------------VLPALE--VELKWKEPDLDGLIE
FEN1_PICST       ----------PYDEARQLFMDPE--------------VTKGEE--VTLKWKEPDVEGLIQ
FEN1_CLAL4       ----------PYDEAKQLFMNPE--------------ITKGDE--VDVKWNEPNVDGLVE
FEN1_PICGU       ----------PYAEARELFLNPD--------------VSPGKE--INLKWQEPKVDELVE
FEN1_DEBHA       ----------PYDEARKLFINPD--------------TIDASE--VNLKWKEPDVEGLIQ
FEN1_KOMPG       ----------PYNEARELFLHPE--------------VIPASE--CELEWKEPDEEALVD
FEN1_YARLI       ----------PYQEVRALLQAPD--------------VLDSSS--CDIKWNNPDVEGLVD
FEN1_DICDI       ----------PYPEVRELFKNPN--------------VIPADQL-PPFQWKDPDVEGLNK
FEN1_POLPP       ----------PYEEVRELFKNPD--------------VIKCQDL-PEIVWKEPDVDGLIK
FEN11_PARTE      ----------LYQDSRELFITPL--------------VQKGEE--IQLTWNKPDVENLKK
FEN12_PARTE      ----------LYQDSRELFITPL--------------VQKGDE--LQLTWNKPDVDNLKK
FEN1_TETTS       ----------DYVSARDLFINPE--------------VTDPET--IQLEWKKPDVEELKK
FEN1_PHATC       GIVDTEELIPAYVQARKLFNEHE--------------VL--ND--IELKWKPCQAEDLQK
FEN1_THAPS       ----------IYVEARRLFNHHE--------------VLPDNE--IELKWTECQPEPLKS
FEN1_PHYIT       ---------PIYKNAREMFIKPE--------------VVDAKE--TEIKWRDPQETELVD
FEN1_ENTDS       ----------KYKEARELFLHP----------------DVADFSDYKLEWNKLDEEGIKQ
FEN1_ENTHI       ----------KYKEARELFLHP----------------DVADFSDYKLEWNKIDEEGIKK
FEN1_ENCCU       ----------RYSDAQKIFGSL---------------AEIGEIRDFNISWDSIDRNGIVN
FEN1_ENTBH       ----------KYKEARTIFFTLGTDTSNNFTNENPINTNIATWDLIAVDSASINIEAVID
FEN1_PLABA       ----------KYVEARQSFIKPK--------------VLEKSE--VKIDWCEPKIEELKK
FEN1_PLAYO       ----------KYVEARQSFINPK--------------VLEKSE--VKIDWCEPKIEELKT
FEN1_PLACH       ----------KYVEARQSFINPK--------------VLEKSE--VKIDWCEPKIEELKT
FEN1_PLAKH       ----------RFVEARDSFINPK--------------VLSKEE--IKIDWGEPKIEELKN
FEN1_PLAVS       ----------RFVEARDSFINPK--------------VLPKEE--VKIDWCEPKIEELKN
FEN1_PLAFA       ----------RFQEARKSFINPN--------------VLPKED--IKIDWNEPQIEELKH
FEN1_PLAF7       ----------RFQEARKSFINPN--------------VLPKED--IKIDWNEPQIEELKH
FEN1_CRYMR       ----------DYIKVRELFTNPN--------------VIKAKEFRDKLKWTNPNLEGLSE
FEN1_CRYPI       ----------DFSKVRELFKNPL--------------VSKNNQIKDLIKWSNPKYEELME
FEN1_GIAIC       ----------PYVRARELFKNPA--------------VIDPKEIKKTLKWKPVNRGEAMQ
FEN1_THEAN       ----------EFKEAKDYFLSPK--------------VNEYDE--NSVKMGTIDPEGLTE
FEN1_THEPA       ----------DFKEAKEYFLSPK--------------VNEYDE--NSVKLGTIDPEGLTE
FEN1_BABBO       ----------GYEAAQEYFRDPK--------------VRDI----TTIDRCEANIDGLRE
FEN_HALMA        ----------HADRIRDLFLDPA-----------------ATDDYEIPDSIEPDIDAART
FEN_NATPD        ----------HADRIRELFLDPA-----------------VTDDYDYDTDIDPDFERARE
FEN_HALWD        ----------HADRVRSLFLDPP-----------------VTNEYTLHTTINPDMDAARS
FEN_HALSA        ----------HGDRIRELFLNPD-----------------VTDDYVIDPDVSPAIDAARA
FEN_HALS3        ----------HGDRIRELFLNPD-----------------VTDDYVIDPDVSPAIDAARA
                                   :                                         

FEN_HYPBU        ILVEGHDFSPERVRNALERLKKAYREHF-RGQQMGLDAWLRR------------------
FEN_STAMF        ILVEEHDFNPERVKNAVERLVKAYREHI-KSKQLGLEAWFS-------------------
FEN_AERPE        ILVERHDFNPERVERALERLGKAYREKL-RGRQSRLDMWFG-------------------
FEN_THEPD        LLVERHQFSMERVTNALDRLEKAVKTHF-K--QQSLESWFGF------------------
FEN_IGNH4        ILVYEHDFNEERVRKAIERLMKAWKEKL-STKQSTLDMFFKKR-----------------
FEN_PYRAB        FLCDEHDFSEERVKNGLERLKKAIK----AGKQSTLESWFIKKKP---------------
FEN_PYRHO        FLCDEHNFSEERVKNGIERLKKAIK----AGRQSTLESWFVKKKP---------------
FEN_PYRFU        FLCDEHDFSEERVKNGLERLKKAIK----SGKQSTLESWFKR------------------
FEN_THEKO        FLCDEHDFSEERVKNGLERLKKAVK----AGKQRTLESWFGR------------------
FEN_THEON        FLCDEHDFSEERVKNGLERLKKAVK----AGKQSTLESWFGRR-----------------
FEN_THEGJ        FLCDEHDFSEERVKNGLERLKKAVK----AGKQRTLESWFR-------------------
FEN_THESM        FLCDEHDFSEERVKNGLERLKKVTK----TGKQFTLDTWFKK------------------
FEN_KORCO        FMVEEHEFSEERVKKVINEIEESYR----MLSGGGLESWF--------------------
FEN_METAC        FLCEENDFSTDRVEKAAERLKAASG-----ARQKTLDQWF--------------------
FEN_METBF        FLCKENDFSVDRVKKAVERLKVVSR-----GRQQTLDQWF--------------------
FEN_METMA        FLCDENDFSEDRVVKAADRLKAASG-----ARQQTLDQWF--------------------
FEN_METBU        LLCKKHDFSEERVNKALDRLEANIG-----GSQSTLDQWF--------------------
FEN_METAR        FLCEEHSFSVDRVDKVLERLTTAVSE---TTKQKTLSSWF--------------------
FEN_METTP        FLCNERNFSEDRVRKAAERLNASYR-----SGQSTLERWL--------------------
FEN_ARCFU        FLCEEHDFSRERVEKALEKLKALKS------TQATLERWF--------------------
FEN_SACS2        ILVYEHNFSEERVKNGIERLTKAIKEAKGASRQTGLDRWF--------------------
FEN_SULTO        ILVKTHDFNEERVKNGIERLEKAKREAKGASRQTGLDQWF--------------------
FEN_SULAC        LLVKNHDFNEDRVNNGIERLKKAIKEAKSVEKQTGLDQWF--------------------
FEN_NANEQ        ILVEEHDFNPERVERAIERLEKALNKINQKTLFSFFGS----------------------
FEN_PYRAE        FLIREHDFSEERVSKALERLRKARGKLK----TSSLDSFF--------------------
FEN_PYRAR        FLVHEHDFGEERVERALERLKKAMGKLR----TSALDSFF--------------------
FEN_PYRIL        FLVREHDFSEDRVLKAVERLKRAQTKYK----ISSLDSFF--------------------
FEN_PYRNV        FLVGEHDFSEERVAKAVERLKKARARQK----TSSLDSFFHGA-----------------
FEN_PYRCJ        LLVEEHDFSQERVAKALERLAKARGKVK----TTSLDAFF--------------------
FEN_CALMQ        LLVEEHDFSQDRVKNALERLRKSMGKAKG---STTLDSFFG-------------------
FEN_METKA        FLVEERDFSEDRVRRAVERLKEALQELRKGGRQETLDAFF--------------------
FEN_CENSY        YLVGERSFSEDRVAAALNRLRRALEK-----RSQNLDQWF--------------------
FEN_NITMS        YLVRERSFSEDRVNSTLNRLKKALEK-----KSQNLDQWF--------------------
FEN_METTH        FLCTEHGFSEDRVRAALKKFEGAS------STQKSLEDWF--------------------
FEN_METS3        FLCEEHGFSQDRVSKACDKLKNLN------SSQKSLEDWF--------------------
FEN_METST        FLCGEHDFDERRTISAIKKLQAK-------TAQSSLEDWF--------------------
FEN_METMJ        MLCGRYDFSEERVRSALAKVSVK-------ATQKTLDAWF--------------------
FEN_METB6        MLCDGYDFAPERVDAALERYSAK-------AGQKTLESFF--------------------
FEN_METPE        LLCGEYGFATERVRTALQKISGP-------PGQKTLDRWF--------------------
FEN_METHJ        FLCGEHGFSQDRVDPVLDKISKK-------EKQKTLESWF--------------------
FEN_METLZ        LLCGEHGFTQERVEAGLERLGAK-------KGQATLDAWF--------------------
FEN_THEAC        FLCDEHDFSRERIRDHLESLRKNDQ----ASTQFRLDSFD--------------------
FEN_THEVO        FLCVVHDFSRDRILEHINTYVKYYN----KSVQFRLDSF---------------------
FEN_PICTO        FLCGKHNFSESRVNETLEKISRNYK----KDHQSSLDRFF--------------------
FEN_METJA        FLVDENDFNYDRVKKHVDKLYNLIAN---KTKQKTLDAWFK-------------------
FEN_META3        FLIEENDFSPNRILPSIKKLDKLLNE---KRSQTSLDSWF--------------------
FEN1_LEIIN       FLVKEKLFNPDRVNKGIARLRAA---LT-RKTQGRLDSFFTVTK----------------
FEN1_LEIMA       FLVKEKLFNPDRVNKGIARLRAA---FT-RKTQGRLDSFFTITK----------------
FEN1_LEIBR       FLVKEKLFNPDRVNKGIARLRAA---LT-KKTQGRLDNFFTIVK----------------
FEN1_TRYB2       FLVDEKLFSKERVLKGIQRLRDA---LT-KKTQGRLDQFFTITK----------------
FEN1_TRYB9       FLVDEKLFSKERVLKGIQRLRDA---LT-KKTQGRLDQFFTITK----------------
FEN1_TRYCC       FLVEEKLFNKDRVLKGIQRLRNA---LT-RKTQGRLDQFFTITR----------------
FEN1_ARATH       FLVNENGFNIDRVTKAIEKIKTA---KN-KSSQGRLESFFKP------------------
FEN1_SOYBN       FLVNENGFNRDRVTKAIEKIKVA---KN-KSSQGRLESFFKP------------------
FEN11_ORYSI      FLVKENGFNQDRVTKAIEKIKFA---KN-KSSQGRLESFFKP------------------
FEN11_ORYSJ      FLVKENGFNQDRVTKAIEKIKFA---KN-KSSQGRLESFFKP------------------
FEN11_SORBI      FLVKDNGFNEDRVTKAIEKIKSA---KN-KSSQGRLESFFKP------------------
FEN1_MAIZE       FLVKDNGFNEDRVTKAIEKIKSA---KN-KSSQGRLESFFKP------------------
FEN11_PHYPA      LLVEENGFNNDRVMKAIEKLKVA---KN-KASQGRLESFFGV------------------
FEN1_OSTLU       FLVKEKQFNEERVRAVCAKVKKA---RQGKASQNRLESFFGP-P----------------
FEN1_OSTTA       FLVKEKQFQEDRVRGVCARIRKA---RQGAASQNRLESFFGP-P----------------
FEN1_MICCC       FLCGEKSFNEDRIRKQLADLKKA---RS-QGGQNRLETFFGA-A----------------
FEN1_CHLRE       FLVNEKQFNEQRVRNAVGRIKAN---KT-KANQGRLESFFTSLP----------------
FEN1_NAEGR       FLVKEKQFDEERVRGYIKRIKSS---RG-KPTQTRLDGFFTP------------------
FEN1_BOVIN       FMCGEKQFSEERIRSGVRRLSKS---RQ-GSTQGRLDDFFKVTG----------------
FEN1_SHEEP       FMCGEKQFSEERIRSGVRRLSKS---RQ-GSTQGRLDDFFKVTG----------------
FEN1_HUMAN       FMCGEKQFSEERIRSGVKRLSKS---RQ-GSTQGRLDDFFKVTG----------------
FEN1_MACFA       FMCGEKQFSEERIRSGVKRLSKS---RQ-GSTQGRLDDFFKVTG----------------
FEN1_MOUSE       FMCGEKQFSEERIRSGVKRLSKS---RQ-GSTQGRLDDFFKVTG----------------
FEN1_RAT         FMCGEKQFSEERIRSGVKRLNKS---RQ-GSTQGRLDDFFKVTG----------------
FEN1_CHICK       FMCGEKQFNEERIRNGVKRLSKS---RQ-GSTQGRLDDFFKVTG----------------
FEN1A_XENLA      FMCGEKQFSEDRIRNGAKKLAKN---RQ-GSTQGRLDDFFKVTG----------------
FEN1B_XENLA      FMCGEKQFSEDRIRNGAKKLAKN---RQ-GSTQGRLDDFFKVTG----------------
FEN1_XENTR       FMCAEKQFSEDRIRNGAKKLAKN---RQ-GSTQGRLDDFFKVTG----------------
FEN1_ANOFI       FMCNEKQFSEDRMRNGCKKILKS---RQ-GSTQGRLDSFFSITG----------------
FEN1_XIPMA       FMCSEKQFSEDRIRNGCKKMMKS---RQ-GSTQGRLDSFFSVTG----------------
FEN1_SALSA       FMCAEKQFSEDRIKNGCKKILKS---RQ-GSTQGRLDTFFTITG----------------
FEN1_OSMMO       FMCAEKQFSEDRMRNGCKKILKS---RQ-GSTQGRLDSFFSVTG----------------
FEN1A_DANRE      FMCAEKQFSEDRIRNGCKKITKS---RQ-GSTQGRLDTFFTVTG----------------
FEN1_BRAFL       YMSNEKGFSEDRIKNGAKKLKNA---RH-TSTQGRLDSFFKVMS----------------
FEN1_NEMVE       FMCQEKGFSEDRIRSGIKKLTKA---RH-GSTQGRLDSFFKVLP----------------
FEN1_TRIAD       FLVEEKGFSEDRIRRGVEKISKA---RG-TSTQGRLDSFFTIT-----------------
FEN1_AEDAE       YLCGDRQFNEDRIRAGAKKILKT---KS-TATQGRLDSFFKVLP----------------
FEN1_ANOGA       FLCGDRQFNEDRIRSGAKKILKT---KN-TATQGRLDSFFKVLP----------------
FEN1_GLOMM       FFCGDRQFNEDRVRSGAKKILKC---KS-SQTQGRLDSFFKVIP----------------
FEN1_DROER       FLCGDRQFSEERVRNGAKKLMKS---KQ-AQTQVRLDSFFKTLP----------------
FEN1_DROYA       FLCGDRQFSEERVRNGAKKLMKS---KQ-AQTQVRLDSFFKTLP----------------
FEN1_DROSE       FLCGDRQFNEERVRNGAKKLMKS---KQ-AQTQVRLDSFFKTLP----------------
FEN1_DROSI       FLCGDRQFNEERVRNGAKKLMKS---KQ-AQTQVRLDSFFKTLP----------------
FEN1_DROME       FLCGDRQFNEERVRNGAKKLMKS---KQ-AQTQVRLDSFFKTLP----------------
FEN1_DROPE       FLCGDRQFSEERVRNGAKKLLKS---KH-AQTQVRLDSFFKTLP----------------
FEN1_DROPS       FLCGDRQFSEERVRNGAKKLFKS---KH-AQTQVRLDSFFKTLP----------------
FEN1_DROAN       FLCGDRQFNEDRVRSGAKKLLKS---KQ-SQTQVRLDSFFKTLP----------------
FEN1_DROWI       FLCGERQFSEERVRGGAKKLLKS---KK-AQTQVRLDSFFQTLP----------------
FEN1_DROGR       FLCGDRQFNEERVRNGAKKLLKS---KQ-AQTQVRLDSFFKTLP----------------
FEN1_DROMO       FLCGDRQFNEERVRNGARKLLKS---KQ-SQTQVRLDSFFKALP----------------
FEN1_DROVI       FLCGDRQFNEERVRNGAKKLLKS---KQ-AQTQVRLDSFFTTLP----------------
FEN1_MONBE       FMCQENGFAEDRIRKSAEKLVKA---RK-GGQQGRLDSFFTAIP----------------
FEN1_CAEBR       FMCGEKNFSEDRIRSAMVRMQKS---RN-AGTQGRIDSFFTVSS----------------
FEN1_CAEEL       FLCGEKNFNEERIRNALAKLKTS---RK-SGTQGRIDSFFGNST----------------
FEN1_BRUMA       FLCVEKSFNEDRVRGSLTRMQKG---RQ-AAQQARIDSFFSVSK----------------
FEN1_AJECH       FLVEEKAFSEDRVRNAAARLQKN---LK-TAQQSRLEGFFKPIA----------------
FEN1_AJECN       FLVEEKAFSEDRVRNAAARLQKN---LK-TAQQSRLEGFFKPIA----------------
FEN1_AJEDR       FLVEEKAFSEDRVRNGAARLQKN---LK-TAQQSRLEGFFKPIA----------------
FEN1_UNCRE       FLVEGKGFSEDRVRSGAARLQKN---MK-TAQQSRLEGFFKPVA----------------
FEN1_ASPFU       FLVKDKGFNEDRVRNGATRLQKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_ASPFC       FLVKDKGFNEDRVRNGAARLQKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_NEOFI       FLVKDKGFNEDRVRNGAARLQKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_ASPCL       FLVKDKGFNEDRVRNGAARLQKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_ASPFN       FLVKDKGFNEDRVRNGAARLQKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_ASPTN       FLVKDKGFNEDRVRNGAARLQKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_EMENI       FLVKDKGFNEDRVRNGAARLQKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_ASPNC       FLVKDKGFNEDRVKNGAARLQKN---LK-SAQQSRLEGFFKPVA----------------
FEN1_PENRW       FLVGDKGFNEDRVRNGAARLSKH---LK-TAQQSRLEGFFKPVA----------------
FEN1_TALMQ       FLVTDKGFSEDRVRNGAARLAKN---LK-TAQQSRLEGFFKPVA----------------
FEN1_TALSN       FLVTEKGFSEDRVRNGAARLAKN---LK-SAQQSRLEGFFKPVT----------------
FEN1_ARTOC       FLVEEKGFSEDRVRNGAARLTKN---LK-SAQQSRLEGFFKPVA----------------
FEN1_PHANO       FLVEEKHFNEDRVRNGAAKLQKN---MK-SAQQSRLEGFFKPVE----------------
FEN1_PYRTR       FLVEEKHFNEDRVRNGAAKLQKN---MK-TAQQSRLEGFFKPIE----------------
FEN1_NEUCR       FLVHEKGFSEDRVRSAGTKLEKN---MK-TSQQARIEGFFKILP----------------
FEN1_SORMK       FLAHEKGFSEDRVRSASIKLQKN---MQ-TSQQARIEGFFKVLP----------------
FEN1_FUSV7       FLVTEKGFSEDRVRSGGARLEKN---LK-SSQQARLEGFFKPVP----------------
FEN1_MAGO7       YLVTEKGFSEDRVRPGALRLEKA---LG-TSQQQRLEGFFKPVA----------------
FEN1_COPCI       FLVTEKGFSEERVRKGAEKLTKF---LN-AKQQGRLDGFFTVKP----------------
FEN1_COPC7       FLVTEKGFSEERVRKGAEKLTKF---LN-AKQQGRLDGFFTVKP----------------
FEN11_LACBS      FLVKEKGFNEDRVRKGAEKLQKF---LN-SKQQGRLDGFFSVKP----------------
FEN12_LACBS      FLVNEKGFNEDRVRKGAEKLQKF---LN-SKQQGRLDGFFSVKP----------------
FEN1_CRYNJ       FLCRDKGFNEDRVRAGAAKLSKM---LA-AKQQGRLDGFFTVKP----------------
FEN1_USTMA       FLCQDKGFSEDRVRKGCEKLQKS---LS-QKQQGRLDGFFTVKP----------------
FEN1_SCHJY       FLVEEKGFNEDRVRVGINRLVKA---SK-TIPQGRLDSFFKVLP----------------
FEN1_SCHPO       FLVKEKGFNEDRVKLGINRLEKA---SK-TIPQGRLDSFFKPVP----------------
FEN1_ASHGO       FMCKEKGFNEDRIKSGIQKLRKG---LK-GGVQGRLDSFFKVKP----------------
FEN1_KLULA       FMVKEKGFNEDRIKSGIERLRKG---LK-VGVQKRLDSFFKIQP----------------
FEN1_YEAST       YLCDDKKFSEERVKSGISRLKKG---LK-SGIQGRLDGFFQVVP----------------
FEN1_YEAS7       YLCDDKKFSEERVKSGISRLKKG---LK-SGIQGRLDGFFQVVP----------------
FEN1_YEAS2       YLCDDKKFSEERVKSGISRLKKG---LK-SGIQGRLDGFFQVVP----------------
FEN1_YEAS8       YLCDDKKFSEERVKSGISRLKKG---LK-SGIQGRLDGFFQVVP----------------
FEN1_YEAS1       YLCDDKKFSEERVKSGISRLKKG---LK-SGIQGRLDGFFQVVP----------------
FEN1_VANPO       FLCGEKKFSEERVKSGIERLKKG---LK-SGVQGRLDGFFQVVP----------------
FEN1_CANGA       YLCHEKKFSEERVRSGIKRLQKG---LK-SGVQGRLDGFFKVVP----------------
FEN1_ZYGRC       FLCHEKKFNEERVKSGIKRLQKG---LK-SGVQVRLDGFFQKVP----------------
FEN1_LACTC       FMCKEKGFNEERIRSGIKRLQKG---LK-TGVQGRLDGFFKVKP----------------
FEN1_CANAW       FMVKQKGFSEDRIRSGAEKLKKG---LK-GGVQGRLDGFFKVVK----------------
FEN1_CANAL       FMVKQKGFSEDRIRSGAEKLKKG---LK-GGVQGRLDGFFKVVK----------------
FEN1_CANDC       FMVRQKGFSEDRIRSGAEKLKKG---LK-GGVQGRLDGFFKVVK----------------
FEN1_CANTT       YMVKGKGFSEDRIRSGAEKLKKG---LK-GGVQGRLDSFFTVVK----------------
FEN1_LODEL       YMVKNKGFSEDRIRSGAEKLKKG---LK-AGIQGRLDGFFTVVP----------------
FEN1_PICST       YMVREKGFSEDRIRSGAEKLKKG---LK-TGVQGRLDGFFSVVA----------------
FEN1_CLAL4       FMVKQKGFSEERIRSGAEKLKKA---LK-GGVQGRLDGFFTVV-----------------
FEN1_PICGU       FMVKQKGFSEDRVRSGAEKLKKG---LK-GGVQGRLDGFFSVV-----------------
FEN1_DEBHA       YMVKEKGFSEDRIRSGAEKLKKG---LK-GGVQGRLDGFFQSVP----------------
FEN1_KOMPG       YMVRQHGFSEQRIRDGASKLRKS---LK-TGTQGRLDKFFVVKK----------------
FEN1_YARLI       FLVRDKGFSEDRVRAGAARLMKQ---VK-VKPQARLDGFFKVMP----------------
FEN1_DICDI       FLVEEMGFSDVRVAQGIEKLKKF---KN-TSVQSRMDSFITVIK----------------
FEN1_POLPP       YLVGEMGFNETRVQQGIEKLKKY---KD-TGVQTRIDTFFPMIK----------------
FEN11_PARTE      FLVEEKGFAESRIDNGLKRIAK----KDTTGFQSRLENFFGKTT----------------
FEN12_PARTE      FLIEEKGFAESRIDNGLKRIAK----KDPAGFQSRLENFFGKTT----------------
FEN1_TETTS       FLVEEKGFSEQRVTSQMEKVLNA---KEHKGSQTRLNDFFKVQP----------------
FEN1_PHATC       FLVDDMGFNVDRVKNNIEKLQAAY--KANSKPQTRMDSFFAVKA----------------
FEN1_THAPS       FLVDEMGFNPDRVQASIEKLQKAF--KASAKPQSRMDSFFKVKA----------------
FEN1_PHYIT       FLVKKHGFQEDRVLSAITRLKKS----KSTQSQKRLDSFFTVMP----------------
FEN1_ENTDS       YLVTEKHFNEERVTKGIEKLKNV---KS-KKAQGRLDSFFSVKK----------------
FEN1_ENTHI       YLVTEKHFNEERVSKGIEKLKNV---KS-KKAQGRLDSFFNVKK----------------
FEN1_ENCCU       FLVEEKGFDLERVNKGIDKLINS---RK-KGTQGRLDCFITRSK----------------
FEN1_ENTBH       FLCNEKGFDKGRIETGIKKLQKQ---KK-VNKQTRIDSFFKKKL----------------
FEN1_PLABA       FLIKEHNFNEVRVTNYITRLLKA----RKVTTQRRLDTFFTTCT----------------
FEN1_PLAYO       FLIKEHNFNEVRVTNYITRLLKA----RKVTTQRRLDTFFTTCT----------------
FEN1_PLACH       FLIKEHNFNEVRVTNYITRLLKA----RKVTTQRRLDTFFTTCT----------------
FEN1_PLAKH       FLIKDYNFNEVRVTNYINRLLKA----RKVTTQRRLDNFFTACT----------------
FEN1_PLAVS       FLIKDYNFNEVRVTNYINRLLKA----RKVTTQRRLDNFFTACT----------------
FEN1_PLAFA       FLIKDYNFNELRVTNYINRLLKA----RKVTTQRRLDNFFTACT----------------
FEN1_PLAF7       FLIKDYNFNELRVTNYINRLLKA----RKVTTQRRLDNFFTACT----------------
FEN1_CRYMR       WLIKQQNFSEVRVANYCTRIKKS----KGKTAQTSLDSFFTLTP---KKTSENKNKE--K
FEN1_CRYPI       WLIKEQNFNEARVNSYCERIKKS----KNKTSQTCLDGFFKTASNERKNTHETPSRPPLS
FEN1_GIAIC       FLVEEMEFDRETTEKKLDKLVAARKK----PKQCTIDSFFSPRS----------------
FEN1_THEAN       FLVQENNFSKERVEKFIEKLLKF----KTKKIQTSLLSFLTNPQP----TNKSKSLDEGP
FEN1_THEPA       FLVQENNFSKERVEKFIEKLLKF----KTKKIQTSLLSFLTAPQH----NNKAKSSNKRP
FEN1_BABBO       FLISENDFSEERVDKLIERLQKA----RSKKTQLSLKSFFGYPPRAANITRNYTVPIKGV
FEN_HALMA        FVTDQWEVDADEVARGFERIDDS-------VVQTGLDRWA--------------------
FEN_NATPD        FVTETWGVPADEVERGFERIEES-------VIQTGLDRWT--------------------
FEN_HALWD        YVVDDWEVPADEVERGFERIETS-------VVQTGLDEWI--------------------
FEN_HALSA        FVTDEWEVDADAVARGFERIDAA-------AAQTGLDRWT--------------------
FEN_HALS3        FVTDEWEVDADAVARGFERIDAA-------AAQTGLDRWT--------------------
                  .     .                           :                        

FEN_HYPBU        ------------------------------------------------------------
FEN_STAMF        ------------------------------------------------------------
FEN_AERPE        ------------------------------------------------------------
FEN_THEPD        ------------------------------------------------------------
FEN_IGNH4        ------------------------------------------------------------
FEN_PYRAB        ------------------------------------------------------------
FEN_PYRHO        ------------------------------------------------------------
FEN_PYRFU        ------------------------------------------------------------
FEN_THEKO        ------------------------------------------------------------
FEN_THEON        ------------------------------------------------------------
FEN_THEGJ        ------------------------------------------------------------
FEN_THESM        ------------------------------------------------------------
FEN_KORCO        ------------------------------------------------------------
FEN_METAC        ------------------------------------------------------------
FEN_METBF        ------------------------------------------------------------
FEN_METMA        ------------------------------------------------------------
FEN_METBU        ------------------------------------------------------------
FEN_METAR        ------------------------------------------------------------
FEN_METTP        ------------------------------------------------------------
FEN_ARCFU        ------------------------------------------------------------
FEN_SACS2        ------------------------------------------------------------
FEN_SULTO        ------------------------------------------------------------
FEN_SULAC        ------------------------------------------------------------
FEN_NANEQ        ------------------------------------------------------------
FEN_PYRAE        ------------------------------------------------------------
FEN_PYRAR        ------------------------------------------------------------
FEN_PYRIL        ------------------------------------------------------------
FEN_PYRNV        ------------------------------------------------------------
FEN_PYRCJ        ------------------------------------------------------------
FEN_CALMQ        ------------------------------------------------------------
FEN_METKA        ------------------------------------------------------------
FEN_CENSY        ------------------------------------------------------------
FEN_NITMS        ------------------------------------------------------------
FEN_METTH        ------------------------------------------------------------
FEN_METS3        ------------------------------------------------------------
FEN_METST        ------------------------------------------------------------
FEN_METMJ        ------------------------------------------------------------
FEN_METB6        ------------------------------------------------------------
FEN_METPE        ------------------------------------------------------------
FEN_METHJ        ------------------------------------------------------------
FEN_METLZ        ------------------------------------------------------------
FEN_THEAC        ------------------------------------------------------------
FEN_THEVO        ------------------------------------------------------------
FEN_PICTO        ------------------------------------------------------------
FEN_METJA        ------------------------------------------------------------
FEN_META3        ------------------------------------------------------------
FEN1_LEIIN       -----VPQQTAAARAPLAG-------------------------------TKRPRDGKYV
FEN1_LEIMA       -----VPQQTAAARAPLVG-------------------------------TKRPRDGKYV
FEN1_LEIBR       -----APPQAAAPRAPLAG-------------------------------RKRSHDGKCV
FEN1_TRYB2       ------PQKQVNSEASTAG-------------------------------TKRNRG--AV
FEN1_TRYB9       ------PQKQVNSEASTAG-------------------------------TKRNRG--AV
FEN1_TRYCC       ------PVTKPNTCDAKAG-------------------------------VKRGHS--AI
FEN1_ARATH       -------VANSSVPAK-----------------------------------RKEIPESTT
FEN1_SOYBN       -------TANPSVPIK-----------------------------------RKETPVNNA
FEN11_ORYSI      -------VVSTSVPLK-----------------------------------RKDTSEKPT
FEN11_ORYSJ      -------VVSTSVPLK-----------------------------------RKDTSEKPT
FEN11_SORBI      -------VATTSAPLK-----------------------------------RKETSDKTS
FEN1_MAIZE       -------TATTSAPLK-----------------------------------RKETSDKTS
FEN11_PHYPA      -------SSSSSNKRKEAPDSEASAG-----------------------KQVKTAAAVKP
FEN1_OSTLU       -----TIISSTIGKRKV---------------------------------EEKK-GKNGK
FEN1_OSTTA       -----KIISSTIGKRKV---------------------------------EETKSGKGSK
FEN1_MICCC       -----TVKSSTVGKRKE---------------------------------PEKGKGKFGA
FEN1_CHLRE       -----KPATADKAKPKE---------------------------------DDKKRKAGAA
FEN1_NAEGR       ------VASSSTTKKKA---------------------------------PAKKDDKKSA
FEN1_BOVIN       -----SLSSA-----KRKEPEPK---------------------------------GAAK
FEN1_SHEEP       -----SLSSA-----KRKEPEPK---------------------------------GAAK
FEN1_HUMAN       -----SLSSA-----KRKEPEPK---------------------------------GSTK
FEN1_MACFA       -----SLSSA-----KRKEPEPK---------------------------------GSTK
FEN1_MOUSE       -----SLSSA-----KRKEPEPK---------------------------------GPAK
FEN1_RAT         -----SLSSA-----KRKEPEPK---------------------------------GPAK
FEN1_CHICK       -----SITSA-----KRKEPETK---------------------------------GSAK
FEN1A_XENLA      -----SVSST-----KRKEAESK---------------------------------GSAK
FEN1B_XENLA      -----SISST-----KRKEVESK---------------------------------GSTK
FEN1_XENTR       -----SISST-----KRKEVESK---------------------------------GSAK
FEN1_ANOFI       -----SLSS------KRKEPELK---------------------------------GSAK
FEN1_XIPMA       -----SLSS------KRKEPETK---------------------------------GSAK
FEN1_SALSA       -----SLSS------KRKEPETK---------------------------------GSNK
FEN1_OSMMO       -----SLSS------KRKEPEMK---------------------------------GSTK
FEN1A_DANRE      -----SISS------KRKEPETK---------------------------------GSAK
FEN1_BRAFL       -----SPSV------KRKEP-PK---------------------------------GAKG
FEN1_NEMVE       -----SPAN------KRK---LQ---------------------------------DGKG
FEN1_TRIAD       ------PGAI-----KRKTDAKK---------------------------------DAGK
FEN1_AEDAE       -----STP-----NPKRKIEDKK---------------------------------TPAS
FEN1_ANOGA       -----STG-----TPKRKVDEKKP------------------------------LAGSSA
FEN1_GLOMM       -----AACG---TTPKRKADDKN---------------------------------NVQQ
FEN1_DROER       -----STPN-ATNAAKRKAEEAK--------------------------------KSANN
FEN1_DROYA       -----STPN-ATNAAKRKAEEAK--------------------------------KSANN
FEN1_DROSE       -----STPN-ATNAAKRKADEAK--------------------------------KSANN
FEN1_DROSI       -----STPN-ATNAAKRKAEEAK--------------------------------KSANN
FEN1_DROME       -----STPN-ATNAAKRKAEEAK--------------------------------KSANN
FEN1_DROPE       -----STPN-AVHAAKRKAEEAK--------------------------------KSANN
FEN1_DROPS       -----STPN-AVNAAKRKAEEAK--------------------------------KSANN
FEN1_DROAN       -----STPS-ATNAAKRKAEEAK--------------------------------KSANN
FEN1_DROWI       -----SSPN-AVAAAKRKAEEAK--------------------------------KSANN
FEN1_DROGR       -----SSPN-AIAAAKRKAEESK--------------------------------KSANS
FEN1_DROMO       -----SSPN-ATAAAKRKAEEIK--------------------------------KSANN
FEN1_DROVI       -----STPNASTSAAKRKAEEAK--------------------------------KSANN
FEN1_MONBE       -----SGSA------KRNTVGLL-------------------------------------
FEN1_CAEBR       -----QVKCVTV-AKRKAQEEAE----------------------------------KMK
FEN1_CAEEL       -----KVTCVTA-ATKRKAEEAE----------------------------------KAK
FEN1_BRUMA       -----VVTSET---TKRKNEEKN----------------------------------NLK
FEN1_AJECH       -----KTEQEKAVLKRKHEEK---------------------------------LELQKK
FEN1_AJECN       -----KTEQEKAVLKRKHEEK---------------------------------LELQKK
FEN1_AJEDR       -----KTEQEKATLKRKHEEK---------------------------------LELQKK
FEN1_UNCRE       -----KTDEEKASLKRKHEEK---------------------------------LEAAKK
FEN1_ASPFU       -----RTDEEKASLKRKHDEK---------------------------------LQEQKK
FEN1_ASPFC       -----RTDEEKASLKRKHDEK---------------------------------LQEQKK
FEN1_NEOFI       -----RTDEEKASLKRKHDEK---------------------------------LQEQKK
FEN1_ASPCL       -----KTDAEKASLKRKHDEK---------------------------------LQEQKK
FEN1_ASPFN       -----RTDEEKANLKRKHDEK---------------------------------LQEQKK
FEN1_ASPTN       -----RSDEEKATLKRKHDEK---------------------------------LQEQKK
FEN1_EMENI       -----KTDAEKATLKRKHDEK---------------------------------IQEQKK
FEN1_ASPNC       -----RTDEEKASLKRKHDEK---------------------------------IQEQKK
FEN1_PENRW       -----RTEDEKASLKRKHDEK---------------------------------LQQQKK
FEN1_TALMQ       -----KTDAEKASMKRKHDEK---------------------------------IEEQKK
FEN1_TALSN       -----KTEAEKASLKRKHDEK---------------------------------IEEQKK
FEN1_ARTOC       -----KTEQQKATAKRKAEEK---------------------------------AELAKK
FEN1_PHANO       -----RTPEEKASLKRKADEK---------------------------------LSEKKK
FEN1_PYRTR       -----KTAEQKATLKRKADEK---------------------------------LEEKKK
FEN1_NEUCR       -----KTEEEKKAHKRKLEEQ---------------------------------AEQKRK
FEN1_SORMK       -----KTEEEKKAHKRKLEEQ---------------------------------AEQKRK
FEN1_FUSV7       -----KTDAQKAAHKRKLEEK---------------------------------NEEKKK
FEN1_MAGO7       -----RTAEEQKAHKRKLEVK---------------------------------AEEAKK
FEN1_COPCI       -----KQ---APPPAAKGKG----------------------------------AASKGT
FEN1_COPC7       -----KQ---APPPAAKGKG----------------------------------AASKGT
FEN11_LACBS      -----KEKAAAPAPVGKAKGKGKVD-----------------------------AKAKGT
FEN12_LACBS      -----KEKAAAPAPVGKAKGKGKID-----------------------------AKAKGT
FEN1_CRYNJ       -----KE--PAAKDTGKGKG----------------------------------KATKGE
FEN1_USTMA       -----GS----APPKRKAED-----------------------------------DKKNV
FEN1_SCHJY       -----STKKE--KEKPKAAAK---------------------------------------
FEN1_SCHPO       -----SSPKKPVDTKSKGSAK---------------------------------------
FEN1_ASHGO       -----KTTEQLAASARKAQAA---------------------------------------
FEN1_KLULA       -----KTKEELATAAKKAKDA---------------------------------------
FEN1_YEAST       -----KTKEQLAAAAKRAQEN---------------------------------------
FEN1_YEAS7       -----KTKEQLAAAAKRAQEN---------------------------------------
FEN1_YEAS2       -----KTKEQLAAAAKRAQEN---------------------------------------
FEN1_YEAS8       -----KTKEQLAAAAKRAQEN---------------------------------------
FEN1_YEAS1       -----KTKEQLAAAAKRAQEN---------------------------------------
FEN1_VANPO       -----KTKEQLAKAAAKAKAA---------------------------------------
FEN1_CANGA       -----KTKEQLEAAAAKAKLA---------------------------------------
FEN1_ZYGRC       -----KTKEQLAAATAKAKAA---------------------------------------
FEN1_LACTC       -----KNKEQLAAANAKAKST---------------------------------------
FEN1_CANAW       -----TDD---------KKRK---------------------------------------
FEN1_CANAL       -----TDD---------KKRK---------------------------------------
FEN1_CANDC       -----NDD---------KKRK---------------------------------------
FEN1_CANTT       -----KDDGKD------KKRK---------------------------------------
FEN1_LODEL       -----KYSNTSPLGKDDKKRK---------------------------------------
FEN1_PICST       -----KPGAKAGDKKGDKKRG---------------------------------------
FEN1_CLAL4       -----KSSPA------KRKPD---------------------------------------
FEN1_PICGU       -----KTE--------KRKP----------------------------------------
FEN1_DEBHA       -----KPKDS------ADKKR---------------------------------------
FEN1_KOMPG       -----RPAE--------EKKG---------------------------------------
FEN1_YARLI       -----KEGG--------EKRK---------------------------------------
FEN1_DICDI       -----KPEDP-NDKKKKVTKTPS-------------------------------------
FEN1_POLPP       -----RPRDEDAGSAKKKQKTVA-------------------------------------
FEN11_PARTE      -----KIIHPNNSKAKGKANK-------------------------------------KN
FEN12_PARTE      -----KIIHPNNSKAKAKSNK-------------------------------------KT
FEN1_TETTS       -----KDTSSTSKASKKPTNT-------------------------------------KS
FEN1_PHATC       -----NPNA-AKSAAKRKADA-------------------------------------AK
FEN1_THAPS       -----NPEGDKKKAEKRKAEL-------------------------------------AA
FEN1_PHYIT       -----SANG----AKKRKAPA-------------------------------------AK
FEN1_ENTDS       -----VPLSKSEAASGVKRKK-------------------------------------PT
FEN1_ENTHI       -----VPLSKSEAASGVKRKK-------------------------------------PT
FEN1_ENCCU       ------------------------------------------------------------
FEN1_ENTBH       ------------------------------------------------------------
FEN1_PLABA       -----KKSTKLIIEENQ------------------------------------KEVLKTK
FEN1_PLAYO       -----KKSTKLIIEESQ------------------------------------KEVLKTK
FEN1_PLACH       -----KKSTKLIIEESQ------------------------------------KELLKAK
FEN1_PLAKH       -----KKSTKLVNEESQ-----------------------------------IKKEVKPK
FEN1_PLAVS       -----KKSTKLVIEESQSQSK-------------------------------TQKEAKSK
FEN1_PLAFA       -----KKSTKLIVEETK------------------------------------KEQTLPA
FEN1_PLAF7       -----KKSTKLIVEETK------------------------------------KEQTLPA
FEN1_CRYMR       EITKVQEVKETISNINKDTRK-----------------------------DSVSEWGEIK
FEN1_CRYPI       EKQKSETRKEVDSSLSCDKKKVKIEE-----------------------TKIISEWGAPV
FEN1_GIAIC       ------------------------------------------------------------
FEN1_THEAN       KQSSTEDYKVNTNPSTKGSNVYTTD--------------TNSTKDTKGIECTATTTNNNL
FEN1_THEPA       REPKALDCKPNTYGSGKGTNVVKKE--------------SSTIKKDE-IDLTAEDLFCEP
FEN1_BABBO       SPPAVVESAVDSTSDDGKDEVPSDDKVPSVNEVPTVDKVPSVNEVPTVEEAPPADAVPTV
FEN_HALMA        ------------------------------------------------------------
FEN_NATPD        ------------------------------------------------------------
FEN_HALWD        ------------------------------------------------------------
FEN_HALSA        ------------------------------------------------------------
FEN_HALS3        ------------------------------------------------------------
                                                                             

FEN_HYPBU        ------------------------------------------------------------
FEN_STAMF        ------------------------------------------------------------
FEN_AERPE        ------------------------------------------------------------
FEN_THEPD        ------------------------------------------------------------
FEN_IGNH4        ------------------------------------------------------------
FEN_PYRAB        ------------------------------------------------------------
FEN_PYRHO        ------------------------------------------------------------
FEN_PYRFU        ------------------------------------------------------------
FEN_THEKO        ------------------------------------------------------------
FEN_THEON        ------------------------------------------------------------
FEN_THEGJ        ------------------------------------------------------------
FEN_THESM        ------------------------------------------------------------
FEN_KORCO        ------------------------------------------------------------
FEN_METAC        ------------------------------------------------------------
FEN_METBF        ------------------------------------------------------------
FEN_METMA        ------------------------------------------------------------
FEN_METBU        ------------------------------------------------------------
FEN_METAR        ------------------------------------------------------------
FEN_METTP        ------------------------------------------------------------
FEN_ARCFU        ------------------------------------------------------------
FEN_SACS2        ------------------------------------------------------------
FEN_SULTO        ------------------------------------------------------------
FEN_SULAC        ------------------------------------------------------------
FEN_NANEQ        ------------------------------------------------------------
FEN_PYRAE        ------------------------------------------------------------
FEN_PYRAR        ------------------------------------------------------------
FEN_PYRIL        ------------------------------------------------------------
FEN_PYRNV        ------------------------------------------------------------
FEN_PYRCJ        ------------------------------------------------------------
FEN_CALMQ        ------------------------------------------------------------
FEN_METKA        ------------------------------------------------------------
FEN_CENSY        ------------------------------------------------------------
FEN_NITMS        ------------------------------------------------------------
FEN_METTH        ------------------------------------------------------------
FEN_METS3        ------------------------------------------------------------
FEN_METST        ------------------------------------------------------------
FEN_METMJ        ------------------------------------------------------------
FEN_METB6        ------------------------------------------------------------
FEN_METPE        ------------------------------------------------------------
FEN_METHJ        ------------------------------------------------------------
FEN_METLZ        ------------------------------------------------------------
FEN_THEAC        ------------------------------------------------------------
FEN_THEVO        ------------------------------------------------------------
FEN_PICTO        ------------------------------------------------------------
FEN_METJA        ------------------------------------------------------------
FEN_META3        ------------------------------------------------------------
FEN1_LEIIN       HVSGTL-RKATSGHKKAVKK----------------------------------------
FEN1_LEIMA       HVSGTL-RKATSGHKKAVKK----------------------------------------
FEN1_LEIBR       HVSGTL-QKATGGHKKAVRK----------------------------------------
FEN1_TRYB2       ALPGVLQRKSSSGHKKAVKK----------------------------------------
FEN1_TRYB9       ALPGVLQRKSSSGHKKAVKK----------------------------------------
FEN1_TRYCC       ALSGTLQQKGSSGHKKVVKK----------------------------------------
FEN1_ARATH       KGAANKKTKGAGGRKKK-------------------------------------------
FEN1_SOYBN       K-ETNKKTKAGGGKKKK-------------------------------------------
FEN11_ORYSI      KAVANKKTKGAGGKKK--------------------------------------------
FEN11_ORYSJ      KAVANKKTKGAGGKKK--------------------------------------------
FEN11_SORBI      KAAAANKKTKAGGKKK--------------------------------------------
FEN1_MAIZE       KAAA-NKKTKAGGKKK--------------------------------------------
FEN11_PHYPA      AKAASKKGPAKGGKKK--------------------------------------------
FEN1_OSTLU       AGLANKKSKGVSGFRRSKN-----------------------------------------
FEN1_OSTTA       AGLN-KKSKGVSGYKSKKT-----------------------------------------
FEN1_MICCC       AGGK--KSKGVTKRKF--------------------------------------------
FEN1_CHLRE       AGGK--DAKGGAAAKKGKFGVGGGKK----------------------------------
FEN1_NAEGR       TDKKRKAADASTSSKKKK------------------------------------------
FEN1_BOVIN       KKAKTGAA---GKFKRGK------------------------------------------
FEN1_SHEEP       KKQRLGPA---GKFKRGK------------------------------------------
FEN1_HUMAN       KKAKTGAA---GKFKRGK------------------------------------------
FEN1_MACFA       KKAKTGAA---GKFKRGK------------------------------------------
FEN1_MOUSE       KKAKTGGA---GKFRRGK------------------------------------------
FEN1_RAT         KKAKTGGA---GKFRRGK------------------------------------------
FEN1_CHICK       KKAKTNSAT--AKFKKGK------------------------------------------
FEN1A_XENLA      KKAKTGGTPA-GKFKRGK------------------------------------------
FEN1B_XENLA      KKSKTGGTPA-GKFKRGK------------------------------------------
FEN1_XENTR       KKAKTAGTPA-GKFKRGK------------------------------------------
FEN1_ANOFI       KKQKTGATP--GKFKKGK------------------------------------------
FEN1_XIPMA       KKQKTGATP--GKFRKGK------------------------------------------
FEN1_SALSA       KKQKTGATP--GKFKKGK------------------------------------------
FEN1_OSMMO       KKLKTGATA--GKFKKGK------------------------------------------
FEN1A_DANRE      KKQKTSATP--GKFKKGK------------------------------------------
FEN1_BRAFL       SASKKAKMSG-GKFKKPK------------------------------------------
FEN1_NEMVE       SQNKKAKT-G-GKFKRPK------------------------------------------
FEN1_TRIAD       KKAKPGPA---GRFKRR-------------------------------------------
FEN1_AEDAE       KKAKTTGGK---PGRKPK------------------------------------------
FEN1_ANOGA       KKAKTGGAT---RGRKPK------------------------------------------
FEN1_GLOMM       KKSKTAGNT---KGKRPK------------------------------------------
FEN1_DROER       KKAKTSGGVG-GRGRRPK------------------------------------------
FEN1_DROYA       KKAKTSGGGG-GRGRRPK------------------------------------------
FEN1_DROSE       KKAKTSGG---GRGRRPK------------------------------------------
FEN1_DROSI       KKAKTSGG---GRGRRPK------------------------------------------
FEN1_DROME       KKAKTSGG---GRGRRPK------------------------------------------
FEN1_DROPE       KKAKTSGGA--ARGRRPK------------------------------------------
FEN1_DROPS       KKAKTSGGA--ARGRRPK------------------------------------------
FEN1_DROAN       KKAKTSGGGGGGRGRRPK------------------------------------------
FEN1_DROWI       KKAKIGGGGGAGRGRRPK------------------------------------------
FEN1_DROGR       KKAKIGGGSGAGRGRRPK------------------------------------------
FEN1_DROMO       KKAKTSGGSGAARGRRPK------------------------------------------
FEN1_DROVI       KKAKT---SSAGRGRRPK------------------------------------------
FEN1_MONBE       --PKPGPPP----FLF--------------------------------------------
FEN1_CAEBR       KGGKKSGPP----KKKAK------------------------------------------
FEN1_CAEEL       KGAKKGGPP----KKRAK------------------------------------------
FEN1_BRUMA       KRGPSLGKK----AKK--------------------------------------------
FEN1_AJECH       KKKEDSKAKKEAKSKPRGTT----------------------------------------
FEN1_AJECN       KKKEDAKAKKEAKSKPRGTT----------------------------------------
FEN1_AJEDR       KKKEEAKAKKEAKSKPRGAV----------------------------------------
FEN1_UNCRE       KKKEDAKAKREAKSRPKGTA----------------------------------------
FEN1_ASPFU       RKKEEAKAKKEAKAKPRGAA----------------------------------------
FEN1_ASPFC       RKKEEAKAKKEAKAKPRGAA----------------------------------------
FEN1_NEOFI       RKKEEAKAKKEAKAKPRGAA----------------------------------------
FEN1_ASPCL       RKKEEAKAKKEAKAKPRGAA----------------------------------------
FEN1_ASPFN       RKKEEAKAKKEAKARPRGAG----------------------------------------
FEN1_ASPTN       RKKEEAKAKKEAKARPRGAG----------------------------------------
FEN1_EMENI       RKKEEAKAKKEAKARPRAAV----------------------------------------
FEN1_ASPNC       KKKEEAKAKKEAKSRPRGAG----------------------------------------
FEN1_PENRW       KKKEDAKAKKEAKAKPRGAA----------------------------------------
FEN1_TALMQ       RKKEDAKAKKEAKARPRGAV----------------------------------------
FEN1_TALSN       RKKEEAKAKKEAKARPRGAV----------------------------------------
FEN1_ARTOC       KKKEDAKAKRAMGAKPRGAR----------------------------------------
FEN1_PHANO       KQKEEAKAKKQAKSKPRTAG----------------------------------------
FEN1_PYRTR       KQKVDAKAKKQAKAKPRTAG----------------------------------------
FEN1_NEUCR       KVKEEKKEKAKLKAKPRGA-----------------------------------------
FEN1_SORMK       KVKEEKKEKAKLKAKPRGA-----------------------------------------
FEN1_FUSV7       KLKQEKKDKAAAKSKPRGAA----------------------------------------
FEN1_MAGO7       KLKAEKKEKAKAKARPRGTA----------------------------------------
FEN1_COPCI       KRKGEDKAEGSGKKAKKK------------------------------------------
FEN1_COPC7       KRKGEDKAEGSGKKAKKK------------------------------------------
FEN11_LACBS      KRKVGFLNSMSGPLA---------------------------------------------
FEN12_LACBS      KRKVDEKAESSAGKKPRKK-----------------------------------------
FEN1_CRYNJ       KRKAEEKG--SAKKKSKN------------------------------------------
FEN1_USTMA       KKKGKK------------------------------------------------------
FEN1_SCHJY       RKRD-TKSSAPKKKR---------------------------------------------
FEN1_SCHPO       RKRDSNKGGESKKKR---------------------------------------------
FEN1_ASHGO       KKTNQ-KGKVLKRR----------------------------------------------
FEN1_KLULA       KKKAAAKGKIAKRR----------------------------------------------
FEN1_YEAST       KKLNKNKNKVTKGRR---------------------------------------------
FEN1_YEAS7       KKLNKNKNKVTKGRR---------------------------------------------
FEN1_YEAS2       KKLNKNKNKVTKGRR---------------------------------------------
FEN1_YEAS8       KKLNKNKNKVTKGRR---------------------------------------------
FEN1_YEAS1       KKLNKNKNKVTKGRR---------------------------------------------
FEN1_VANPO       KKSGK----VTKKRR---------------------------------------------
FEN1_CANGA       KKNAKGAKGKVTKRR---------------------------------------------
FEN1_ZYGRC       KKTKGKTGKVSKR-----------------------------------------------
FEN1_LACTC       KAGKQATKGKVGKPGRPRK-----------------------------------------
FEN1_CANAW       ADPKESKASKKKKK----------------------------------------------
FEN1_CANAL       ADPKESKASKKKKK----------------------------------------------
FEN1_CANDC       ADPKETKSSKKKRR----------------------------------------------
FEN1_CANTT       STAKDTKSKKQKK-----------------------------------------------
FEN1_LODEL       TNDKKGAAAKKTKRR---------------------------------------------
FEN1_PICST       SDSK--ASNNKKKRK---------------------------------------------
FEN1_CLAL4       AKDAKGKGKKKAKR----------------------------------------------
FEN1_PICGU       EQDKKTKGSKKAKKK---------------------------------------------
FEN1_DEBHA       KNDTKSAKSKKAKTRK--------------------------------------------
FEN1_KOMPG       KNTKEEKPKKKRK-----------------------------------------------
FEN1_YARLI       ADDKKTKGKKPATKKAKK------------------------------------------
FEN1_DICDI       KPSAKTSKKSSSTFKRK-------------------------------------------
FEN1_POLPP       KPGAAGSKKKPAAKKAAGKK----------------------------------------
FEN11_PARTE      EQTQKSGGK-----KKI-------------------------------------------
FEN12_PARTE      EQPQKSGGK-----KKI-------------------------------------------
FEN1_TETTS       AN--KKGGK-----K---------------------------------------------
FEN1_PHATC       AKAAVSKKK----TKKH-------------------------------------------
FEN1_THAPS       SRGKGKKGKGGGGFKKK-------------------------------------------
FEN1_PHYIT       GGKKAATAK----KGKK-------------------------------------------
FEN1_ENTDS       TKAKESRKKK--------------------------------------------------
FEN1_ENTHI       TKAKESRKKK--------------------------------------------------
FEN1_ENCCU       ------------------------------------------------------------
FEN1_ENTBH       ------------------------------------------------------------
FEN1_PLABA       SKGKKREINNDNSTKLNAKKK----------KTNVKDEKKNNEKVD------EPKNKPN-
FEN1_PLAYO       GKGKKREINNDSSTKLNAKKK----------KTNVKDEKKNNEKVD------ELKNKSD-
FEN1_PLACH       GKGKKRELN-DNSTKLNAKKK----------KTNIKDEKKNTDKMD------ELKNKSD-
FEN1_PLAKH       RKGKKRDAPNDSSTKLNSKQN----------KKPKGEKESKTEKDD-----GDTHNGNDN
FEN1_PLAVS       RKGKKRDAPNDGAAKLNSKQS----------KKTKVEKEPKREKKDEEAPNGEAHNGDNN
FEN1_PLAFA       RKGKKRPTAGDKNKQKAVKRKIEQANANGHHKMKEENKSVDNEKNEDGIKSVDNEKNEDG
FEN1_PLAF7       RKGKKRPTAGDKNKQKAVKRKIEQANANGHHKMKEENKSVDNEKNEDGIKSVDNEKNEDG
FEN1_CRYMR       TKIIETKEDKLDFERRNKIIQEDKLNSKKEFDYNEKLQCNSTAENTPIIDNKAKVLSIK-
FEN1_CRYPI       SKNLSSQAEKDLAENSSEAPNQSSEIKVNKIEENKDSE-SSTVENTPSLQTKSPEPTMRP
FEN1_GIAIC       SNPEVTKTKVKQ------------------------------------------------
FEN1_THEAN       ENKVKIENEENDTGRRDS----------IDDLFKEFE-----------------------
FEN1_THEPA       SNS---DNEEDDRGRVDK----------NEDLFKKSE-----------------------
FEN1_BABBO       EDTSEPPSEEPDAKKRNKRVPIEVDDSLVPDNLKRFICVQHYDPRVTIKRTGASELGSDS
FEN_HALMA        ------------------------------------------------------------
FEN_NATPD        ------------------------------------------------------------
FEN_HALWD        ------------------------------------------------------------
FEN_HALSA        ------------------------------------------------------------
FEN_HALS3        ------------------------------------------------------------
                                                                             

FEN_HYPBU        ------------------------------------------------------------
FEN_STAMF        ------------------------------------------------------------
FEN_AERPE        ------------------------------------------------------------
FEN_THEPD        ------------------------------------------------------------
FEN_IGNH4        ------------------------------------------------------------
FEN_PYRAB        ------------------------------------------------------------
FEN_PYRHO        ------------------------------------------------------------
FEN_PYRFU        ------------------------------------------------------------
FEN_THEKO        ------------------------------------------------------------
FEN_THEON        ------------------------------------------------------------
FEN_THEGJ        ------------------------------------------------------------
FEN_THESM        ------------------------------------------------------------
FEN_KORCO        ------------------------------------------------------------
FEN_METAC        ------------------------------------------------------------
FEN_METBF        ------------------------------------------------------------
FEN_METMA        ------------------------------------------------------------
FEN_METBU        ------------------------------------------------------------
FEN_METAR        ------------------------------------------------------------
FEN_METTP        ------------------------------------------------------------
FEN_ARCFU        ------------------------------------------------------------
FEN_SACS2        ------------------------------------------------------------
FEN_SULTO        ------------------------------------------------------------
FEN_SULAC        ------------------------------------------------------------
FEN_NANEQ        ------------------------------------------------------------
FEN_PYRAE        ------------------------------------------------------------
FEN_PYRAR        ------------------------------------------------------------
FEN_PYRIL        ------------------------------------------------------------
FEN_PYRNV        ------------------------------------------------------------
FEN_PYRCJ        ------------------------------------------------------------
FEN_CALMQ        ------------------------------------------------------------
FEN_METKA        ------------------------------------------------------------
FEN_CENSY        ------------------------------------------------------------
FEN_NITMS        ------------------------------------------------------------
FEN_METTH        ------------------------------------------------------------
FEN_METS3        ------------------------------------------------------------
FEN_METST        ------------------------------------------------------------
FEN_METMJ        ------------------------------------------------------------
FEN_METB6        ------------------------------------------------------------
FEN_METPE        ------------------------------------------------------------
FEN_METHJ        ------------------------------------------------------------
FEN_METLZ        ------------------------------------------------------------
FEN_THEAC        ------------------------------------------------------------
FEN_THEVO        ------------------------------------------------------------
FEN_PICTO        ------------------------------------------------------------
FEN_METJA        ------------------------------------------------------------
FEN_META3        ------------------------------------------------------------
FEN1_LEIIN       ------------------------------------------------------------
FEN1_LEIMA       ------------------------------------------------------------
FEN1_LEIBR       ------------------------------------------------------------
FEN1_TRYB2       ------------------------------------------------------------
FEN1_TRYB9       ------------------------------------------------------------
FEN1_TRYCC       ------------------------------------------------------------
FEN1_ARATH       ------------------------------------------------------------
FEN1_SOYBN       ------------------------------------------------------------
FEN11_ORYSI      ------------------------------------------------------------
FEN11_ORYSJ      ------------------------------------------------------------
FEN11_SORBI      ------------------------------------------------------------
FEN1_MAIZE       ------------------------------------------------------------
FEN11_PHYPA      ------------------------------------------------------------
FEN1_OSTLU       ------------------------------------------------------------
FEN1_OSTTA       ------------------------------------------------------------
FEN1_MICCC       ------------------------------------------------------------
FEN1_CHLRE       ------------------------------------------------------------
FEN1_NAEGR       ------------------------------------------------------------
FEN1_BOVIN       ------------------------------------------------------------
FEN1_SHEEP       ------------------------------------------------------------
FEN1_HUMAN       ------------------------------------------------------------
FEN1_MACFA       ------------------------------------------------------------
FEN1_MOUSE       ------------------------------------------------------------
FEN1_RAT         ------------------------------------------------------------
FEN1_CHICK       ------------------------------------------------------------
FEN1A_XENLA      ------------------------------------------------------------
FEN1B_XENLA      ------------------------------------------------------------
FEN1_XENTR       ------------------------------------------------------------
FEN1_ANOFI       ------------------------------------------------------------
FEN1_XIPMA       ------------------------------------------------------------
FEN1_SALSA       ------------------------------------------------------------
FEN1_OSMMO       ------------------------------------------------------------
FEN1A_DANRE      ------------------------------------------------------------
FEN1_BRAFL       ------------------------------------------------------------
FEN1_NEMVE       ------------------------------------------------------------
FEN1_TRIAD       ------------------------------------------------------------
FEN1_AEDAE       ------------------------------------------------------------
FEN1_ANOGA       ------------------------------------------------------------
FEN1_GLOMM       ------------------------------------------------------------
FEN1_DROER       ------------------------------------------------------------
FEN1_DROYA       ------------------------------------------------------------
FEN1_DROSE       ------------------------------------------------------------
FEN1_DROSI       ------------------------------------------------------------
FEN1_DROME       ------------------------------------------------------------
FEN1_DROPE       ------------------------------------------------------------
FEN1_DROPS       ------------------------------------------------------------
FEN1_DROAN       ------------------------------------------------------------
FEN1_DROWI       ------------------------------------------------------------
FEN1_DROGR       ------------------------------------------------------------
FEN1_DROMO       ------------------------------------------------------------
FEN1_DROVI       ------------------------------------------------------------
FEN1_MONBE       ------------------------------------------------------------
FEN1_CAEBR       ------------------------------------------------------------
FEN1_CAEEL       ------------------------------------------------------------
FEN1_BRUMA       ------------------------------------------------------------
FEN1_AJECH       ------------------------------------------------------------
FEN1_AJECN       ------------------------------------------------------------
FEN1_AJEDR       ------------------------------------------------------------
FEN1_UNCRE       ------------------------------------------------------------
FEN1_ASPFU       ------------------------------------------------------------
FEN1_ASPFC       ------------------------------------------------------------
FEN1_NEOFI       ------------------------------------------------------------
FEN1_ASPCL       ------------------------------------------------------------
FEN1_ASPFN       ------------------------------------------------------------
FEN1_ASPTN       ------------------------------------------------------------
FEN1_EMENI       ------------------------------------------------------------
FEN1_ASPNC       ------------------------------------------------------------
FEN1_PENRW       ------------------------------------------------------------
FEN1_TALMQ       ------------------------------------------------------------
FEN1_TALSN       ------------------------------------------------------------
FEN1_ARTOC       ------------------------------------------------------------
FEN1_PHANO       ------------------------------------------------------------
FEN1_PYRTR       ------------------------------------------------------------
FEN1_NEUCR       ------------------------------------------------------------
FEN1_SORMK       ------------------------------------------------------------
FEN1_FUSV7       ------------------------------------------------------------
FEN1_MAGO7       ------------------------------------------------------------
FEN1_COPCI       ------------------------------------------------------------
FEN1_COPC7       ------------------------------------------------------------
FEN11_LACBS      ------------------------------------------------------------
FEN12_LACBS      ------------------------------------------------------------
FEN1_CRYNJ       ------------------------------------------------------------
FEN1_USTMA       ------------------------------------------------------------
FEN1_SCHJY       ------------------------------------------------------------
FEN1_SCHPO       ------------------------------------------------------------
FEN1_ASHGO       ------------------------------------------------------------
FEN1_KLULA       ------------------------------------------------------------
FEN1_YEAST       ------------------------------------------------------------
FEN1_YEAS7       ------------------------------------------------------------
FEN1_YEAS2       ------------------------------------------------------------
FEN1_YEAS8       ------------------------------------------------------------
FEN1_YEAS1       ------------------------------------------------------------
FEN1_VANPO       ------------------------------------------------------------
FEN1_CANGA       ------------------------------------------------------------
FEN1_ZYGRC       ------------------------------------------------------------
FEN1_LACTC       ------------------------------------------------------------
FEN1_CANAW       ------------------------------------------------------------
FEN1_CANAL       ------------------------------------------------------------
FEN1_CANDC       ------------------------------------------------------------
FEN1_CANTT       ------------------------------------------------------------
FEN1_LODEL       ------------------------------------------------------------
FEN1_PICST       ------------------------------------------------------------
FEN1_CLAL4       ------------------------------------------------------------
FEN1_PICGU       ------------------------------------------------------------
FEN1_DEBHA       ------------------------------------------------------------
FEN1_KOMPG       ------------------------------------------------------------
FEN1_YARLI       ------------------------------------------------------------
FEN1_DICDI       ------------------------------------------------------------
FEN1_POLPP       ------------------------------------------------------------
FEN11_PARTE      ------------------------------------------------------------
FEN12_PARTE      ------------------------------------------------------------
FEN1_TETTS       ------------------------------------------------------------
FEN1_PHATC       ------------------------------------------------------------
FEN1_THAPS       ------------------------------------------------------------
FEN1_PHYIT       ------------------------------------------------------------
FEN1_ENTDS       ------------------------------------------------------------
FEN1_ENTHI       ------------------------------------------------------------
FEN1_ENCCU       ------------------------------------------------------------
FEN1_ENTBH       ------------------------------------------------------------
FEN1_PLABA       -------------ENLVKDE-DDQDDY------------------------------DQN
FEN1_PLAYO       -------------ENLVKDEEDDQDDY------------------------------DQN
FEN1_PLACH       -------------ENFVKDEENDQDDY------------------------------DQN
FEN1_PLAKH       EEEGGEGETADMGAKDPFDTEEDEDNP------------------------------SVN
FEN1_PLAVS       EDE----ETPGMGARDPFDTDDEEDNP------------------------------SPN
FEN1_PLAFA       IKSVDD-EKNLDDEKNLDDEKNKDDEK------------------------KSLDNFSSN
FEN1_PLAF7       IKSVDD-EKNLDDEKNLDDEKNKDDEKNKDDEKNKDDEKNKDDEKNKDDEKKSLDNFSSN
FEN1_CRYMR       -KRRINRVNYDE------------------------------------------------
FEN1_CRYPI       VKRKLNRLISESDED---------------------------------------------
FEN1_GIAIC       ------------------------------------------------------------
FEN1_THEAN       -------------------------------------DETNLFEQDEFEPKSKE-YNLEK
FEN1_THEPA       -------------------------------------NETNEIKQNQFKSKSDEKKKQEE
FEN1_BABBO       VDSLVSHICGVYGIQSGTPDNDLSVVGEGILWPNPILQRFRSVTKDLPNSRLHELWRCSS
FEN_HALMA        ------------------------------------------------------------
FEN_NATPD        ------------------------------------------------------------
FEN_HALWD        ------------------------------------------------------------
FEN_HALSA        ------------------------------------------------------------
FEN_HALS3        ------------------------------------------------------------
                                                                             

FEN_HYPBU        ------------------------------------------------------------
FEN_STAMF        ------------------------------------------------------------
FEN_AERPE        ------------------------------------------------------------
FEN_THEPD        ------------------------------------------------------------
FEN_IGNH4        ------------------------------------------------------------
FEN_PYRAB        ------------------------------------------------------------
FEN_PYRHO        ------------------------------------------------------------
FEN_PYRFU        ------------------------------------------------------------
FEN_THEKO        ------------------------------------------------------------
FEN_THEON        ------------------------------------------------------------
FEN_THEGJ        ------------------------------------------------------------
FEN_THESM        ------------------------------------------------------------
FEN_KORCO        ------------------------------------------------------------
FEN_METAC        ------------------------------------------------------------
FEN_METBF        ------------------------------------------------------------
FEN_METMA        ------------------------------------------------------------
FEN_METBU        ------------------------------------------------------------
FEN_METAR        ------------------------------------------------------------
FEN_METTP        ------------------------------------------------------------
FEN_ARCFU        ------------------------------------------------------------
FEN_SACS2        ------------------------------------------------------------
FEN_SULTO        ------------------------------------------------------------
FEN_SULAC        ------------------------------------------------------------
FEN_NANEQ        ------------------------------------------------------------
FEN_PYRAE        ------------------------------------------------------------
FEN_PYRAR        ------------------------------------------------------------
FEN_PYRIL        ------------------------------------------------------------
FEN_PYRNV        ------------------------------------------------------------
FEN_PYRCJ        ------------------------------------------------------------
FEN_CALMQ        ------------------------------------------------------------
FEN_METKA        ------------------------------------------------------------
FEN_CENSY        ------------------------------------------------------------
FEN_NITMS        ------------------------------------------------------------
FEN_METTH        ------------------------------------------------------------
FEN_METS3        ------------------------------------------------------------
FEN_METST        ------------------------------------------------------------
FEN_METMJ        ------------------------------------------------------------
FEN_METB6        ------------------------------------------------------------
FEN_METPE        ------------------------------------------------------------
FEN_METHJ        ------------------------------------------------------------
FEN_METLZ        ------------------------------------------------------------
FEN_THEAC        ------------------------------------------------------------
FEN_THEVO        ------------------------------------------------------------
FEN_PICTO        ------------------------------------------------------------
FEN_METJA        ------------------------------------------------------------
FEN_META3        ------------------------------------------------------------
FEN1_LEIIN       ------------------------------------------------------------
FEN1_LEIMA       ------------------------------------------------------------
FEN1_LEIBR       ------------------------------------------------------------
FEN1_TRYB2       ------------------------------------------------------------
FEN1_TRYB9       ------------------------------------------------------------
FEN1_TRYCC       ------------------------------------------------------------
FEN1_ARATH       ------------------------------------------------------------
FEN1_SOYBN       ------------------------------------------------------------
FEN11_ORYSI      ------------------------------------------------------------
FEN11_ORYSJ      ------------------------------------------------------------
FEN11_SORBI      ------------------------------------------------------------
FEN1_MAIZE       ------------------------------------------------------------
FEN11_PHYPA      ------------------------------------------------------------
FEN1_OSTLU       ------------------------------------------------------------
FEN1_OSTTA       ------------------------------------------------------------
FEN1_MICCC       ------------------------------------------------------------
FEN1_CHLRE       ------------------------------------------------------------
FEN1_NAEGR       ------------------------------------------------------------
FEN1_BOVIN       ------------------------------------------------------------
FEN1_SHEEP       ------------------------------------------------------------
FEN1_HUMAN       ------------------------------------------------------------
FEN1_MACFA       ------------------------------------------------------------
FEN1_MOUSE       ------------------------------------------------------------
FEN1_RAT         ------------------------------------------------------------
FEN1_CHICK       ------------------------------------------------------------
FEN1A_XENLA      ------------------------------------------------------------
FEN1B_XENLA      ------------------------------------------------------------
FEN1_XENTR       ------------------------------------------------------------
FEN1_ANOFI       ------------------------------------------------------------
FEN1_XIPMA       ------------------------------------------------------------
FEN1_SALSA       ------------------------------------------------------------
FEN1_OSMMO       ------------------------------------------------------------
FEN1A_DANRE      ------------------------------------------------------------
FEN1_BRAFL       ------------------------------------------------------------
FEN1_NEMVE       ------------------------------------------------------------
FEN1_TRIAD       ------------------------------------------------------------
FEN1_AEDAE       ------------------------------------------------------------
FEN1_ANOGA       ------------------------------------------------------------
FEN1_GLOMM       ------------------------------------------------------------
FEN1_DROER       ------------------------------------------------------------
FEN1_DROYA       ------------------------------------------------------------
FEN1_DROSE       ------------------------------------------------------------
FEN1_DROSI       ------------------------------------------------------------
FEN1_DROME       ------------------------------------------------------------
FEN1_DROPE       ------------------------------------------------------------
FEN1_DROPS       ------------------------------------------------------------
FEN1_DROAN       ------------------------------------------------------------
FEN1_DROWI       ------------------------------------------------------------
FEN1_DROGR       ------------------------------------------------------------
FEN1_DROMO       ------------------------------------------------------------
FEN1_DROVI       ------------------------------------------------------------
FEN1_MONBE       ------------------------------------------------------------
FEN1_CAEBR       ------------------------------------------------------------
FEN1_CAEEL       ------------------------------------------------------------
FEN1_BRUMA       ------------------------------------------------------------
FEN1_AJECH       ------------------------------------------------------------
FEN1_AJECN       ------------------------------------------------------------
FEN1_AJEDR       ------------------------------------------------------------
FEN1_UNCRE       ------------------------------------------------------------
FEN1_ASPFU       ------------------------------------------------------------
FEN1_ASPFC       ------------------------------------------------------------
FEN1_NEOFI       ------------------------------------------------------------
FEN1_ASPCL       ------------------------------------------------------------
FEN1_ASPFN       ------------------------------------------------------------
FEN1_ASPTN       ------------------------------------------------------------
FEN1_EMENI       ------------------------------------------------------------
FEN1_ASPNC       ------------------------------------------------------------
FEN1_PENRW       ------------------------------------------------------------
FEN1_TALMQ       ------------------------------------------------------------
FEN1_TALSN       ------------------------------------------------------------
FEN1_ARTOC       ------------------------------------------------------------
FEN1_PHANO       ------------------------------------------------------------
FEN1_PYRTR       ------------------------------------------------------------
FEN1_NEUCR       ------------------------------------------------------------
FEN1_SORMK       ------------------------------------------------------------
FEN1_FUSV7       ------------------------------------------------------------
FEN1_MAGO7       ------------------------------------------------------------
FEN1_COPCI       ------------------------------------------------------------
FEN1_COPC7       ------------------------------------------------------------
FEN11_LACBS      ------------------------------------------------------------
FEN12_LACBS      ------------------------------------------------------------
FEN1_CRYNJ       ------------------------------------------------------------
FEN1_USTMA       ------------------------------------------------------------
FEN1_SCHJY       ------------------------------------------------------------
FEN1_SCHPO       ------------------------------------------------------------
FEN1_ASHGO       ------------------------------------------------------------
FEN1_KLULA       ------------------------------------------------------------
FEN1_YEAST       ------------------------------------------------------------
FEN1_YEAS7       ------------------------------------------------------------
FEN1_YEAS2       ------------------------------------------------------------
FEN1_YEAS8       ------------------------------------------------------------
FEN1_YEAS1       ------------------------------------------------------------
FEN1_VANPO       ------------------------------------------------------------
FEN1_CANGA       ------------------------------------------------------------
FEN1_ZYGRC       ------------------------------------------------------------
FEN1_LACTC       ------------------------------------------------------------
FEN1_CANAW       ------------------------------------------------------------
FEN1_CANAL       ------------------------------------------------------------
FEN1_CANDC       ------------------------------------------------------------
FEN1_CANTT       ------------------------------------------------------------
FEN1_LODEL       ------------------------------------------------------------
FEN1_PICST       ------------------------------------------------------------
FEN1_CLAL4       ------------------------------------------------------------
FEN1_PICGU       ------------------------------------------------------------
FEN1_DEBHA       ------------------------------------------------------------
FEN1_KOMPG       ------------------------------------------------------------
FEN1_YARLI       ------------------------------------------------------------
FEN1_DICDI       ------------------------------------------------------------
FEN1_POLPP       ------------------------------------------------------------
FEN11_PARTE      ------------------------------------------------------------
FEN12_PARTE      ------------------------------------------------------------
FEN1_TETTS       ------------------------------------------------------------
FEN1_PHATC       ------------------------------------------------------------
FEN1_THAPS       ------------------------------------------------------------
FEN1_PHYIT       ------------------------------------------------------------
FEN1_ENTDS       ------------------------------------------------------------
FEN1_ENTHI       ------------------------------------------------------------
FEN1_ENCCU       ------------------------------------------------------------
FEN1_ENTBH       ------------------------------------------------------------
FEN1_PLABA       IFDERTNSESGN-IKNENVKED--------------------------------------
FEN1_PLAYO       IFDEKTNSESGN-IKNENVKED--------------------------------------
FEN1_PLACH       LFDEKTNSDSGN-IKNENIKED--------------------------------------
FEN1_PLAKH       FFHHKSDSESGN-VKKESTEQEA-------------------------------NATPTG
FEN1_PLAVS       FFHQKSDSESGN-VKKEKTEQEG-------------------------------NATTAG
FEN1_PLAFA       LFDSDKESESGNIIKNEKQNMDDEKINDNLPSLFGDHSRIRHTENKDNISDINNNNNNNN
FEN1_PLAF7       LFDSDKESESGNIIKNEKQNMDDEKINDNLPSLFGDHSRIRHTENKDNISDINNNNNNNN
FEN1_CRYMR       ------------------------------------------------------------
FEN1_CRYPI       ------------------------------------------------------------
FEN1_GIAIC       ------------------------------------------------------------
FEN1_THEAN       QHELELNVHNRNVILIDDDDD--------------EVLTTANSEKMNCEIGKVKEEPNKK
FEN1_THEPA       HHTIEFNFNHRKVILIDDDDD--------------EVVTTANSEKMNCGKCLIYYFLQKL
FEN1_BABBO       SHGISWDALDKLYINFREARDSSVEEWDKYAPEIVDFASKVARDKITQWLDGSTSCPPRL
FEN_HALMA        ------------------------------------------------------------
FEN_NATPD        ------------------------------------------------------------
FEN_HALWD        ------------------------------------------------------------
FEN_HALSA        ------------------------------------------------------------
FEN_HALS3        ------------------------------------------------------------
                                                                             

FEN_HYPBU        ------------------------------------------------------------
FEN_STAMF        ------------------------------------------------------------
FEN_AERPE        ------------------------------------------------------------
FEN_THEPD        ------------------------------------------------------------
FEN_IGNH4        ------------------------------------------------------------
FEN_PYRAB        ------------------------------------------------------------
FEN_PYRHO        ------------------------------------------------------------
FEN_PYRFU        ------------------------------------------------------------
FEN_THEKO        ------------------------------------------------------------
FEN_THEON        ------------------------------------------------------------
FEN_THEGJ        ------------------------------------------------------------
FEN_THESM        ------------------------------------------------------------
FEN_KORCO        ------------------------------------------------------------
FEN_METAC        ------------------------------------------------------------
FEN_METBF        ------------------------------------------------------------
FEN_METMA        ------------------------------------------------------------
FEN_METBU        ------------------------------------------------------------
FEN_METAR        ------------------------------------------------------------
FEN_METTP        ------------------------------------------------------------
FEN_ARCFU        ------------------------------------------------------------
FEN_SACS2        ------------------------------------------------------------
FEN_SULTO        ------------------------------------------------------------
FEN_SULAC        ------------------------------------------------------------
FEN_NANEQ        ------------------------------------------------------------
FEN_PYRAE        ------------------------------------------------------------
FEN_PYRAR        ------------------------------------------------------------
FEN_PYRIL        ------------------------------------------------------------
FEN_PYRNV        ------------------------------------------------------------
FEN_PYRCJ        ------------------------------------------------------------
FEN_CALMQ        ------------------------------------------------------------
FEN_METKA        ------------------------------------------------------------
FEN_CENSY        ------------------------------------------------------------
FEN_NITMS        ------------------------------------------------------------
FEN_METTH        ------------------------------------------------------------
FEN_METS3        ------------------------------------------------------------
FEN_METST        ------------------------------------------------------------
FEN_METMJ        ------------------------------------------------------------
FEN_METB6        ------------------------------------------------------------
FEN_METPE        ------------------------------------------------------------
FEN_METHJ        ------------------------------------------------------------
FEN_METLZ        ------------------------------------------------------------
FEN_THEAC        ------------------------------------------------------------
FEN_THEVO        ------------------------------------------------------------
FEN_PICTO        ------------------------------------------------------------
FEN_METJA        ------------------------------------------------------------
FEN_META3        ------------------------------------------------------------
FEN1_LEIIN       ------------------------------------------------------------
FEN1_LEIMA       ------------------------------------------------------------
FEN1_LEIBR       ------------------------------------------------------------
FEN1_TRYB2       ------------------------------------------------------------
FEN1_TRYB9       ------------------------------------------------------------
FEN1_TRYCC       ------------------------------------------------------------
FEN1_ARATH       ------------------------------------------------------------
FEN1_SOYBN       ------------------------------------------------------------
FEN11_ORYSI      ------------------------------------------------------------
FEN11_ORYSJ      ------------------------------------------------------------
FEN11_SORBI      ------------------------------------------------------------
FEN1_MAIZE       ------------------------------------------------------------
FEN11_PHYPA      ------------------------------------------------------------
FEN1_OSTLU       ------------------------------------------------------------
FEN1_OSTTA       ------------------------------------------------------------
FEN1_MICCC       ------------------------------------------------------------
FEN1_CHLRE       ------------------------------------------------------------
FEN1_NAEGR       ------------------------------------------------------------
FEN1_BOVIN       ------------------------------------------------------------
FEN1_SHEEP       ------------------------------------------------------------
FEN1_HUMAN       ------------------------------------------------------------
FEN1_MACFA       ------------------------------------------------------------
FEN1_MOUSE       ------------------------------------------------------------
FEN1_RAT         ------------------------------------------------------------
FEN1_CHICK       ------------------------------------------------------------
FEN1A_XENLA      ------------------------------------------------------------
FEN1B_XENLA      ------------------------------------------------------------
FEN1_XENTR       ------------------------------------------------------------
FEN1_ANOFI       ------------------------------------------------------------
FEN1_XIPMA       ------------------------------------------------------------
FEN1_SALSA       ------------------------------------------------------------
FEN1_OSMMO       ------------------------------------------------------------
FEN1A_DANRE      ------------------------------------------------------------
FEN1_BRAFL       ------------------------------------------------------------
FEN1_NEMVE       ------------------------------------------------------------
FEN1_TRIAD       ------------------------------------------------------------
FEN1_AEDAE       ------------------------------------------------------------
FEN1_ANOGA       ------------------------------------------------------------
FEN1_GLOMM       ------------------------------------------------------------
FEN1_DROER       ------------------------------------------------------------
FEN1_DROYA       ------------------------------------------------------------
FEN1_DROSE       ------------------------------------------------------------
FEN1_DROSI       ------------------------------------------------------------
FEN1_DROME       ------------------------------------------------------------
FEN1_DROPE       ------------------------------------------------------------
FEN1_DROPS       ------------------------------------------------------------
FEN1_DROAN       ------------------------------------------------------------
FEN1_DROWI       ------------------------------------------------------------
FEN1_DROGR       ------------------------------------------------------------
FEN1_DROMO       ------------------------------------------------------------
FEN1_DROVI       ------------------------------------------------------------
FEN1_MONBE       ------------------------------------------------------------
FEN1_CAEBR       ------------------------------------------------------------
FEN1_CAEEL       ------------------------------------------------------------
FEN1_BRUMA       ------------------------------------------------------------
FEN1_AJECH       ------------------------------------------------------------
FEN1_AJECN       ------------------------------------------------------------
FEN1_AJEDR       ------------------------------------------------------------
FEN1_UNCRE       ------------------------------------------------------------
FEN1_ASPFU       ------------------------------------------------------------
FEN1_ASPFC       ------------------------------------------------------------
FEN1_NEOFI       ------------------------------------------------------------
FEN1_ASPCL       ------------------------------------------------------------
FEN1_ASPFN       ------------------------------------------------------------
FEN1_ASPTN       ------------------------------------------------------------
FEN1_EMENI       ------------------------------------------------------------
FEN1_ASPNC       ------------------------------------------------------------
FEN1_PENRW       ------------------------------------------------------------
FEN1_TALMQ       ------------------------------------------------------------
FEN1_TALSN       ------------------------------------------------------------
FEN1_ARTOC       ------------------------------------------------------------
FEN1_PHANO       ------------------------------------------------------------
FEN1_PYRTR       ------------------------------------------------------------
FEN1_NEUCR       ------------------------------------------------------------
FEN1_SORMK       ------------------------------------------------------------
FEN1_FUSV7       ------------------------------------------------------------
FEN1_MAGO7       ------------------------------------------------------------
FEN1_COPCI       ------------------------------------------------------------
FEN1_COPC7       ------------------------------------------------------------
FEN11_LACBS      ------------------------------------------------------------
FEN12_LACBS      ------------------------------------------------------------
FEN1_CRYNJ       ------------------------------------------------------------
FEN1_USTMA       ------------------------------------------------------------
FEN1_SCHJY       ------------------------------------------------------------
FEN1_SCHPO       ------------------------------------------------------------
FEN1_ASHGO       ------------------------------------------------------------
FEN1_KLULA       ------------------------------------------------------------
FEN1_YEAST       ------------------------------------------------------------
FEN1_YEAS7       ------------------------------------------------------------
FEN1_YEAS2       ------------------------------------------------------------
FEN1_YEAS8       ------------------------------------------------------------
FEN1_YEAS1       ------------------------------------------------------------
FEN1_VANPO       ------------------------------------------------------------
FEN1_CANGA       ------------------------------------------------------------
FEN1_ZYGRC       ------------------------------------------------------------
FEN1_LACTC       ------------------------------------------------------------
FEN1_CANAW       ------------------------------------------------------------
FEN1_CANAL       ------------------------------------------------------------
FEN1_CANDC       ------------------------------------------------------------
FEN1_CANTT       ------------------------------------------------------------
FEN1_LODEL       ------------------------------------------------------------
FEN1_PICST       ------------------------------------------------------------
FEN1_CLAL4       ------------------------------------------------------------
FEN1_PICGU       ------------------------------------------------------------
FEN1_DEBHA       ------------------------------------------------------------
FEN1_KOMPG       ------------------------------------------------------------
FEN1_YARLI       ------------------------------------------------------------
FEN1_DICDI       ------------------------------------------------------------
FEN1_POLPP       ------------------------------------------------------------
FEN11_PARTE      ------------------------------------------------------------
FEN12_PARTE      ------------------------------------------------------------
FEN1_TETTS       ------------------------------------------------------------
FEN1_PHATC       ------------------------------------------------------------
FEN1_THAPS       ------------------------------------------------------------
FEN1_PHYIT       ------------------------------------------------------------
FEN1_ENTDS       ------------------------------------------------------------
FEN1_ENTHI       ------------------------------------------------------------
FEN1_ENCCU       ------------------------------------------------------------
FEN1_ENTBH       ------------------------------------------------------------
FEN1_PLABA       -----------------ISSS---------------------------------------
FEN1_PLAYO       -----------------VSSN---------------------------------------
FEN1_PLACH       -----------------ISSN---------------------------------------
FEN1_PLAKH       DVYSFPNGKDASGSNIHLSSNSTLHSCNNLNGDKAINESMHVVGSSAPEAGNNEIG----
FEN1_PLAVS       DVYNYPNGKDTAGSNTHLSSNSTLHSCNNVGSEKAPNEGMHTVGSSAPEAGTNHVGINHV
FEN1_PLAFA       NNSSSNNNNISNNHFNSVSSNSTFNSSTKLKSEDTLKSNSPLKEDSPNSYNNIKNN----
FEN1_PLAF7       --SSSNNNNISNNHFNSVSSNSTFNSSTKLKSEDTLKSNSPLKEDSPNSYNNIKNN----
FEN1_CRYMR       ------------------------------------------------------------
FEN1_CRYPI       ------------------------------------------------------------
FEN1_GIAIC       ------------------------------------------------------------
FEN1_THEAN       GKFSLISIYIF-------------------------------------------------
FEN1_THEPA       IK----------------------------------------------------------
FEN1_BABBO       LRRWTHLLYSRWRERYLHVYGPRMLSRYLKGEVTDRVLVREINECLPAGVECSELPLDTE
FEN_HALMA        ------------------------------------------------------------
FEN_NATPD        ------------------------------------------------------------
FEN_HALWD        ------------------------------------------------------------
FEN_HALSA        ------------------------------------------------------------
FEN_HALS3        ------------------------------------------------------------
                                                                             

FEN_HYPBU        ------------------------------------------------------------
FEN_STAMF        ------------------------------------------------------------
FEN_AERPE        ------------------------------------------------------------
FEN_THEPD        ------------------------------------------------------------
FEN_IGNH4        ------------------------------------------------------------
FEN_PYRAB        ------------------------------------------------------------
FEN_PYRHO        ------------------------------------------------------------
FEN_PYRFU        ------------------------------------------------------------
FEN_THEKO        ------------------------------------------------------------
FEN_THEON        ------------------------------------------------------------
FEN_THEGJ        ------------------------------------------------------------
FEN_THESM        ------------------------------------------------------------
FEN_KORCO        ------------------------------------------------------------
FEN_METAC        ------------------------------------------------------------
FEN_METBF        ------------------------------------------------------------
FEN_METMA        ------------------------------------------------------------
FEN_METBU        ------------------------------------------------------------
FEN_METAR        ------------------------------------------------------------
FEN_METTP        ------------------------------------------------------------
FEN_ARCFU        ------------------------------------------------------------
FEN_SACS2        ------------------------------------------------------------
FEN_SULTO        ------------------------------------------------------------
FEN_SULAC        ------------------------------------------------------------
FEN_NANEQ        ------------------------------------------------------------
FEN_PYRAE        ------------------------------------------------------------
FEN_PYRAR        ------------------------------------------------------------
FEN_PYRIL        ------------------------------------------------------------
FEN_PYRNV        ------------------------------------------------------------
FEN_PYRCJ        ------------------------------------------------------------
FEN_CALMQ        ------------------------------------------------------------
FEN_METKA        ------------------------------------------------------------
FEN_CENSY        ------------------------------------------------------------
FEN_NITMS        ------------------------------------------------------------
FEN_METTH        ------------------------------------------------------------
FEN_METS3        ------------------------------------------------------------
FEN_METST        ------------------------------------------------------------
FEN_METMJ        ------------------------------------------------------------
FEN_METB6        ------------------------------------------------------------
FEN_METPE        ------------------------------------------------------------
FEN_METHJ        ------------------------------------------------------------
FEN_METLZ        ------------------------------------------------------------
FEN_THEAC        ------------------------------------------------------------
FEN_THEVO        ------------------------------------------------------------
FEN_PICTO        ------------------------------------------------------------
FEN_METJA        ------------------------------------------------------------
FEN_META3        ------------------------------------------------------------
FEN1_LEIIN       ------------------------------------------------------------
FEN1_LEIMA       ------------------------------------------------------------
FEN1_LEIBR       ------------------------------------------------------------
FEN1_TRYB2       ------------------------------------------------------------
FEN1_TRYB9       ------------------------------------------------------------
FEN1_TRYCC       ------------------------------------------------------------
FEN1_ARATH       ------------------------------------------------------------
FEN1_SOYBN       ------------------------------------------------------------
FEN11_ORYSI      ------------------------------------------------------------
FEN11_ORYSJ      ------------------------------------------------------------
FEN11_SORBI      ------------------------------------------------------------
FEN1_MAIZE       ------------------------------------------------------------
FEN11_PHYPA      ------------------------------------------------------------
FEN1_OSTLU       ------------------------------------------------------------
FEN1_OSTTA       ------------------------------------------------------------
FEN1_MICCC       ------------------------------------------------------------
FEN1_CHLRE       ------------------------------------------------------------
FEN1_NAEGR       ------------------------------------------------------------
FEN1_BOVIN       ------------------------------------------------------------
FEN1_SHEEP       ------------------------------------------------------------
FEN1_HUMAN       ------------------------------------------------------------
FEN1_MACFA       ------------------------------------------------------------
FEN1_MOUSE       ------------------------------------------------------------
FEN1_RAT         ------------------------------------------------------------
FEN1_CHICK       ------------------------------------------------------------
FEN1A_XENLA      ------------------------------------------------------------
FEN1B_XENLA      ------------------------------------------------------------
FEN1_XENTR       ------------------------------------------------------------
FEN1_ANOFI       ------------------------------------------------------------
FEN1_XIPMA       ------------------------------------------------------------
FEN1_SALSA       ------------------------------------------------------------
FEN1_OSMMO       ------------------------------------------------------------
FEN1A_DANRE      ------------------------------------------------------------
FEN1_BRAFL       ------------------------------------------------------------
FEN1_NEMVE       ------------------------------------------------------------
FEN1_TRIAD       ------------------------------------------------------------
FEN1_AEDAE       ------------------------------------------------------------
FEN1_ANOGA       ------------------------------------------------------------
FEN1_GLOMM       ------------------------------------------------------------
FEN1_DROER       ------------------------------------------------------------
FEN1_DROYA       ------------------------------------------------------------
FEN1_DROSE       ------------------------------------------------------------
FEN1_DROSI       ------------------------------------------------------------
FEN1_DROME       ------------------------------------------------------------
FEN1_DROPE       ------------------------------------------------------------
FEN1_DROPS       ------------------------------------------------------------
FEN1_DROAN       ------------------------------------------------------------
FEN1_DROWI       ------------------------------------------------------------
FEN1_DROGR       ------------------------------------------------------------
FEN1_DROMO       ------------------------------------------------------------
FEN1_DROVI       ------------------------------------------------------------
FEN1_MONBE       ------------------------------------------------------------
FEN1_CAEBR       ------------------------------------------------------------
FEN1_CAEEL       ------------------------------------------------------------
FEN1_BRUMA       ------------------------------------------------------------
FEN1_AJECH       ------------------------------------------------------------
FEN1_AJECN       ------------------------------------------------------------
FEN1_AJEDR       ------------------------------------------------------------
FEN1_UNCRE       ------------------------------------------------------------
FEN1_ASPFU       ------------------------------------------------------------
FEN1_ASPFC       ------------------------------------------------------------
FEN1_NEOFI       ------------------------------------------------------------
FEN1_ASPCL       ------------------------------------------------------------
FEN1_ASPFN       ------------------------------------------------------------
FEN1_ASPTN       ------------------------------------------------------------
FEN1_EMENI       ------------------------------------------------------------
FEN1_ASPNC       ------------------------------------------------------------
FEN1_PENRW       ------------------------------------------------------------
FEN1_TALMQ       ------------------------------------------------------------
FEN1_TALSN       ------------------------------------------------------------
FEN1_ARTOC       ------------------------------------------------------------
FEN1_PHANO       ------------------------------------------------------------
FEN1_PYRTR       ------------------------------------------------------------
FEN1_NEUCR       ------------------------------------------------------------
FEN1_SORMK       ------------------------------------------------------------
FEN1_FUSV7       ------------------------------------------------------------
FEN1_MAGO7       ------------------------------------------------------------
FEN1_COPCI       ------------------------------------------------------------
FEN1_COPC7       ------------------------------------------------------------
FEN11_LACBS      ------------------------------------------------------------
FEN12_LACBS      ------------------------------------------------------------
FEN1_CRYNJ       ------------------------------------------------------------
FEN1_USTMA       ------------------------------------------------------------
FEN1_SCHJY       ------------------------------------------------------------
FEN1_SCHPO       ------------------------------------------------------------
FEN1_ASHGO       ------------------------------------------------------------
FEN1_KLULA       ------------------------------------------------------------
FEN1_YEAST       ------------------------------------------------------------
FEN1_YEAS7       ------------------------------------------------------------
FEN1_YEAS2       ------------------------------------------------------------
FEN1_YEAS8       ------------------------------------------------------------
FEN1_YEAS1       ------------------------------------------------------------
FEN1_VANPO       ------------------------------------------------------------
FEN1_CANGA       ------------------------------------------------------------
FEN1_ZYGRC       ------------------------------------------------------------
FEN1_LACTC       ------------------------------------------------------------
FEN1_CANAW       ------------------------------------------------------------
FEN1_CANAL       ------------------------------------------------------------
FEN1_CANDC       ------------------------------------------------------------
FEN1_CANTT       ------------------------------------------------------------
FEN1_LODEL       ------------------------------------------------------------
FEN1_PICST       ------------------------------------------------------------
FEN1_CLAL4       ------------------------------------------------------------
FEN1_PICGU       ------------------------------------------------------------
FEN1_DEBHA       ------------------------------------------------------------
FEN1_KOMPG       ------------------------------------------------------------
FEN1_YARLI       ------------------------------------------------------------
FEN1_DICDI       ------------------------------------------------------------
FEN1_POLPP       ------------------------------------------------------------
FEN11_PARTE      ------------------------------------------------------------
FEN12_PARTE      ------------------------------------------------------------
FEN1_TETTS       ------------------------------------------------------------
FEN1_PHATC       ------------------------------------------------------------
FEN1_THAPS       ------------------------------------------------------------
FEN1_PHYIT       ------------------------------------------------------------
FEN1_ENTDS       ------------------------------------------------------------
FEN1_ENTHI       ------------------------------------------------------------
FEN1_ENCCU       ------------------------------------------------------------
FEN1_ENTBH       ------------------------------------------------------------
FEN1_PLABA       --------------------------------------------------DITMDIPKCI
FEN1_PLAYO       --------------------------------------------------DITMDIPKCT
FEN1_PLACH       --------------------------------------------------DITMDIPKCT
FEN1_PLAKH       ---------------------NGDLFTSNAADCVNNNTDKTQAEIEMKKKNISFLLPYCP
FEN1_PLAVS       GTNHVGINHVGTNHVGTNHVGSGDLFPPNVADCANNNADKAQPE--MKKKNMLFLLPYCP
FEN1_PLAFA       ----------------NHTININSQINNHKEPISNNNLNNINNSTEIKKKNTLFLLPFCP
FEN1_PLAF7       ----------------NHTININSQINNHKEPISNNNLNNINNSTEIKKKNTLFLLPFCP
FEN1_CRYMR       ------------------------------------------------------------
FEN1_CRYPI       ------------------------------------------------------------
FEN1_GIAIC       ------------------------------------------------------------
FEN1_THEAN       ------------------------------------------------------------
FEN1_THEPA       ------------------------------------------------------------
FEN1_BABBO       PSEHNPHFVRRVPKSGS-------------------------------------------
FEN_HALMA        ------------------------------------------------------------
FEN_NATPD        ------------------------------------------------------------
FEN_HALWD        ------------------------------------------------------------
FEN_HALSA        ------------------------------------------------------------
FEN_HALS3        ------------------------------------------------------------
                                                                             

FEN_HYPBU        ---------------
FEN_STAMF        ---------------
FEN_AERPE        ---------------
FEN_THEPD        ---------------
FEN_IGNH4        ---------------
FEN_PYRAB        ---------------
FEN_PYRHO        ---------------
FEN_PYRFU        ---------------
FEN_THEKO        ---------------
FEN_THEON        ---------------
FEN_THEGJ        ---------------
FEN_THESM        ---------------
FEN_KORCO        ---------------
FEN_METAC        ---------------
FEN_METBF        ---------------
FEN_METMA        ---------------
FEN_METBU        ---------------
FEN_METAR        ---------------
FEN_METTP        ---------------
FEN_ARCFU        ---------------
FEN_SACS2        ---------------
FEN_SULTO        ---------------
FEN_SULAC        ---------------
FEN_NANEQ        ---------------
FEN_PYRAE        ---------------
FEN_PYRAR        ---------------
FEN_PYRIL        ---------------
FEN_PYRNV        ---------------
FEN_PYRCJ        ---------------
FEN_CALMQ        ---------------
FEN_METKA        ---------------
FEN_CENSY        ---------------
FEN_NITMS        ---------------
FEN_METTH        ---------------
FEN_METS3        ---------------
FEN_METST        ---------------
FEN_METMJ        ---------------
FEN_METB6        ---------------
FEN_METPE        ---------------
FEN_METHJ        ---------------
FEN_METLZ        ---------------
FEN_THEAC        ---------------
FEN_THEVO        ---------------
FEN_PICTO        ---------------
FEN_METJA        ---------------
FEN_META3        ---------------
FEN1_LEIIN       ---------------
FEN1_LEIMA       ---------------
FEN1_LEIBR       ---------------
FEN1_TRYB2       ---------------
FEN1_TRYB9       ---------------
FEN1_TRYCC       ---------------
FEN1_ARATH       ---------------
FEN1_SOYBN       ---------------
FEN11_ORYSI      ---------------
FEN11_ORYSJ      ---------------
FEN11_SORBI      ---------------
FEN1_MAIZE       ---------------
FEN11_PHYPA      ---------------
FEN1_OSTLU       ---------------
FEN1_OSTTA       ---------------
FEN1_MICCC       ---------------
FEN1_CHLRE       ---------------
FEN1_NAEGR       ---------------
FEN1_BOVIN       ---------------
FEN1_SHEEP       ---------------
FEN1_HUMAN       ---------------
FEN1_MACFA       ---------------
FEN1_MOUSE       ---------------
FEN1_RAT         ---------------
FEN1_CHICK       ---------------
FEN1A_XENLA      ---------------
FEN1B_XENLA      ---------------
FEN1_XENTR       ---------------
FEN1_ANOFI       ---------------
FEN1_XIPMA       ---------------
FEN1_SALSA       ---------------
FEN1_OSMMO       ---------------
FEN1A_DANRE      ---------------
FEN1_BRAFL       ---------------
FEN1_NEMVE       ---------------
FEN1_TRIAD       ---------------
FEN1_AEDAE       ---------------
FEN1_ANOGA       ---------------
FEN1_GLOMM       ---------------
FEN1_DROER       ---------------
FEN1_DROYA       ---------------
FEN1_DROSE       ---------------
FEN1_DROSI       ---------------
FEN1_DROME       ---------------
FEN1_DROPE       ---------------
FEN1_DROPS       ---------------
FEN1_DROAN       ---------------
FEN1_DROWI       ---------------
FEN1_DROGR       ---------------
FEN1_DROMO       ---------------
FEN1_DROVI       ---------------
FEN1_MONBE       ---------------
FEN1_CAEBR       ---------------
FEN1_CAEEL       ---------------
FEN1_BRUMA       ---------------
FEN1_AJECH       ---------------
FEN1_AJECN       ---------------
FEN1_AJEDR       ---------------
FEN1_UNCRE       ---------------
FEN1_ASPFU       ---------------
FEN1_ASPFC       ---------------
FEN1_NEOFI       ---------------
FEN1_ASPCL       ---------------
FEN1_ASPFN       ---------------
FEN1_ASPTN       ---------------
FEN1_EMENI       ---------------
FEN1_ASPNC       ---------------
FEN1_PENRW       ---------------
FEN1_TALMQ       ---------------
FEN1_TALSN       ---------------
FEN1_ARTOC       ---------------
FEN1_PHANO       ---------------
FEN1_PYRTR       ---------------
FEN1_NEUCR       ---------------
FEN1_SORMK       ---------------
FEN1_FUSV7       ---------------
FEN1_MAGO7       ---------------
FEN1_COPCI       ---------------
FEN1_COPC7       ---------------
FEN11_LACBS      ---------------
FEN12_LACBS      ---------------
FEN1_CRYNJ       ---------------
FEN1_USTMA       ---------------
FEN1_SCHJY       ---------------
FEN1_SCHPO       ---------------
FEN1_ASHGO       ---------------
FEN1_KLULA       ---------------
FEN1_YEAST       ---------------
FEN1_YEAS7       ---------------
FEN1_YEAS2       ---------------
FEN1_YEAS8       ---------------
FEN1_YEAS1       ---------------
FEN1_VANPO       ---------------
FEN1_CANGA       ---------------
FEN1_ZYGRC       ---------------
FEN1_LACTC       ---------------
FEN1_CANAW       ---------------
FEN1_CANAL       ---------------
FEN1_CANDC       ---------------
FEN1_CANTT       ---------------
FEN1_LODEL       ---------------
FEN1_PICST       ---------------
FEN1_CLAL4       ---------------
FEN1_PICGU       ---------------
FEN1_DEBHA       ---------------
FEN1_KOMPG       ---------------
FEN1_YARLI       ---------------
FEN1_DICDI       ---------------
FEN1_POLPP       ---------------
FEN11_PARTE      ---------------
FEN12_PARTE      ---------------
FEN1_TETTS       ---------------
FEN1_PHATC       ---------------
FEN1_THAPS       ---------------
FEN1_PHYIT       ---------------
FEN1_ENTDS       ---------------
FEN1_ENTHI       ---------------
FEN1_ENCCU       ---------------
FEN1_ENTBH       ---------------
FEN1_PLABA       NDIVC----------
FEN1_PLAYO       NDIVC----------
FEN1_PLACH       NDIVC----------
FEN1_PLAKH       KNVTSVKKRKSVQRC
FEN1_PLAVS       KNVTNVKKRKSVQRC
FEN1_PLAFA       KDVTNVKKKKYTQRC
FEN1_PLAF7       KDVTNVKKKKYTQRC
FEN1_CRYMR       ---------------
FEN1_CRYPI       ---------------
FEN1_GIAIC       ---------------
FEN1_THEAN       ---------------
FEN1_THEPA       ---------------
FEN1_BABBO       ---------------
FEN_HALMA        ---------------
FEN_NATPD        ---------------
FEN_HALWD        ---------------
FEN_HALSA        ---------------
FEN_HALS3        ---------------