CLUSTAL format seed alignment for MF_00615

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOP_PYRFU      -MVEA--VYRCFKCGREV-KLDLSITRDLRCPYCGSKILYKPRPKV-PRRVKAI
RPOP_PYRHO      -MPEA--VYRCAKCGREV-KLDLSTTRDLRCPYCGSKILYKPRPKI-PRRVKAI
RPOP_PYRAB      -MVEA--IYRCAKCGREV-KIDLSVTRDLRCPYCGSKILYKPRPKV-PRRVKAI
RPOP_SACS2      -MAV----YRCGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPT-IKIVKAI
RPOP_SULTO      -MAK----YRCGNCWREFDDEQLRALPGVRCPYCGYKIIYMVRKPT-VKVVKAI
RPOP_PYRAE      -MTEERKLYVCMRCGRIFSKSEMEILPGIRCPYCNFKIIMKVRSPM-VKRIPAI
RPOP_METJA      -MVE----YKCLNCKKIIKLEELG--KRARCPHCSYKILVKLRPKV-VKHVKAR
RPOP_HALSA      ------MSYKCSRCKRDV-ELD-E-YGGVRCPYCGHRVLLKERSRD-VKEVSVQ
RPOP_METAC      ------MGYKCTRCKQKV-EIDYE-YTGIRCPYCGHRILVKERPTT-IKRIKAE
RPOP_ARCFU      ------MSYVCLICGAEV-DIDTE-KSLVQCTNCGGRILIKPRPLAKKKRVKAI
RPOP_METKA      MYEEEKYEYICMRCGKKV-RLDIN-EDPIRCTHCGFRLVMKPRHPV-PRRYKAR
                        * *  *   .   :       :*. *. :::   *     :   .