CLUSTAL format seed alignment for MF_00618

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PCYA_PROMM      MERVRGACQSPILILLAIVLPFPSTSGPAIHPLIESLAARIRQRRAQLPELSPFA-LDSV
PCYA_SYNPX      -------MQSP-----------PSESSSTVAPLIPSLAETIRGAWIGLPELKPLD-ADSD
PCYA_PROMA      ----------------------MFAKSFPLNPFLESVADRIRERVKGLTGVESLE-LAPD
PCYA_NOSS1      ---------MSLTSIP----SLREQ----QHPLIRQLADCIEEVWHQHLDLSPYH-LPAE
PCYA_NOSP7      ---------MSFTSMP----SLREQ----QHPLIRQLADCIEAAWHQHLDLSPYH-LPDE
PCYA_SYNY3      ---------MAVTDLSLTNSSLMPT----LNPMIQQLALAIAASW-QSLPLKPYQ-LPED
PCYA_THEEB      -------------------MSLRQH----QHPLIQRLADRIEAIWQAFFPLAPYA-LPED
PCYA_SYNE7      ---------MSSSTQV----GLKEQ----LHPLIRDLATGIEATWQRWLNLEPYAAMPAD
PCYA_GLOVI      ---------MHEGNRSPRPMRMEAKTVKPRHPLVSRLAELLVSTWGEYLQLEPYH-LPAD
PCYA_PROMP      ------------------MLSKSLTKTKLIDPLILTLLQNIKVQRSKLNDLNCIE-VDPK
                                               *::  :   :         :         

PCYA_PROMM      MESISGQLDGEELLISNELHRCRGMRKLHLEIARLGGGLQVLHCVFFPDPRFDLPIFGAD
PCYA_SYNPX      FSSIEGQLEGDDLLIRNELLCCRGVRKIHLELARLGRGLQILHCVWFPDPRFDLPIFGAD
PCYA_PROMA      LKNIYGKTDGEDFFIFNELHQSRGFRKLHIETAVFEPSLEILHVVFFPDPAFDLPIFGVD
PCYA_NOSS1      LGYVEGRLEGEKLTIENRCYQTPQFRKMHLELAKVGNMLDILHCVMFPRPEYDLPMFGCD
PCYA_NOSP7      LGYVEGRLEGEKLTIENRCYQTPQFRKMHLELANIGNMLDILHCVMFPRPQYNLPMFGCD
PCYA_SYNY3      LGYVEGRLEGEKLVIENRCYQTPQFRKMHLELAKVGKGLDILHCVMFPEPLYGLPLFGCD
PCYA_THEEB      LGYVEGKLEGERLTIENHCYQAPPFRKLHLELARVGESLDILHCVMFPEPRYDLPMFGCD
PCYA_SYNE7      LGYIEGKLEGERLQIENRCYQSREFRKLHLELARVGNNLDILHCVLFPRTTFDLPMFGAD
PCYA_GLOVI      LGFVEGQLEGDRLTIVNRCYQSRVFRKLHLELATIGPNLDILHCVMYPRPQFDLPIYGTD
PCYA_PROMP      LSNIISNEEGKELYIENEFYKAKGFRKLHIEVAEFSKSLKILHCVFFPDPKYDIPIFGMD
                :  : .. :*. : * *.      .**:*:* * .   *.:** * :* . :.:*::* *

PCYA_PROMM      IVAGPAGISAAIVDLSPVG--LTMPEALLHGLESLPI--PAFQQVRELPEWGSIFSPFVQ
PCYA_SYNPX      IVAGPAGVSAAIVDLSPVS--GTLPSGIETALAGTPS--PAFRQVRDLPGWGTIFSPHVC
PCYA_PROMA      LIAVPQGISAAIVDLSPVR--DKLPRTIENQLAQIEI--PSFEKVRKLPDWGDIFSSHVQ
PCYA_NOSS1      LVGGRGQISAAIADLSPVHLDRTLPESYNSALTSLNT--LNFSQPRELPEWGNIFSDFCI
PCYA_NOSP7      LVGGRGQISAAIADLSPIQLERTLPESYTTALAQLPV--LNFSQPRELPEWGNIFSDFCI
PCYA_SYNY3      IVAGPGGVSAAIADLSPTQSDRQLPAAYQKSLAELGQ--PEFEQQRELPPWGEIFSEYCL
PCYA_THEEB      LVGGRGQISAAIVDLSPVT--GQLPAAYTCALNALPK--LTFRQPRELPPWGHIFSPFCI
PCYA_SYNE7      LVGGRGQISAAIVDLSPTTIARELSNDYIAGLTALPN--PTFQGLRELPTWGDIFSSFCL
PCYA_GLOVI      IVASTQMVSAAIVDLSPVR--GELPPAYLAGLEPSFARCTDFGQLRNLPPWGTIFSPRCV
PCYA_PROMP      LVKVNELVSAAIVDLSPSS--KNQNLKYDHLLSHIDK--SVFKSKREIPIWGNIFSKNVF
                ::     :****.****              *         *   *.:* ** ***    

PCYA_PROMM      FIRPASSQEESWFVDLADGYLKALISSVIDATPDASDAASTIQRHKSQL-SYCIQQKRND
PCYA_SYNPX      FIRPDGAEEEVLFRSRVEEVLTILRTAVLQTACEPATAASTIRRYEGQL-SYCLQQKRND
PCYA_PROMA      FITPIGAEENGFFLDLVDKFLTILIDYSESIEPDLDDSPFTIERIEGQM-YYCLQQKQND
PCYA_NOSS1      FVRPSSPEEEAMFLGRVREFLQVHCQGAIAASPVSAE--QKQQILAGQH-NYCSKQQQND
PCYA_NOSP7      FVRPGSPEEEAMFLSRVREFLDIHCMQAIASHPVSVE--QVTQNLAGQH-NYCTKQQQND
PCYA_SYNY3      FIRPSNVTEEERFVQRVVDFLQIHCHQSIVAEPLSEA--QTLEHRQGQI-HYCQQQQKND
PCYA_THEEB      FIRPQGEAEEQQFLDRIGEYLTLHCQLSQQAVPTDHP--QAV--IAGQR-QYCQQQQQND
PCYA_SYNE7      FIRPGSPEEEAAFLDRALGFLQVHCQQAAAATALTDP--EAIATVLEQQRYYCEQQRRND
PCYA_GLOVI      FARVVTPTEADLFMEISRAYLRFHCEQAARAEAVDTA--TEAQILAGQR-HYCEQQQQND
PCYA_PROMP      FASLKNESEKNAFCKIVDNYLSVLIQLSQSTSPDSDY--EIIEERINYQKNYCVQQMKNE
                *       *   *       *                              ** :* :*:

PCYA_PROMM      KTRGVLEKAFNPQWADRYIEEILFEDPPPL-----
PCYA_SYNPX      KTRRVLEKAFDASWADRYIEELLFDDPLPPG----
PCYA_PROMA      KTRNVLAKAFSPNWANQYIEMVLFDMPVHTKNLDN
PCYA_NOSS1      KTRRVLEKAFGVDWAENYMTTVLFDLPE-------
PCYA_NOSP7      KTRRVLEKAFGPVWAENYMTTVLFDLPT-------
PCYA_SYNY3      KTRRVLEKAFGEAWAERYMSQVLFDVIQ-------
PCYA_THEEB      KTRRVLEKAFGVPWAERYMTTVLFDVPPV------
PCYA_SYNE7      KTRRVLEKAFGDDWADRYMTTMLFDLPSD------
PCYA_GLOVI      KTRRILAQAFDEAWAERYIRTVLFDLPQ-------
PCYA_PROMP      KTSLVLLKYFDKVWVDEYIKKVLFDF---------
                **  :* : *.  *.:.*:  :**: