CLUSTAL format seed alignment for MF_00625

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SELD_HAEIN       ----------------------MEEKIRLTQYSHGAGUGCKISPKVLGTILHSE-LEKFY
SELD_PASMU       ------------------MNDTIASTVRLTQYSHGAGCGCKISPKVLEKILHSD-MEKWV
SELD_PHOLL       ----------------------MSTEVRLTQYSHGAGCGCKISPKVLETILHSE-QEKFL
SELD_YERPE       ---------------------MASPAIRLTQYSHGAGCGCKISPKVLDKILHTE-QQKFF
SELD_ECOLI       ---------------------MSENSIRLTQYSHGAGCGCKISPKVLETILHSE-QAKFV
SELD_SHIFL       ---------------------MSENSIRLTQYSHGAGCGCKISPKVLETILHSE-QAKFV
SELD_ECOL6       ---------------------MSENSIRLTQYSHGAGCGCKISPKVLETILHSE-QAKFV
SELD_SALTI       ---------------------MSKQAIRLTQYSHGAGCGCKISPKVLETILHSE-QAKFV
SELD_SALTY       ---------------------MSEQAIRLTQYSHGAGCGCKISPKVLETILHSE-QAKFV
SELD_PSEPK       ----------------------MSEPIRLTQYSHGAGCGCKISPKVLDVILAES-GTQAL
SELD_PSESM       ----------------------MNEPIRLTQYSHGAGCGCKISPKVLDVILAGS-GAQNL
SELD_PSEAE       ----------------------MSEAIRLTQYSHGAGCGCKISPKVLEVILAGS-GAQNL
SELD_BORBR       ----------------------MNTPVRLTQYSHGAGCGCKISPKVLEIILAGS-GAQNL
SELD_SHEON       ---------------MSNSTLPSTDSIKLTEYSHGAGCGCKISPKVLTTILASQ-LPVFT
SELD_PSEOC       -------------MNSDISNISLDATPRLTSLSHGGGCGCKIAPGVLSELLAKSNLPKQF
SELD_RHIME       -------------MNT--------LAPRLTDLAHGGGCGCKLAPSVLQQLLANQPAARPF
SELD_PORGI       ---------------------MNRSSFDLLSTVEYGGCSAKLDPAKLSELLHDI--PLPV
SELD1_PEPAC      ----------------MKGSK----EIKLTQMVTASGUAAKIGPEDLAKALVGL--PKMF
SELD2_PEPAC      MDIKKLKLHHRLETNKLKTNKHYEEEVKLTQMVRAAGUAAKLGPEYLAKALEII--PQVF
SELD_CALS4       ----------------------MIEKIKLTQFTKSAGUAAKIGPEALAQVLCQL--EITW
SELD_CAMJE       ---------------------MQYKNQNLTHFVKAAGUAAKLSPGGLKTILNFM--QKT-
SELD_AQUAE       -------------------------MVELLKLVRSSGUAAKVGPGDLQEILKGF----NI
SELD_METJA       -------------------MERGNEKIKLTELVKLHGUACKLPSTELEFLVKGI-VTDDD
SELD_METMP       -------------------------------MVTLHGUACKLPDTELENLVKGI-ISEDD
SELD_METKA       ----------------------MSRKKSLVEMADLHGUACKLPQGDLEDLLKGV-ELPEE
                                                     **..*:    *   :         

SELD_HAEIN       DPNLIVGNETADDAAVYDLGNGTAIISTTDFFMPIVDDPFDFGRIAATNAISDIFAMGGK
SELD_PASMU       DPHLLVGNETKDDAAVYDIGNGIGIISTTDFFMPIVDDPFDFGRIAATNAISDIFAMGGK
SELD_PHOLL       DPHLLVGNETRDDAAVYDIGNGTGIISTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGK
SELD_YERPE       DPRLLVGNETRDDAAVYDIGNGVGIISTTDFFMPIVDDPFDFGRIAATNAISDVYAMGGK
SELD_ECOLI       DPNLLVGNETRDDAAVYDLGNGTSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGK
SELD_SHIFL       DPNLLVGNETRDDAAVYDLGNGTSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGK
SELD_ECOL6       DPNLLVGNETRDDAAVYDLGNGTSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGK
SELD_SALTI       DPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGK
SELD_SALTY       DPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGK
SELD_PSEPK       DPKLWVGNASRDDAAVYALDDERGVVSTTDFFMPIVDDPYDFGRIAATNAISDIYAMGGD
SELD_PSESM       DPKLWVGNTSRDDAAVYALDDERGVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGD
SELD_PSEAE       DPKLWVGNASRDDAAVYALDEERGVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGD
SELD_BORBR       DPRLWVGNASRDDAAVYALDDQRGVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGD
SELD_SHEON       DPNLLVGNQSRDDAAVYKLNEEVGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGT
SELD_PSEOC       FPDLLVGTETADDAAVYKINDEQAIVATTDFFMPIVDDPYDFGRIAATNALSDIYAMGGT
SELD_RHIME       -AQLLVGNDMADDAAVWQVDDNTCVIATTDFFMPIVDDPRDFGRIAATNAISDVYAMGGK
SELD_PORGI       DSRIMVDVSTHDDAGVYRLNDDTALIVTTDFFPPVCSDPYTFGRIAAANALSDVYAMGGR
SELD1_PEPAC      DERLLVGFDTSDDAAVYRLDDDKALIQTLDFFTPMVDDPYLFGQIAASNSLSDVYAMVGK
SELD2_PEPAC      NKDLLVGYEHSDDAAVYRINSETALILTLDFFTPVVDDPYLFGLISATNSLSDVYAMGGK
SELD_CALS4       NENLLVGLNTNDDAAVYRLNEDIAIVHTVDYFTPVVDDPYDFGQIAAANALSDVYAMGAV
SELD_CAMJE       -PALLSDIGNNEDASVYQISPDLALVQTLDFITPIVDSAYHFGAIAAANALSDVFAMGAE
SELD_AQUAE       YTDESTLVSIGDDAGVYEHN-GIIWVYTVDIITPVVNDPYLWGAISTANALSDVYAMGGI
SELD_METJA       LLDKNILVGLGDDASIIKRN-GLVIAKTVDVFTPIVDDPYIQGKIAACNSTSDIYAMGLL
SELD_METMP       L--KHAKVGLGDDAAVVIKN-GMAIVKTIDVFTPIVDDPYLQGRIAACNSTSDVYAMGIS
SELD_METKA       G--GRVEVGVGDDAAVIRVD-GGYVIQSVDFFTPIHPDPYTQGRIAANNSINDVFAMGAT
                            :**.:   .       : * : *:  ..   * *:: *: .*::**   

SELD_HAEIN       PIMGIAILGFPTNVLPAEVAQKIVDGGRFACHQAGIALAGGHSIDSPEPIFGLAVTGVID
SELD_PASMU       PIMAIAILGFPIKLLPPEVAQRIVDGGRFACRQAGITLAGGHSIDAPEPIFGLAVTGIIN
SELD_PHOLL       PIMAIAILGWPIDKLAPEIARKVIEGGRAACKEAGIVLAGGHSIDAPEPIFGLAVTGIVN
SELD_YERPE       PIMAIAILGWPIDKLAPEIAQQVIEGGRYVCQQAGISLAGGHSIDAPEPILGLAVTGIVS
SELD_ECOLI       PIMAIAILGWPINKLSPEIAREVTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVP
SELD_SHIFL       PIMAIAILGWPINKLSPEIAREVTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVP
SELD_ECOL6       PIMAIAILGWPINKLSPEIAREVTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVP
SELD_SALTI       PIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVP
SELD_SALTY       PIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVP
SELD_PSEPK       PLMAIAILGWPVNVLPPEVAREVIRGGRAVCAEAGIPLAGGHSIDAPEPIFGLAVTGVVS
SELD_PSESM       PLMAIAILGWPVNVLPPEVAREVIRGGRAVCDAAGIPLAGGHSIDAPEPIFGLAVTGVVQ
SELD_PSEAE       PLMAIAILGWPVNVLAAEVAREVIAGGRKVCEEAGIPLAGGHSIDAPEPIFGLAVTGVVE
SELD_BORBR       PLLAIAILGWPVNVLPPEVAREVVRGGRAACDEAGIALAGGHSIDAPEPIFGLAVTGVVD
SELD_SHEON       PMMAIAILGWPINKLPAEIAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVTGQIA
SELD_PSEOC       PLMALAIVGMPINVLPHDVIAKILEGGESVCRDAGIPLAGGHSIDSVEPIYGLVGIGIVN
SELD_RHIME       PILALAIVGMPINKLDSTTIAKILEGGASICAEAGIPVAGGHSIDSVEPIYGLAVIGLCH
SELD_PORGI       PLLVLNLTMFPSEGIPVEVLADILRGGQQTIDESGAFTMGGHTIDDPIPKYGLAVTGIVH
SELD1_PEPAC      PIVAMNIVCFPSCHD-MSILGEILKGGADKVIESGAILVGGHTVDDKEPKYGLSVAGLVH
SELD2_PEPAC      PLVAMNIVCFPACKD-VGILAQILKGGFDKVQESGAILVGGHSVDDNEPKYGLSVCGIVH
SELD_CALS4       PLFALNVVCFPAAY--IDVLKEVLRGGNDKVKEAGALIAGGHTIEDEEPKYGLSVTGIVH
SELD_CAMJE       VINALNIVGFDTCNHDLNILKELLEGANDKVKECNALVVGGHTIESTELFFGLSVTGKVH
SELD_AQUAE       PVNALAISCFNNCELDIEIFREVIRGALDKLREAKTVLLGGHTIDDKEPKFGLSVAGICP
SELD_METJA       DIVGVLAIVGIPEKLPIHVVREMLKGFQDFCRENKTTIVGGHTILNPWPLIGGAVTGVGR
SELD_METMP       EIIGGLVFLGIPPELPVPVAKKMLQGFQDFCRENDTTIIGGHTILNPWPLIGGSITGVGK
SELD_METKA       EVLSVLVVSGFPRELPEEDAREMLQGFADQCREVDALIVGGHTIMNPWPILGGCVTGFA-
                  :                    :  *             ***::       *    *   

SELD_HAEIN       TEKVKRNASAKSGCKLYMTKPLGIGILTTAEKKGKLKPEHQ-----------GLATAAMC
SELD_PASMU       TDKVKKNASATAGCKLFLTKPLGIGVLTTAEKKGKLKAEHQ-----------GLATEVMC
SELD_PHOLL       IDRVKQNSAAKVGSQLFLTKPLGIGVLTTAEKKGLLLPEHQ-----------GIAIETMC
SELD_YERPE       TEQVKKNSAAKPGCKLFLTKPLGIGILTTAEKKSKLRPEHR-----------GLATETMC
SELD_ECOLI       TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQ-----------GLATEVMC
SELD_SHIFL       TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQ-----------GLATEVMC
SELD_ECOL6       TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQ-----------GLATEVMC
SELD_SALTI       TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQ-----------GLATEVMC
SELD_SALTY       TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQ-----------GLATEVMC
SELD_PSEPK       KRHLKRNDTASAGCQLYLTKPLGIGILTTAEKKAKLRVQDQ-----------GLARDWMC
SELD_PSESM       KKHMKRNDTAQAGCVLYLTKPLGIGILTTAEKKARLREEDM-----------GLARDWMC
SELD_PSEAE       KRFMKRNDTAEAGCRLYLTKPLGIGILTTAEKKARLRAEDV-----------GVARDWMC
SELD_BORBR       KARLKRNDTATAGCRLYLTKPLGIGILTTAEKKSRLRPEDV-----------NLARDWMC
SELD_SHEON       LTDLKQNDTAKAGDRLYLTKPIGIGILTTAQKQKKLKDEDS-----------HIAVNAMC
SELD_PSEOC       PKQMKRNADAKDGDVLILGKPLGVGILSAALKKNLLDDAGY-----------RAMVDATT
SELD_RHIME       PSEVRRNGGVKAGDALILTKGIGVGIYSAAIKKNALPPGCY-----------EEMIGSTT
SELD_PORGI       PEHLVTNAGVRAGQCLVLTKPLGIGVAMAAHRLGLIGSEVY-----------EAAIGQMC
SELD1_PEPAC      PDKVLANSGARPGDALILTKPIGTGIVSTGMKAAMVQKSTE-----------DEVVKIMA
SELD2_PEPAC      PGRVLSNSAAKVGDVLVLTKPLGTGIINTGIKAGIVGQQTV-----------DEVVKIMT
SELD_CALS4       PEKVIKNSTAKPGDVLILTKPLGIGVINTAIKGEMCPSETY-----------LLAVEVMK
SELD_CAMJE       PSKFIANNTSKIGDCIILTKPLGTGILSTALKAQMLNQKHL-----------DIMLKNMI
SELD_AQUAE       EGKYITQSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDI-----------NEAIENML
SELD_METJA       EEEVLTKAGVKVGDVLILTKPLGTQTAMALSRIPEEFKDLISITEEERDYIINKAIEIMT
SELD_METMP       EEDILTKAGCKNGDVLILTKPLGNQSAMALSRVTEEFEDLIDIPKEEQKYIFEKTIELMT
SELD_METKA       -ERYVTVGGAEPGDVLYLTKPLGTQPAMAALRLPEDVRKQF-LTDSELEEAVDLAVEVMT
                             *  : : * :*        :                            

SELD_HAEIN       QMN-------SIGSQFSQVDGVTAMTDVTGFGLLGHLIEICEGSNLSAVVFSDKIKTLDG
SELD_PASMU       QMN-------TIGAKFAEIAGISAMTDVTGFGLLGHLSELCEGSGVRAEVYFDKIKTLDG
SELD_PHOLL       RLN-------KLGMDFAEVAGITAMTDVTGFGLLGHLSEICAGSGVQATLHFAKVPKLPE
SELD_YERPE       QLN-------KPGADFAHIPGVTAMTDVTGFGLLGHLSEICQGSGVQAILHYSAIPRLPA
SELD_ECOLI       RMN-------IAGASFANIEGVKAMTDVTGFGLLGHLSEMCQGAGVQARVDYEAIPKLPG
SELD_SHIFL       RMN-------IAGASFANIEGVKAMTDVTGFGLLGHLSEMCQGAGVQARVDYEAIPKLPG
SELD_ECOL6       RMN-------IAGASFANIEGVKAMTDVTGFGLLGHLSEMCQGAGVQARVDYDAIPKLPG
SELD_SALTI       RMN-------VAGAAFANIDGVKAMTDVTGFGLLGHLSEMCQGAGVQAMLCYQDIPKLPG
SELD_SALTY       RMN-------VAGAAFANIDGVKAMTDVTGFGLLGHLSEMCQGAGVQALLCYQDIPKLPG
SELD_PSEPK       TLN-------TPGSRFGKLDGVKAMTDVTGFGLLGHLVELAEGSGLTAHLNYAAVPRLPS
SELD_PSESM       TLN-------TPGSRFGKLAGVAAMTDVTGFGLLGHLVEMADGAGLTARLDYAAVPRLPG
SELD_PSEAE       TLN-------RPGARFGRLAGVKAMTDVTGFGLLGHLVEMADGSKLTARVEYAAVPRLAS
SELD_BORBR       TLN-------KPGSRFGALAGVKAMTDVTGFGLLGHLVEMADGSGVSARIEYAKVPRLPG
SELD_SHEON       QLN-------SIGAQIAKINGVNALTDVTGFGLAGHLLEMCQGAKLTAKLKLDAVPLLPR
SELD_PSEOC       KLN-------RPGTELAKLDGVHALTDVTGFGLLGHGLELARGAQLSARIDSAKLPMLPG
SELD_RHIME       LLN-------RIGADLAADPDVHALTDVTGFGVLGHGLEMARASQLSLTLRLSAIPFLSQ
SELD_PORGI       LLN-------RAGAELMQKYGIRGATDITGFGLLGHAKGLAEASDVCLHIDSRSVPVLPE
SELD1_PEPAC      HLN-------KYAAEALDGFNVNSVTDITGFGFLGHAAEMAKGSGVTLEISSKDIPIMSE
SELD2_PEPAC      HLN-------KYAALAFDDIRVNSATDVTGFGFLGHTMEMARGSDVTIEITVAQIPFIAE
SELD_CALS4       YLN-------KEASEIMKEVGVNACTDITGFGLLGHAYEMAFSSGVTIEFDKDSIPLIEG
SELD_CAMJE       ELN-------YKASQIALKFHPSAMSDVTGFGLLGHLKEML-NKNISFEIFESELPFLDG
SELD_AQUAE       ALN-------DKARNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGARIFFEKVPYYQL
SELD_METJA       TSNRYALKALRKAEERVGDKIANALTDITGFGILGHSNEMAKNSNVLIEINLLPCIKRTP
SELD_METMP       TSNRIALLHLRELENELGEKIANAMTDVTGFGILGHSQEMAEQSDVEIEISCLPVIKGTP
SELD_METKA       EP-------LKDAAEAALEVGVHAMTDVTGFGLKGHAGEMAEASGVRVVIERLPVIPGTT
                                        . :*:****. **   :     :   .          

SELD_HAEIN       VKDYIAQGCVPGGTGRNFDSYGHKV---GILTEEQKAILCDPQTSGGLLVAVELNSVQTV
SELD_PASMU       VQRYIEKGCIPGGTERNFESYGHKI---GAMSDLQKAILCDPQTSGGLLIAVDADSEQQV
SELD_PHOLL       VESYIAKGCVPGGTGRNFDSYGHLI---GEMTELQRKLLCDPQTSGGLLLAVLPEAMDEV
SELD_YERPE       VEDYIAEGCVPGGTGRNFDSYGHLI---GNMSDLQKQLLCDPQTSGGLLLAVLPDAEADV
SELD_ECOLI       VEEYIKLGAVPGGTERNFASYGHLM---GEMPREVRDLLCDPQTSGGLLLAVMPEAENEV
SELD_SHIFL       VEEYIKLGAVPGGTERNFASYGHLM---GEMPREVRDLLCDPQTSGGLLLAVMPEAENEV
SELD_ECOL6       VEEYIKLGAVPGGTERNFASYGHLM---GEMPREVRDLLCDPQTSGGLLLAVMPEAENEV
SELD_SALTI       VEEYIALGAVPGGTERNFASYGHLM---GDMSREVRSLLCDPQTSGGLLLAVTPDAEDDV
SELD_SALTY       VEEYIALGAVPGGTERNFASYGHLM---GDMSREVRSLLCDPQTSGGLLLAVTPDAEDDV
SELD_PSEPK       VDHYLAEGCIPGGTLRNYDSYGHKI---SALSDDQKHLLCDPQTSGGLLVAVAPEGEAEF
SELD_PSESM       VEHYIAEGCVPGGTLRNFESYGDKI---AALSDAQRDLLCDPQTSGGLLVAVSPEGEAEF
SELD_PSEAE       AEYYLEQGCVPGGTLRNFDSYGERI---APLPEVQKLLLCDPQTSGGLLVAVAPEGEAEF
SELD_BORBR       VEHYLAEGCVPGGTGRNFDSYGARI---APLPQDRVDLLCDPQTSGGLLVAVEPAGEAEF
SELD_SHEON       ALDYLAQGCVPGGTHRNYDSYGEHL---PELTDHQKAILCDPQTSGGLLVAVSSEAEAEL
SELD_PSEOC       VQALAEQGIFTGASGRNWASYGEHVELASSLTDAQKALLTDPQTSGGLLVSCTQDVVHQV
SELD_RHIME       AYMLAEQGFITGASGRNWASYGADVVLPDDLPDWQRLLLADPQTSGGLLVACAPEKAGAL
SELD_PORGI       CLSLLRDGCIPGAAFRNLRFVGDML--RADCPTEYKMLLADAQTSGGLLMAVDADRAEDL
SELD1_PEPAC      AEELAKMGIIPAGMYRNKKFIQSDV-LCEGVSEHIMDILYDPQTSGGLLVSVPQEHARAL
SELD2_PEPAC      TEELAKSGIIPAGAYRNRDFVKNDV-RMEGIADHISDILYDPQTAGGLLVSVPENDAKAL
SELD_CALS4       ARELAQMGLIPGGCYRNKKYLKGKV-CIKVEEDEVIDLMFDPQTSGGLLISVSEEKAEEL
SELD_CAMJE       VKEYFNMGLIPAGAYKNLEFIKELT-PDLNEEK---LLLCDPQTSGGLLISISEKDSLEC
SELD_AQUAE       SENLVKKKIYPKGAIENLNFVKNYL--KSNLDNWKLILLSDPVTSGGLLFTINKEKLEKI
SELD_METJA       ELSRLFGHALLDGY--------------------------GAETAGGLLISAKEEYKDNL
SELD_METMP       ELASLFGHALCSGK--------------------------GAETAGGLLISTKPEYKDKL
SELD_METKA       ELSRALGYGLERGE--------------------------SAETAGGLLVAVPEEHAEDL
                             .                           .. *:****.:         

SELD_HAEIN       IDIAKDAGIDLYEVGKLKPKS-ESDIVVEVK------
SELD_PASMU       LEIAADDSIELFEVGRLFAKEHDSPILITVL------
SELD_PHOLL       KAIARCHGIELTAIGELSEQQ-SGRVLIEVNE-----
SELD_YERPE       QAIAAQHGMTLSPIGELTSAD-SRRALIEIVV-----
SELD_ECOLI       KATAAEFGIELTAIGELVPAR-GGRAMVEIR------
SELD_SHIFL       KTTAAEFGIELTAIGELVPAR-GGRAMVEIR------
SELD_ECOL6       KATAAEFGIELTAIGELVPAR-GGRAMVEIR------
SELD_SALTI       KATAAEFGIELTAIGELVEAR-GGRAMVEIR------
SELD_SALTY       KATAAEFGIDLTAIGELVEAR-GGRAMVEIR------
SELD_PSEPK       LAVAAELGLKLSPIGKLVERQ---SHAVEVI------
SELD_PSESM       LAVAAELGLQLNPIGTLLERQ---THAVEVF------
SELD_PSEAE       LAVAAELGLQLAPIGELVERQ---SLAVQVL------
SELD_BORBR       LAAAGELGLRLEPIGELVAQR---PYAVEVL------
SELD_SHEON       VALLNANQIEPICIGSLEAPTTATNVVLC--------
SELD_PSEOC       LQVFADSGFAEAAVIGRMEAG---APKVFVG------
SELD_RHIME       VEKVRLAGYPLAGIVGTAAAG---AAQIKVIS-----
SELD_PORGI       VADLHRTGLHPFAAIIGYATDAEDAAKLIVT------
SELD1_PEPAC      ADKMTSCGSLAAKIVGRVLSK--EEKSIIVI------
SELD2_PEPAC      VAKMLAYGSLDARIVGRVIPK--ADKYVIVR------
SELD_CALS4       YRRLNKKLKFGAFIVGRVKEK--QEYDIYVR------
SELD_CAMJE       LKKLEDE-NIQAKIIAKVVNK--QENDIIIS------
SELD_AQUAE       DETAKELEVNYWIIGETIAEN-----VLEVL------
SELD_METJA       IDELEKAKCYAFEVGRVVKKGEGKAVLSKDVKVIEI-
SELD_METMP       IQKFKENNVYAFEVGKIVNNGVGIAKLSENVEILEI-
SELD_METKA       EDAFERRDVWYRRIGRVEE-GSGVEVRGDVEEVEDYP