CLUSTAL format seed alignment for MF_00632

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y2387_BACHD      MAKEHSFDLVSEVNLQEVDNAINLAMKEITNRYDFKGSKSSIERTG-DEQVTLISDDEYK
YITK_BACSU       MAKESSFDIVSKVELPEVQNAIQIALKEISTRYDFKGSKSDISLD--KEELVLVSDDEFK
Y3406_LEPIN      MS-DPSFDVVSEISRPELTNAVTQALGEIKNRFDFKGSKSDIQLE--DEQLVLTSDNEAK
YAJQ_ECOLI       ---MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDASKTIKVLSESDFQ
YAJQ_SHIFL       ---MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEYSFELNDASKTIKVLSESDFQ
YAJQ_SALTI       ---MPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATIELNDANKTIKVLSESDFQ
YAJQ_SALTY       ---MPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATIELNDANKTIKVLSESDFQ
Y1034_HAEIN      ---MPSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQ
Y1656_PASMU      ---MPSFDIVSEITLHEVRNAVENANRDLTNRWDFRNVQAAIELNEKNESIKVSSESDFQ
Y3170_YERPE      ---MPSFDIVSEIDMQEVRNAVENATRDLANRWDFRNVPASFELNEKNESIKVVSESDFQ
Y1617_VIBPA      ---MPSFDIVSEIDTVELRNAVDNANRELSTRFDFRNVNASFELVE--ENVKVSAEGDFQ
Y2655_VIBVU      ---MPSFDIVSEIDTVELRNAVDNSNRELSTRFDFRNVQASFELVE--QTVKVSAEGDFQ
Y1508_VIBCH      ---MPSFDIVSEIDAVELRNAVENSTRELASRFDFRNVDASFELKE--ETVKLAAEDDFQ
Y3815_SHEON      ---MPSFDIVSEVDEVELRNAVENSRRELSGRFDFRGKDASIDYKD--HVVTLTAEDDFQ
Y4395_PSEAE      ---MPSFDVVSELDKHELTNAVDNAIKELDRRFDLKG-KCSFEAKDK--SVTLTAEADFM
Y1352_PSEPK      ---MPSFDVVSELDKHEVQNAVDNAIKELDRRYDLKG-KGTFEFKDKEQTVMLTAEEEFQ
Y3671_XANAC      ---MPSFDVVSEVDKHELTNAVDQANRELDTRFDFKGVEARFELEDG-KVINQSAPSDFQ
Y3632_XANCP      ---MPSFDVISEVDKHELTNAVDQANRELDTRFDFKGVEAKFELEDG-KVINQSAPSDFQ
Y2549_RALSO      ---MPSFDVVCEANMVELKNAVEQANKEISTRFDFKGSDARVEHKD--QELTLFGDDDFK
Y4662_NOSS1      MASTYSFDIVSDFDRQELVNAVDQVIRDLKSRYDLKDTQTTVELGE--EKITIGTDSEFT
Y793_THEEB       MASTFSFDIVSDFDWQELVNAVDQTGREIKARYDLKDTQTALELTK--EGLTIHTDSEFT
Y566_MYCTU       MADS-SFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKGD-EAVELTSSTEER
Y4614_STRCO      MADS-SFDIVSKVERQEVDNALNQAAKEISQRYDFKGVGASISWSG--EKILMEANSEDR
Y374_CAMJE       MASEHSFDISAALDKQELKNAFEQAKKELDSRYDLKGIKCEIDLSEKESIFKLSSSSEGK
                      ***: .     *  *..      :  *:*::.    .        .      :  

Y2387_BACHD      LESVIDILKSKFIKRGLSQKTMDF-GKIERAAGGTVRQVVTLLSGIEGERAKKLTKLIRD
YITK_BACSU       LSQLKDVLVSKLIKRNVPTKNIDY-GKVENASGGTVRQRAKLVQGIDKDNAKKINTIIKN
Y3406_LEPIN      LESVIDVLVSKMAKRGLGLKNFDFKSKIEPATGGTVRMKVKIRKGMEKEQTKEVTRIVKE
YAJQ_ECOLI       VNQLLDILRAKLLKRGIEGSSLDVPENIVHS-GKTWFVEAKLKQGIESATQKKIVKMIKD
YAJQ_SHIFL       VNQLLDILRAKLLKRGIEGSSLDVPENIVHS-GKTWFVEAKLKQGIESATQKKIVKMIKD
YAJQ_SALTI       VNQLLDILRAKLLKRGIEGASLDVPDEFVHS-GKTWYVEAKLKQGIESAVQKKIVKLIKD
YAJQ_SALTY       VNQLLDILRAKLLKRGIEGASLDVPDEFVHS-GKTWYVEAKLKQGIESAVQKKIVKLIKD
Y1034_HAEIN      LEQLIEILIGSCIKRGIEHSSLDIPAESEHH-GKLYSKEIKLKQGIETEMAKKITKLVKD
Y1656_PASMU      VEQLVDILRNACIKRGIDSGSLDIPTEYEHS-GKTYSKEIKLKQGIASEMAKKITKLIKD
Y3170_YERPE      VEQLLDILRAQLSKRGIEGAALEIPEEMARS-GKTYSVDAKLKQGIESVQAKKLVKLIKD
Y1617_VIBPA      LKQMRDILRGHLAKRNVDANAMDAQN-PEVT-GKNWHQNILFRQGIDTPTAKKLVKLIKD
Y2655_VIBVU      LKQMRDILRGHLAKRGVDANSMDAKT-AEQT-GKNWHQDIVFLQGIETPMAKKIVKLIKD
Y1508_VIBCH      LGQMMDILRGNLAKRGVDARAMKAKD-SVHI-GKNWYKEAEFKQGLEALLAKKIVKLIKD
Y3815_SHEON      CKQLVDILRTQLSKRNVEPSTMDVDEKSVHS-GKTFSLKVRFKQGIETDIAKKIVKMVKD
Y4395_PSEAE      LEQMLDILRSNLVKRKVDSQCMEIKD-AYPS-GKVVKQDVNFREGIDKDLAKKIVGLIKE
Y1352_PSEPK      LEAMLEILRLALVKRKIDVKCLETKD-PYAS-GKEKKQEAKFREGIDKDLAKKIVATIKD
Y3671_XANAC      IKQMTDILRARLLARGIDIRCLEFGD-VETN-LAGARQKVTVKQGIEQKQAKQLVAKLKE
Y3632_XANCP      VKQMTDILRARLLARGIDVRCLEFGD-VETN-LAGARQKVTVKQGIEQKQAKQLVAKLKE
Y2549_RALSO      LGQVKDVLLTKLAKRGVDVRFLDYQDKQKIG-GDKMKQVVKIKKGVSGELSKKIVKLIKD
Y4662_NOSS1      LESVHNILREKAAKRNLSQKIFDFGKVESAS-GNRVRQEITLKKGISQDIAKQISKLIRD
Y793_THEEB       LNSVQTILQQKAAKRQLSLKIFDYGPVEAAG-GQRVKQLIKLRRGIPSELAKEISKLIRN
Y566_MYCTU       VKAAVDVFKEKLIRRDISLKAFEAGEPQAS--GKTYKVTGALKQGISSENAKKITKLIRD
Y4614_STRCO      VTAVLDVFQSKLIKRGISLKALDAGEPQLS--GKEYKIFASIEEGISQENAKKVAKLIRD
Y374_CAMJE       LDVLKDIVISKLIKRGINPKAIKELS---RESGAMFRLNLKANDAIDSENAKKINKVIKD
                       :.      * :    :.                     .:     *::   :::

Y2387_BACHD      S-KLKVKAQIQNDQIRVTGKNIDDLQQVIQLVKEQDLDFPVQFVNMR-
YITK_BACSU       S-GLKVKSQVQDDQVRVTGKNKDDLQQIISAVRGADLPIDVQFINFR-
Y3406_LEPIN      S-KLKVNATIMGECVRITGKKKDDLQEVIHLLKNSDLPFDVQFTNYK-
YAJQ_ECOLI       S-KLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
YAJQ_SHIFL       S-KLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
YAJQ_SALTI       S-KLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGDDLGQPFQFKNFRD
YAJQ_SALTY       S-KLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQFKNFRD
Y1034_HAEIN      S-KIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNNFRD
Y1656_PASMU      S-KLKVQTQIQGEQVRVTGKSRDDLQAVIQLVKGAELGQPFQFNNFRD
Y3170_YERPE      S-KLKVQAQIQGEQVRVTGKARDDLQAVMALVRAADLGQPFQFNNFRD
Y1617_VIBPA      A-KLKVQASIQGDKVRVTGKKRDDLQATIAAIREAELGQPFQFNNFRD
Y2655_VIBVU      A-KLKVQASIQGDKVRVTGKKRDDLQETIAAIRAAELGQPFQFNNFRD
Y1508_VIBCH      A-KIKVQASIQGDKVRVTGKKRDDLQEVMAMLREANLEQPLQYNNFRE
Y3815_SHEON      S-KIKVQSQIQGDTVRVTGKARDDLQAVMALVRQADLGQPFQFNNFRD
Y4395_PSEAE      R-KLKVQAAIQGEQVRVTGKKRDDLQEAIALLRGESLGMPLQFTNFRD
Y1352_PSEPK      G-KLKVQAAIQGEQVRVTGKKRDDLQEAIALLRTKEFDMPLQFNNFRD
Y3671_XANAC      A-KLKVEAQINGDKLRVTGKKRDDLQDAIALLKKADFELPLQFDNFRD
Y3632_XANCP      A-KLKVEAQINGDKLRVTGKKRDDLQDAIAVLKKADFELPLQFDNFRD
Y2549_RALSO      S-KIKVQGSIQGDAVRVSGAKRDDLQAVIAMLRKDVTDTPLDFNNFRD
Y4662_NOSS1      E-FKKVQASIQGDAVRVSAKAKDDLQIVIQRLKQEDYPVALQFTNYR-
Y793_THEEB       E-FKKVQASIQGDVVRVSAKSKDDLQAVIQRLKTQDYPVPLQFTNYR-
Y566_MYCTU       AGPKNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR-
Y4614_STRCO      EGPKGVKAQVQGEELRVSSKSRDDLQTVISLLKGQDFDFALQFVNYR-
Y374_CAMJE       S-KLKVNSSIRGEEIRVAAKQIDDLQAVMKLVKELDLELNISFKNLK-
                      *:  : .: :*::.   ****  :  ::       ..: * :