CLUSTAL format seed alignment for MF_00634

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YGGU_ECOL6       ---------MSAVTV-----------NDDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_ECOLC       ---------MSAVTV-----------NDDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_ECOL5       ---------MSAVTV-----------NDDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_SHIFL       ---------MSAVTV-----------NDDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_ECOK1       ---------MSAVTV-----------NDDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_ECOLI       ---------MNAVTV-----------NDDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_ECO57       ---------MSAVTV-----------NDDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_SALPB       ---------MSAVTR-----------CEDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_SALTI       ---------MSAVTR-----------CEDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_SALTY       ---------MSAVTR-----------CEDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_SALPA       ---------MSAVTR-----------CEDGLVLRLYIQPKASRDSIV--GLH-----GDE
YGGU_SALAR       ---------MSAVTR-----------CEDGLVLRLYIQPKASRDCIV--GLH-----GDE
Y4329_CITK8      ---------MSAVTP-----------CADGLILRLYIQPKASRDSIV--GLH-----GDE
Y3323_KLEP7      ---------MSAVET-----------CADGLVLRLYIQPKASRDSIV--GVH-----GDE
Y3359_ENT38      ---------MSAVST-----------CADGLVLRLYIQPKASRDSIV--GLH-----GDE
Y387_CROS8       ---------MSAVSK-----------TVDGLVLRLYIQPKASRDSII--GLH-----GDE
Y827_YERP3       ---------MSAVLS-----------TENGLILKLYIQPKASRDQIV--GLH-----GDE
Y3216_YERPS      ---------MSAVLS-----------TENGLILKLYIQPKASRDQIV--GLH-----GDE
Y944_YERPE       ---------MSAVLS-----------TENGLILKLYIQPKASRDQIV--GLH-----GDE
Y3141_YERPN      ---------MSAVLS-----------TENGLILKLYIQPKASRDQIV--GLH-----GDE
Y571_YERPP       ---------MSAVLS-----------TENGLILKLYIQPKASRDQIV--GLH-----GDE
Y321_YERPA       ---------MSAVLS-----------TENGLILKLYIQPKASRDQIV--GLH-----GDE
Y4033_SERP5      ---------MSAVTP-----------VLDGLAIRLYIQPKASRDQIV--GLH-----GDE
Y3436_YERE8      ---------MSAVTP-----------LLDGLALRLYIQPKASRDQIV--GLH-----GDE
Y3630_PECAS      ---------MSAITR-----------HGDALVIRLYIQPKASRDQIV--GLH-----GDE
Y3628_AERS4      ---------MPAVLR-----------EGDELILHLMIQPKASRDQIV--GLH-----GDE
Y3661_AERHH      ---------MAAVLR-----------EGDELIMHLMIQPKASRDQIV--GLH-----GEE
Y1210_VIBC3      ---------MAAVWR-----------EGDDLLLRLYIQPKASRDSIV--GLH-----GEE
Y458_VIBCH       ---------MAAAWR-----------EGDDLLLRLYIQPKASRDSIV--GLH-----GEE
Y3581_VIBCB      --------MSEAVWH-----------DGEDVVLRLYIQPKASRDKIV--GLH-----GEE
Y2619_VIBPA      --------MSAAVWQ-----------DGEDIVLKLYIQPKASRDKIV--GLH-----GEE
Y1522_VIBVU      --------MSQTVWL-----------DGEDVVLRLYIQPKASRDKIL--GLH-----GDE
Y2877_VIBVY      --------MNPAVWL-----------DGEDVVLRLYIQPKASRDKIL--GLH-----GDE
Y1134_SHELP      ---------MGVVTK-----------EQDDLVIRLYIQPKASRDQIV--GPH-----GDE
Y2690_SHEPC      ---------MSAVVQ-----------QQGDLLLNVYIQPKASRDQIV--GLH-----GDE
Y1321_SHESW      ---------MSAVVQ-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y1261_SHESR      ---------MSAVIM-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y1190_SHESM      ---------MSAVIM-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y1191_SHESA      ---------MSAVIM-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y3356_SHEON      ---------MSAVIM-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y3043_SHEB8      ---------MSAVTL-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y3028_SHEB5      ---------MSAVTL-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y3186_SHEB9      ---------MSAVTL-----------QQGDLLLNLYIQPKASRDQIV--GLH-----GDE
Y2863_SHEFN      ---------MNPVSYI-------NDEQQGDLLLFVYVQPKASRDQIV--GLY-----GNE
Y1229_SHESH      ---------MLPVSK-----------QQDDLLLNLYIQPKASRDQIV--GVH-----GEE
Y1977_ACTSZ      ---------MTAVEQ---------TAD--GIRLRIMLQPKASKDAII--GLH-----DEE
Y322_MANSM       ---------MSAIEQ---------TAE--GLRLRIFLQPKASRDKII--GIH-----DDE
Y778_HAEDU       ---------MKAVEF---------VENPYGIRLRIFLQPKASRDQIV--GLH-----DNE
Y1380_ACTP2      ---------MEAVER---------IENPCGIRLRIFLQPKASRDQIV--GLH-----DNE
Y1313_PASMU      ------MTQLPAVEK---------QEE--HLRLRIFLQPKASKDQIV--GLH-----DNE
Y2480_SHEAM      ---------MSAITR-----------QDEDLLLALYVQPKASRDELV--GLH-----GEE
Y3043_PSYIN      ---------MAVDNL---------QYEGEDLLLRLVLQPKSSRDQFI--GLL-----GDE
Y5841_PSEF5      ---------MSYYRW-----------DGDDLILDCHLQPKASSDEFA--GLH-----GER
Y5322_PSEPF      ---------MSWFRW-----------DGDDLILECHLQPAARSDDFC--GLH-----GDR
Y4153_PSEMY      ---------MSYFRW-----------DGEDLILDCHLQPKASKDEFA--GLH-----GER
Y3000_NITOC      -------MAVRWYCW-----------QQEALIIQIRLQPRAKGDEVI--GPH-----GDR
Y3835_GLOVI      -----MRSPLPPMPDPEAFPPGAVSVDAGGITLTVWAQPRASCSEVV--GWQ-----QNA
Y3654_MAGMM      ---------MGQPSW-----------QGDTLHLTIRVQPKAAQERVM--GWQ-----GEQ
Y3887_DECAR      --------MSDWFRQA---------ANGCI-TLTLHIQPGAKKSEFA--GLH-----GDA
Y3464_AZOSB      --------MADWVREA---------ADGSL-TLTLHIQPGARQTGFA--GLH-----GEA
Y395_NITEU       ---------MSWYSFG---------NDRSLLILKLYVQPGARQTEAV--GIC-----GEE
Y2146_NITEC      ---------MGWYCLD---------RDHNL-ILKLYIQPGARQTEAI--GVH-----GEE
Y1126_ANADF      ---------MSWARDE-----------AGGVVLELLVQPRASRTRVL--GEH-----GGR
Y1087_ANADE      ---------MAWARDE-----------GGAAVLEILVQPRASRTRAV--GEH-----DGR
Y959_SYNWW       -------MNKPLIRTER---------NGDWLRFGVKVQPRSSRNQIV--GEH-----EGD
Y247_CHLCV       -------------------------MNEEYWILEVKVTPKSRENKIV--GF-----EGEV
Y243_CHLAB       -------------------------MHQEYWILEVKVTPKSKQNTIV--GF-----EGEV
Y497_CHLPN       --------------------------MDDSWILEVKVTPKAKENKIV--GF-----DGQA
Y423_CHLTA       MRFLLKLLSKEKENI----------LLEGFWVLEVRVTTKARENRVV--CL-----EDGI
Y388_CHLTR       MRFLLKLLSKEKENI----------LLEGFWVLEVRVTTKARENRVV--CL-----EDGI
Y667_CHLMU       -------------------------MLEGFWVLEIRVTTKARENKVV--SL-----EDGI
Y3569_MYCGI      -------------------------MAE---LISVRVKPGSRKGPLV--EAG----EDGA
Y2846_MYCVP      -------------------------MSD---VVSVRVKPGSKKGPLV--ETG----PDGE
Y1997_MYCTA      -------------------------MTD---SVVVRVKPGSHKGPLV--EVG----PNGE
Y2174_PARDP      ---------MTDLSH----------LARPGAEIAVRVTPRASRNAVI--LD------GEA
Y8260_RHOBA      ---MMSEPGAGLDRQ----------CDGLTWRFRVRVTPKAKKASVG--GL-----HDGA
Y109_RHOP2       ---------MAEAWR----------YSAQGVAVAVRVTPRGDRDEID--GLETLSDGRPV
Y058_RHOPB       ---------MTEAWR----------YSAQGISVALRVTPRGGRDDID--GLETLANGRTV
Y4503_RHIL3      ---------MSSPWS----------LFDDHLRLAVRLTPNGGRDALD--GIEADGEGEAF
Y3912_RHIEC      MDHPLPAGRLSPPWK----------LFADHLRLTVRLTPNGGRDAFD--GIDTDSEGETY
Y2660_AGRFC      MEHALPDDCLSGLWR----------KHDDHVRLSVRLTPNGGRDAID--GVEQDADGNAH
Y4154_RHILO      ---------MSAPLR----------IRENGIDLFVRLTPKSSLDRLE--GVETSADGRSH
Y3622_CAUVC      --------------M----------ADGVAVTLVVRLTPRGGRDAAE--GWALDADGRLY
Y1821_PELTS      ----------MLFLK----------EEKDGVLLKVRVQPRAARNQVA--GLY-----EDA
Y717_DESRM       ----------MFDIK----------EDQNGVVVKVRVQPRASKNSLA--GEM-----EGA
Y4205_KORVE      ----------MIEIR----------ETSSGVSFAVRLQPKAKKTAII--GEL-----NGA
Y338_PELLD       ----------MVEFH----------EKRGNAVFGVRVQPRSSKSAVS--GPY-----GNA
Y403_CHLPM       --------MRVVAVR----------EKKGNALFSVRVQPRASKTAVS--GPY-----AGG
Y319_CHLCH       ----------MVELQ----------EKNGSVCIAVRAQPRSSKSMVS--GEW-----NGA
Y2081_CHLPD      ------MMISGVEIS----------EKSGSAVFRLKAQPRSSKSAIS--GAY-----NGG
Y1832_CHLTE      ----------MSPIS----------QKGEAVCLSVRVQPRSSKSGVA--GMY-----GEQ
Y1103_DEHMB      ---------MPP--------------KESPFKVNLKIIPSARKNELA--GYE-----NGL
Y1230_DEHMC      ---------MPP--------------KESPFKVNLKIIPSARKNELA--GYE-----NGL
Y1292_DEHM1      ---------MPA--------------KESPFRVNLKILPSAQRNELT--GYE-----NGL
Y3894_TRIV2      ------------------------------MQKKVKVKPNSKQQKIA--EQDD-----GS
Y3196_NOSS1      ------------------------------MQKRVKVKPNSKQQKIA--EQDD-----GS
Y1736_LEPIN      ------------------------------MKFTVYVKPNSKKVFFR--KEED-----GV
Y2068_LEPIC      ------------------------------MKFTVYVKPNSKKVFFR--KEED-----GV
Y1994_THEEB      -----------------------------MGKKHVIVKPNARQASVS--ITPA-----GQ
Y182_AERPE       ------------MPVNVDRLKDAVEVLGNRVRIRVYVKPEGRERRLR--LEE------GE
Y501_PYRAB       -----------MLKE---------VRE--GVILRVIVKPNARENSIE--GIDEW---RGR
Y1765_PYRFU      -----------MLRE---------TSE--GVILSVIVAPNARETKIV--GIDGT---RGR
Y768_THEKO       ---------MKFIKE---------TKE--GVLIMIYVQPKAKKNAIE--GVDGW---RGR
Y273_METKA       --------MESPVKE---------HRE--GTLIRVRVNPDADTTDLK--GVDEW---RGV
Y637_METTH       ------MITMDCLRE---------VGD--DLLVNIEVSPASGKFGIP--SYNEW---RKR
Y2072_ARCFU      ------------MRE---------AKD--GVLISVHVSPGSKEVSF---SYDEW---RRA
Y1055_METMP      -------MIEKMVKE---------SEK--GILIDIEVTTNAKKNEIG--KINEW---RKR
Y538_METM5       -------MIEKIVKE---------SEK--GILIDIEVTTNAKKNEIG--KINEW---RKR
Y309_METM7       -------MIEEIVKE---------SEK--GILIDIEVTTNAKKNEIG--KINEW---RKR
Y378_METVS       -------MIEEIIKK---------TEK--GVLIDIEVTTNAKKNEIG--KINKW---RKR
Y618_METJA       -------MIEKIIKE---------SRE--GVLIDIDVQANAKKNEIV--GINEW---RKR
Y841_META3       -------MINEIIRE---------SKDKNGILIDVEISSNAKKNEIG--EINEW---RKR
Y4097_METAC      --MMTYMSFEEAIKT---------LDS--GIIIEIEVTPGSRSLSVPS-GYNEW---RKR
Y822_METMA       ---MRSMSFEEAIKS---------LDS--GIIVDIEVTPGSRSLSVPS-GYNEW---RKR
Y7140_RICRS      --------MDKFYNY---------NSSSHQALLSFKVKPNSKQNLISNFVIINN---IQY
Y1526_RICRO      --------MDKFYNY---------NSSSHQALLSFKVKPNSKQNLISNFVIINN---IQY
Y1301_RICCN      --------MDKFYNY---------NSSSHQALLSFKVKPNSKQNLISNFVIINN---IPY
Y1332_RICFE      --------MNKFYNY---------NSSSHQVLLNLKVKPNSKQNLISDFVIINN---IPY
Y6510_RICAH      --------MDKFYNY---------NSSLHQVLLNLKVKPNSKQNLISNFVIINN---IPY
Y5380_RICCK      --------MDKFYNY---------NSSSNQALLNLKVKPDSKQNLISDFVIINN---LPY
Y827_RICTY       --------MNKFYIY---------NNFKNEALINIKVKPYSKQNLINNFVIINN---IPY
Y839_RICPR       --------MNKFYIY---------NSFKHEALINVKVKPYAKQNLIGNFVIINN---IPY
Y633_RICBR       ---------MKFFVY---------NPLLKTASLNIKVKAAAKSNDIKEFIIIND---VLH
                                                       . .                   

YGGU_ECOL6       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAA
YGGU_ECOLC       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAA
YGGU_ECOL5       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAA
YGGU_SHIFL       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAA
YGGU_ECOK1       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAA
YGGU_ECOLI       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAA
YGGU_ECO57       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEVAA
YGGU_SALPB       VKVAITAPPVDGQANSHLTKFLGKQFRVAKSQIVIEKGELGRHKQVKIIHPQQIPPEIAA
YGGU_SALTI       VKVAITAPPVDGQANSHLTKFLGKQFRVAKSQIVIEKGELGRHKQVKIIHPQQIPPEIAA
YGGU_SALTY       VKIAITAPPVDGQANSHLTKFLGKQFRVAKSQIVIEKGELGRHKQVKIIHPQQIPPEIAA
YGGU_SALPA       VKVAITAPPVDGQANSHLIKFLGKQFRVAKSQIVIEKGELGRHKQVKIIHPQQIPPEIAA
YGGU_SALAR       VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVAIEKGELGRHKQVKIIHPQQIPPEIAA
Y4329_CITK8      VKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQVKIIHPQQIPPEIAA
Y3323_KLEP7      LKVAITAPPVDGQANAHLVKFLAKQFRVAKSQVLIEKGELGRHKQVKIIAPQQIPTAVAA
Y3359_ENT38      LKVAITAPPVDGQANAHLTKYLAKQFRVAKSQVIIEKGELGRHKQVKILNPQNIPTEVAA
Y387_CROS8       LKVAITAPPVDGQANAHLVKYLAKQFRVAKSQVVIEKGELGRHKQVKIIEPQQIPTEVAA
Y827_YERP3       LKVAITAPPVDGQANAHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTI
Y3216_YERPS      LKVAITAPPVDGQANAHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTI
Y944_YERPE       LKVAITAPPVDGQANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTI
Y3141_YERPN      LKVAITAPPVDGQANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTI
Y571_YERPP       LKVAITAPPVDGQANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTI
Y321_YERPA       LKVAITAPPVDGQANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTI
Y4033_SERP5      LKVAITAPPVDGQANAHLIKFLAKQFKVAKGNVTIEKGELGRHKQLRIVNPQQIPDVVAA
Y3436_YERE8      LKVAITAPPVDGQANAHLIKFIAKQFRVAKSQVIIEKGELGRHKQIKIVNPQQIPPEVAT
Y3630_PECAS      LKVAITAPPVDGQANAHLTKFLAKQFRVAKSLVVIEKGELGRHKQIRITHPQHIPADVAE
Y3628_AERS4      LKVAITAPPVDGQANSHLIKYLAKQFKVAKGQVRIVRGELGRHKTVAIESPRQIPAEIHA
Y3661_AERHH      LKVAITAPPVDGQANSHLIKYLAKQFKVAKGQVRIVRGELGRHKTVAIEAPRQIPAEVSA
Y1210_VIBC3      LKVAITAPPIDGKANAHLSKYLAKLCKVAKGSVVIEKGELGRHKQVRILQPSQIPAEITA
Y458_VIBCH       LKVAITAPPIDGKANAHLSKYLAKLCKVAKGSVVVEKGELGRHKQVRILQPSQIPAEIAA
Y3581_VIBCB      LKIAITAPPVDGKANAHLTKFLAKQFKVAKGLVHIEKGELGRHKQIRIESPVQIPTEIKA
Y2619_VIBPA      LKIAITAPPVDGKANAHLTKFLAKQFKIAKGLVHIEKGELGRHKQIRIESPVQIPAEVKA
Y1522_VIBVU      LKIAITAPPVDGKANGHLTKLLGKWFKVAKSLVTIEKGELGRHKQVRVHTPQQIPDEVKA
Y2877_VIBVY      LKIAITAPPVDGKANGHLTKLLGKWFKVAKSLVTIEKGELGRHKQVRVHTPQQIPDEVKA
Y1134_SHELP      LKVAITAPPIDGKANAHLCKFLAKQFKTAKGNILIEKGELGRHKQIRVVMPKEIPEAISV
Y2690_SHEPC      LKVAITAPPIDGKANAHLSKYLAKAFKVPKSDVYIIKGELGRHKQIRIVTPKLIPPEVSE
Y1321_SHESW      LKVAITAPPIDGKANAHLSKYLAKAFKVPKSDVYIIKGELGRHKQIRIVTPKLIPPEVSE
Y1261_SHESR      LKVAITAPPIDGKANAHLSKYLAKAFKVPKSDVHILKGELGRHKLVRISAPKNVPAEIAT
Y1190_SHESM      LKVAITAPPIDGKANAHLSKYLAKAFKVPKSDVHILKGELGRHKQVRISAPKNVPAEIAT
Y1191_SHESA      LKVAITAPPIDGKANAHLSKYLAKAFKVPKSDVHILKGELGRHKQVRISPPKNVPAEIAT
Y3356_SHEON      LKVAITAPPIDGKANAHLSKYLAKAFKVPKSDVHILKGELGRHKQVRINAPKSVPAEISA
Y3043_SHEB8      LKVAITAPPIDGKANAHLSKYLAKTFKVPKSDIHIMKGELGRHKQIRVIDPKIIPSIITE
Y3028_SHEB5      LKVAITAPPIDGKANAHLSKYLAKTFKVPKSDIHIMKGELGRHKQIRVIDPKIIPSIITE
Y3186_SHEB9      LKVAITAPPIDGKANAHLSKYLAKTFKVPKSDIHIMKGELGRHKQIRVIDPKIIPSIITE
Y2863_SHEFN      LKIAITAPPIDGKANAYLSKYLAKACKVAKSQVHIIKGEQGRHKQIRISQPQVIPPEIAA
Y1229_SHESH      LKIAITAPPVDGKANAHLIKYLSKAFKVPKGDIVILKGQLGRHKQIKILSPRLIPEIINA
Y1977_ACTSZ      LKISITAPPVDGAANAHLIKYLSKAFKVPKSAVQLEKGELNRHKQVFIPAPKIIPEAVRQ
Y322_MANSM       LKIAITAPPVDGAANAHLLKYLSKAFKVPKSAIILEKGELNRHKQLFIPEPKLIPEELQP
Y778_HAEDU       LKVAITAPPVDGAANAYLLKYLSKLFKVPKSSIVLEKGELQRHKQLFVPAPKLLPKEIEQ
Y1380_ACTP2      LKIAITALPVDGAANAHLLKYLSKLFKVPKSSIVLEKGELQRHKQLFVPEPKLIPKEIEA
Y1313_PASMU      LKITITAPPIDGQANAHLLKFLSKTFKVPKSSIVLEKGELNRHKQILIPNPKVIPTEVNV
Y2480_SHEAM      LKLAITAPPVDGKANAHICKLLAKAFKVPKGKVSIERGELGRHKLVRIQAPEIIPDDFAQ
Y3043_PSYIN      LKIAITAPPVDGKANAHLIKFLSKQFKVAKGAIIIEKGLLSRHKRVRVCAPKKMPEFFNS
Y5841_PSEF5      LKIRLTAPPVEGKANAHLMAFLAKAFGIPKSNVSLVSGELNRQKRVRLQAPKKLPDLPGL
Y5322_PSEPF      LKIRLTAPPVEGKANAYLMGFLAKAFGVSKSQVSLLSGELNRQKRVRIGAPKKLPDLPGL
Y4153_PSEMY      LKIRLTAPPVEGKANAHLLAFLAKAFGVAKAQVSLESGELNRHKRLRIHAPQRLPTLPGL
Y3000_NITOC      LKIRITAPPVEGKANTHLLRFLAKTFQVSRNQVYLLSGATSRDKRVRIEKPTKL--LPGI
Y3835_GLOVI      FKVRLAAPPVEGKANAECVALIAAFFGVPRRQVSLVQGQQGRHKKIRIEAPADLLLVALQ
Y3654_MAGMM      LKVALNAPPVDGAANKALCHFLAKQLGIAKGQVTLVRGEKSREKQLVIQG--ISPSIWQQ
Y3887_DECAR      LKIRLAAPPVDGKANEALIRFIADALGLAKSAVHLKSGQTSRRKVLEIL--GTSTTTIAG
Y3464_AZOSB      MKIRLAAPPVDGKANAALCAFLADFCEVPKSAVTLVSGETSRAKRVRV---ETKTPGLAG
Y395_NITEU       LKIKLAALPVDGKANRALTEFLAKRFNVPRKNITLKRGEQSRHKVVEVCQSSNGPEVLFS
Y2146_NITEC      LKIKLAAPPMDGKANRALAVFLAKRFNVPLKHITLKWGAQSRHKVVEIYQPVNGPEVLFN
Y1126_ANADF      LKIQLAAPPVDGAANAALVEFLAEALEVRKQDVVLVRGETGRRKAVRVTSVSAARAVAAL
Y1087_ANADE      LKIQLAAPPVDGAANAALVEFLAVALGVRRADVALLRGEAGRRKTVRVAGITAAAAVAAL
Y959_SYNWW       LKIKVMAPPVEGAANQALQKFLAELFKLPKKDIRIVRGETSRHKIVEIRGIEAEKLLAFI
Y247_CHLCV       LKIRVTEAPEKGKANEAVIALLAKTLSLPKRDVTLISGETSRKKRLLLPKSTESIISHWR
Y243_CHLAB       LKIRVTEVPEKGKANEAVIALLAKALSLPKRDITLIPGDTSRKKRILLPKSTESIVSHWR
Y497_CHLPN       LKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRVQDIIFSLH
Y423_CHLTA       LRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSIKAFLLEQF
Y388_CHLTR       LRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSIKAFLLEQF
Y667_CHLMU       LRVRVTEAPERGKANDAVVALLAKFLSIPKNDVTLIAGEASRRKKVLLPRAIKAFLFEQF
Y3569_MYCGI      LTLYVQERAVDGKANEAVTKLLAEHLGVPRSRIELVSGATSRHKRFRIG-----------
Y2846_MYCVP      LTVYVRERAVDGKANAAVIRVLAEHFGVPRSLVELTGGASSRIKRFRIG-----------
Y1997_MYCTA      LIIYVREPAIDGKANDAVTRLLAAHLQLPKSRVKLVSGATSRFKRFRLSR----------
Y2174_PARDP      IRVTVTTVPEDGKANAAVVKLLAKALGVAKSRLVLVRGATARDKLFRID-----------
Y8260_RHOBA      LKVSVHTVPEDGKANKAVIASLAKWLRVSKGRVAIVAGETSRLKTIVVEFKSQDEMNTAD
Y109_RHOP2       VKLRVRAIADGGEANRAVIELLAKALGVPKRNVRLLSGATSRQKQIAIDG-DPKSLGETL
Y058_RHOPB       VKVRVRAIAEGGEANRAVTELLAKALGVPKRAVRVLSGTTSRLKQVAVDG-DPNELGEAL
Y4503_RHIL3      LKARVTAVPEKGKANKALMLLIAKSLRIPKSSVSLVSGETARKKILRIDG-DPEDLVKKL
Y3912_RHIEC      LGARVTAVPEKGKANKALIALVSKSVGVAKSSVSVISGETARKKILRIEG-DPEDLARKL
Y2660_AGRFC      LKARVSAVPEGGKANKALIVLLAKKLGLPKSSITFISGETARKKILRIDT-DPEDFEKLF
Y4154_RHILO      LKARVRAVPENGAANQALERLVAKTLGVPASSVSVVAGGTSRLKTVRIVG-DPEALAQRV
Y3622_CAUVC      LKVRVASPPVEGAANAALIAFLAKTLKIPRSAVRLAAGETARLKRLELEGVDPADVARAF
Y1821_PELTS      LKIRLTAPPVDGEANEACRAFLADSLSLPPSKVEIVSGHASRTKVVKIAGVGAEKVRRAF
Y717_DESRM       LKVRLTAPPVDGAANEACCKFFGELFGVAKSKVEIIAGHTGRNKLVHIQGVTEKQARFIL
Y4205_KORVE      LKLGVTDPPIDGRANEALIRFVAGLLKVTRSSVTIAAGESSRNKVIRIEGVTAEQVRFRL
Y338_PELLD       LKVTLKAAPVDDAANRECCRLFSKLFSIPDSRVSIVSGAASRTKSVMLEGLSAEEARSIL
Y403_CHLPM       LKITLKAAPVDDAANRECCRLFAGMFGIADGRVHVVSGRSSRSKSVMLEGVSSREAEEAF
Y319_CHLCH       LKVHLQSPPVDDAANEECCRLLARLFQVPPSRVHLVAGHSSRNKRVMVEGVSAAMATELL
Y2081_CHLPD      VKVNLKAAPVDDAANRECCDLFAKVLSVSSSRLTILSGKSSKNKTIKVEGLGAEEVALLL
Y1832_CHLTE      LKICLKSAPVDNAANKECCELLAKALGVPRSSVSVMKGASSRSKVLKVEGVTPAAVREAL
Y1103_DEHMB      LKLKIAAQPEKGKANKELIDYLSDLLDTPKAEIEICHGHTGRNKVLAFFTLSQADFEAKI
Y1230_DEHMC      LKLKIAAQPEKGKANKELIDYLSDLLDTPKAEIEICHGHTGRNKVLAFFTLSQADFEAKI
Y1292_DEHM1      LKIKIAAQPEKGKANKALVDYLSELLDTPKSEIEICRGLSGRNKVVAFYSLSQADFEAKI
Y3894_TRIV2      LTVHLKSPPVDGKANEELIKLLAEKFAVPKSHITIKSGLSSRQKLIEIDTDI--------
Y3196_NOSS1      LTVHLKSPPVDGKANEELIKLLAEKFDVPKSHITIKSGLSSKQKLIEIETDI--------
Y1736_LEPIN      LTIAVREPALEGKANEAVIESISKEMKVPKSKIRILSGQKNKKKIIEIDL----------
Y2068_LEPIC      LTIAVREPALEGKANEAVIESISKEMKVPKSKIRILSGQKNKKKIIEIDL----------
Y1994_THEEB      LLVTVRAPASDGQANQELIALLAAYFGVPKSRIQLVKGHTSRHKVIELLD----------
Y182_AERPE       LVFYTDEPPLEGRANASLINFLARGLKVSVKNIEIVHGARSRSKVVEIRDVADPDALLER
Y501_PYRAB       IKVNIKAQPVKGKANRELIKFLSNLFGA---EVEILKGETSREKDVLVRGVNLEEVKRRL
Y1765_PYRFU      VKVNVAAPPVKGKANKELMKFFKKLFGA---EVVIVRGETSREKDLLIKGITKKEVIEKL
Y768_THEKO       LKVRIAAPPVEGKANKEVVKFFSKLLGA---EVNIVRGETSREKDLLVKGLSVEEVRKKL
Y273_METKA       LEVDVAAPPVKGKANRELLEFLGRKLNT---TCELVSGEKSREKLVLARDVSVDEVKERL
Y637_METTH       IEVKIHSPPQKGKANREIIKEFSETFGR---DVEIVSGQKSRQKTIRIQGMGRDLFLKLV
Y2072_ARCFU      VEVRIKSPAKEGKANRELLGIFRQIFG----EVELVSGEKSRSKVLKGK---RE------
Y1055_METMP      IEIRIKEQPIEGKANKAIIKFLKGIFKS---EILINSGTTSSQKTVLIPDKTKDDVV-TI
Y538_METM5       IEIRIKEQPIEGKANKAIMKFLKGIFKS---EILINSGTTSAQKTVLIPDKTKDDIV-KI
Y309_METM7       IEIRIREQPIEGKANKAIVKFLKGIFKS---EIFINSGTTSSQKTVLIPDKTKEDVV-KI
Y378_METVS       LEVKIKEQPIEGRANKAILKFLKEIFKT---DVELNPVTTSPQKTVLISCDTKEYVV-NI
Y618_METJA       LSIKIKAPATEGKANKEIIKFFKEIFKK---DVEIVSGKLNPQKTVLIGDIKKDEVI-EI
Y841_META3       LIIKIKALPVDGKANKEIAKFFKKTFGK---DIIIVSGLTSSQKTICVIGATKDEIIDKI
Y4097_METAC      IAVKLTKNAQKGKANEQLIESLAELFGISSSEILINSGATSSKKSLLIKGISYQQAVSVL
Y822_METMA       IEVKLTRNAQKGKANEQLIESLAELFGICSSDIFISSGATSSKKSLLIKGVSYQQAVLVF
Y7140_RICRS      LKLSIKAIPEQGKANSEIINYLAKEWKLSRSNIEIIKGHTHSLKTILIKNINEDYLNLII
Y1526_RICRO      LKLSIKAIPEQGKANAEIINYLAKEWKLSRSNIEIIKGHTHSLKTILIKNINEDYLNLII
Y1301_RICCN      LKLSIKAIPEQGKANEEIINYLAKEWKLSRSNIEIIKGHTHSLKTILIKNINEDYLNLII
Y1332_RICFE      LKLSIKATPEQGKANEEIINYLAKEWKLSRKDIEIIKGHTNSLKTILIKNIDEDYLNLII
Y6510_RICAH      LKLSIKATPEKGKANEEIINYLAKAWKLSRSNIEIIKGHTHSVKTILIKNINEDYLNFII
Y5380_RICCK      LKLFIKTAPEQGKANEEIINYLAKAWKLSRSNIEIIKGHTHSLKTILIKNIDEDYLNSII
Y827_RICTY       IKLSITAAPEQGKANEGIINYLAKEWKLSRSSIEIIKGHTHSLKTILIKNINEDYLNLII
Y839_RICPR       IKLAIKATPEQGKANEGIIHYLAKEWELSRSSIEIIKGHTHSLKTILIKNINEDYLNLII
Y633_RICBR       LKLSIKAHAQQGKANEEIINFLAKEWQLLRSNLEITKGHTNSLKTILIKNIDEEYLNLIL
                 .       .  . **      .            .        * .              

YGGU_ECOL6       LIN---------
YGGU_ECOLC       LIN---------
YGGU_ECOL5       LIN---------
YGGU_SHIFL       LIN---------
YGGU_ECOK1       LIN---------
YGGU_ECOLI       LIN---------
YGGU_ECO57       LIN---------
YGGU_SALPB       LTE---------
YGGU_SALTI       LTE---------
YGGU_SALTY       LTE---------
YGGU_SALPA       LTE---------
YGGU_SALAR       LTE---------
Y4329_CITK8      LTD---------
Y3323_KLEP7      LTE---------
Y3359_ENT38      LTE---------
Y387_CROS8       VTD---------
Y827_YERP3       LLK---------
Y3216_YERPS      LLK---------
Y944_YERPE       LLE---------
Y3141_YERPN      LLE---------
Y571_YERPP       LLE---------
Y321_YERPA       LLE---------
Y4033_SERP5      LIE---------
Y3436_YERE8      LLE---------
Y3630_PECAS      FIE---------
Y3628_AERS4      LLETQG------
Y3661_AERHH      LLDNQG------
Y1210_VIBC3      LIE---------
Y458_VIBCH       LIE---------
Y3581_VIBCB      II----------
Y2619_VIBPA      IL----------
Y1522_VIBVU      IL----------
Y2877_VIBVY      IL----------
Y1134_SHELP      LIP---------
Y2690_SHEPC      LLE---------
Y1321_SHESW      LLE---------
Y1261_SHESR      LLE---------
Y1190_SHESM      LLE---------
Y1191_SHESA      LLE---------
Y3356_SHEON      LLE---------
Y3043_SHEB8      LMGQTS------
Y3028_SHEB5      LMGQTS------
Y3186_SHEB9      LMGQTS------
Y2863_SHEFN      LLSPFSL-----
Y1229_SHESH      LL----------
Y1977_ACTSZ      LLDNP-------
Y322_MANSM       LL----------
Y778_HAEDU       WL----------
Y1380_ACTP2      LL----------
Y1313_PASMU      LLK---------
Y2480_SHEAM      FL----------
Y3043_PSYIN      LNE---------
Y5841_PSEF5      ARPA--------
Y5322_PSEPF      CRP---------
Y4153_PSEMY      IFPGK-------
Y3000_NITOC      TPPIRKTVR---
Y3835_GLOVI      KLS---------
Y3654_MAGMM      FLERHGV-----
Y3887_DECAR      LADR--------
Y3464_AZOSB      RLRALG------
Y395_NITEU       EMRAE-------
Y2146_NITEC      EIRAE-------
Y1126_ANADF      VH----------
Y1087_ANADE      AP----------
Y959_SYNWW       PQITK-------
Y247_CHLCV       EHGL--------
Y243_CHLAB       EKGFYAGL----
Y497_CHLPN       IDV---------
Y423_CHLTA       PSESSSTTGKKS
Y388_CHLTR       PSESSSTTGKKS
Y667_CHLMU       PQTSSPDAGKKC
Y3569_MYCGI      ------------
Y2846_MYCVP      ------------
Y1997_MYCTA      ------------
Y2174_PARDP      ------------
Y8260_RHOBA      AKLKKELS----
Y109_RHOP2       RQLTAAKPAG--
Y058_RHOPB       RKLTAPKPD---
Y4503_RHIL3      EIFLG-------
Y3912_RHIEC      EVFLE-------
Y2660_AGRFC      KKLAG-------
Y4154_RHILO      EALG--------
Y3622_CAUVC      GPPN--------
Y1821_PELTS      GL----------
Y717_DESRM       K-----------
Y4205_KORVE      KVW---------
Y338_PELLD       RNSSIPGL----
Y403_CHLPM       ERFGL-------
Y319_CHLCH       QPFLHT------
Y2081_CHLPD      RPYL--------
Y1832_CHLTE      VGMLGDEAEAGA
Y1103_DEHMB      SAALHGS-----
Y1230_DEHMC      SAALHGS-----
Y1292_DEHM1      SAILRGS-----
Y3894_TRIV2      ------------
Y3196_NOSS1      ------------
Y1736_LEPIN      ------------
Y2068_LEPIC      ------------
Y1994_THEEB      ------------
Y182_AERPE       LASIVDEG----
Y501_PYRAB       KL----------
Y1765_PYRFU      EL----------
Y768_THEKO       GV----------
Y273_METKA       GLR---------
Y637_METTH       SEKFGLEIP---
Y2072_ARCFU      ------------
Y1055_METMP      LKKEIKSI----
Y538_METM5       LKKEIKSI----
Y309_METM7       LKKEIKSI----
Y378_METVS       LKREIKSV----
Y618_METJA       LKRYL-------
Y841_META3       LKNNI-------
Y4097_METAC      GARLKE------
Y822_METMA       GKHLKG------
Y7140_RICRS      NSYIK-------
Y1526_RICRO      NSYIK-------
Y1301_RICCN      NSYIK-------
Y1332_RICFE      NSYIK-------
Y6510_RICAH      NSYIR-------
Y5380_RICCK      NSYIK-------
Y827_RICTY       NSYIK-------
Y839_RICPR       NAYIK-------
Y633_RICBR       KPYIK-------