CLUSTAL format seed alignment for MF_00636

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RAPZ_ECOLI       -----------------------------------------------MVLMIVSGRSGSG
RAPZ_PROMH       -----------------------------------------------MVLMIVSGRSGSG
Y584_HAEDU       -----------------------------------------------MELVIISGRSGSG
Y087_HAEPS       -----------------------------------------------MELIIMSGRSGSG
Y1718_MANSM      -----------------------------------------------MELIIISGRSGAG
Y169_PASMU       -----------------------------------------------MEIIIISGHSGAG
Y1595_HISS2      -----------------------------------------------MEIIIISGRSGAG
Y2532_VIBCH      -----------------------------------------------MRLIVVSGQSGAG
Y2760_VIBA3      -----------------------------------------------MRLIVVSGQSGAG
Y2673_VIBPA      -----------------------------------------------MRLIVVSGHSGAG
Y445_VIBVY       -----------------------------------------------MRLIVVSGHSGAG
Y495_ALISL       -----------------------------------------------MKLMVVSGNSGAG
Y3258_PHOPR      -----------------------------------------------MQLMVVSGRSGSG
Y571_PSEA6       -----------------------------------------------MKLIIISGRSGSG
Y4546_COLP3      -----------------------------------------------MKLIIVSGRSGSG
Y2554_PSET1      -----------------------------------------------MELIIISGRSGSG
Y318_AERS4       -----------------------------------------------MQLIVVSGRSGSG
Y393_IDILO       -----------------------------------------------MQLIIVSGRSGSG
Y3091_SHEAM      -----------------------------------------------MKLVIVSGRSGSG
Y674_SHEPW       -----------------------------------------------MKLVLVSGRSGSG
Y2894_PSYIN      -----------------------------------------------MKLIVISGRSGSG
Y127_PSYCK       -----------------------MQANQDTHNAQSKLTDSNESTGDKLSILVVSGRSGSG
Y2129_PSYWF      -----------------------MSANESVVTADLKPR---VPSTGSVDVLIVSGRSGSG
Y3059_ACIAD      ----------------------------------------------MKRILIVTGQSGSG
Y549_ALCBS       -----------------------------------------------MKLTIISGRSGSG
Y2229_CHRSD      -----------------------------------------------MQLVIISGRSGSG
Y5324_HAHCH      -----------------------------------------------MKLIIVSGRSGSG
Y2718_MARHV      -----------------------------------------------MKLIIVSGRSGSG
Y5038_PSEA7      -----------------------------------------------MRLIIVSGRSGSG
Y2809_CELJU      -----------------------------------------------MHLVIVSGLSGSG
Y3181_SACD2      -----------------------------------------------MRLLVISGRSGSG
Y739_METCA       -----------------------------------------------MRLIIVSGFSGSG
Y722_THISH       -----------------------------------------------MKLIIVSGLSGSG
Y2797_NITOC      -----------------------------------------------MKLHIISGVSGSG
Y2233_ALKEH      --------------------------------------------MKSIRLIIISGLSGSG
Y2130_HALHL      --------------------------------------------MSGLRLIVVSGLSGSG
Y950_STRM5       ---------------------------------------MSTAPPSAPTLIIVSGLSGSG
Y1354_XANCB      --------------------------------------------------MIVSGLSGSG
Y753_XYLFM       ------------------------------------------MKPPEHSLIIISGLSGSG
Y2629_ACIF5      --------------------------------------------MAERDFIIVSGLSGSG
Y3603_ACIAC      ------------------------------------------MMADTLEIVLITGMSGSG
Y1053_VEREI      ---------------------------------------------MVLEIVLITGMSGSG
Y831_ACIET       ---------------------------------------------MDLEVVVITGMSGSG
Y1300_POLSJ      -------------------------------------------------MVLITGMSGSG
Y1653_RHOFT      ----------------------------------------MKSEADNLQIVLITGMSGSG
Y5422_DELAS      ---------------------------------------------MSLEIVLITGMSGSG
Y3490_LEPCP      --------------------MSSRPPYLPPIPTHVPGATAAELAALPEPVILISGISGGG
Y3336_METPP      --------------------MSQ-------------DTVAPALPDAPREVVLVTGISGSG
Y3158_BORA1      ----------------------------------------------MLRVVLITGISGSG
Y322_PARP8       -----------------------------------------------MRIILITGISGSG
Y403_RALSO       -----------------------------------------------MRIILITGMSGSG
Y3120_JANMA      -----------------------------------------------MRIILITGISGSG
Y1915_POLAQ      -----------------------------------------------MQINLITGISGSG
Y399_AZOSB       -----------------------------------------------MQIVLISGLSGSG
Y2061_AROAE      -----------------------------------------------MQIVLISGLSGSG
Y081_NITMU       -----------------------------------------------MQVIVISGLSGSG
Y529_THIDA       -----------------------------------------------MQIVLVSGLSGSG
Y1559_NITEC      -----------------------------------------------MQVIIISGLSGSG
Y070_DECAR       -----------------------------------------------MELILISGLSGSG
Y3336_CHRVO      -----------------------------------------------MRLILISGLSGSG
Y145_METFK       -----------------------------------------------MQLVIVTGLSGSG
Y2029_LARHH      -----------------------------------------------MQLILISGLAGSG
Y698_NEIM0       -----------------------------------------------MKIVLISGLSGSG
Y399_DICNV       -------------------------------------------------MLIVTGMSGAG
Y2060_FRASN      ------------------------------------------MTAATLDLAIITGLSGAG
Y5570_STRGG      MTENTHETAPNTADTDTADFDTADTDRADGAADVSTNTPNETGEAAIPELVIISGMSGAG
Y2020_THEFY      -------------------------------------MATSRGDDLLPEIVVVTGMSGAG
Y1111_ACIC1      -------------------------MTGDVRRLPDGHAAPALNPLTGIKLVVLTGLSGAG
Y2139_SACEN      ----------------------------------------MSEEQTGIEVAVVSGLSGAG
Y1815_MYCUA      --------------------------MTNHIAGGGNPPGPEGDASAGIDVVLVTGLSGAG
Y2783_MYCA9      --------------------------MESMTL---HPPSE--TANADIDVVLVTGLSGAG
Y3026_RHOE4      ---------------------------MTTDSAKDS---------RTMDFLLVTGLSGAG
Y3593_NOCFA      -----------------------MTRVESNNTASQAPPSGAGTLEQQVEVVIVTGLSGAG
Y3101_SALTO      -----------------------------MIEGQTSVPGEPDPSGTDTTLVVVTGVSGGG
Y2084_PAEAT      ----------------------MDEATA---KSGTEQDGLTPVKPPEAELLVVTGMSGAG
Y2275_RENSM      ----------------------MTDSTP---EAGAEGE-FTPVKPQESELLVVTGMSGAG
Y1207_KOCRD      ----------------------MSTPPP---DAAPTLE---PVKPPTAELLIVTGMSGAG
Y2934_KINRD      ----------------------MQDAAGRDRDPAVEVE-----RPRRPELLIITGMSGAG
Y1991_CLAMS      ----------------------MHARMS------VEIP--------QQDVMIVTGMSGAG
Y1149_LEIXX      ----------------------MTSDVE------TTAE--------QQEVLIVTGMSGAG
Y2527_NOCSJ      ----------------------MPSNSAS--ERSTTIP-----DRTPGELVVVTGMTGAG
Y813_CUTAK       --------------------------------------MSTEQTTKTPRVVIITGISGAG
Y1368_BIFA0      ------------------MQSARNEQRGTG----PESP-HAASPTEGFEVLLITGMSGAG
Y1085_BIFLS      -----MSQQTTIRDTGEAAATNAPANSATS----TSTPDNQPTPLDAFEVLLITGMSGAG
Y1710_COREF      ------------------MNQTPGSTVPETATPVTSPASSPSAPETTFTPVIITGMSGAG
Y1313_CORDI      ------------------MNLNMRTDV---------------EPRTEIPPVVITGLSGAG
Y1197_CORA7      ------------------MEAMTLFDS---------------------PPILITGMSGGG
Y1004_CORJK      ------------------MSASTQQEP---------------------SLILITGMSGAG
Y2009_RUBXD      ----------------------------MS---EEAPHPTRTPAAQRRQIVVITGLSGAG
Y5766_SORC5      ----------------------------MSNGGDQQQHGLLGPDGAPGRVVVVTGLSGAG
Y3782_KORVE      -----------MPLRK-----TKKKKVLPKSPRAPKLQP--------SELVIITGLSGSG
Y7395_SOLUE      -----------MPLRKKGAATTKAAATRKDSAKAPASSKRKDAPQHKPELVIITGLSGSG
Y619_ACIC5       -----------MPAPE----PTRRAKKDASASPSPAHPA-------SRELVILTGLSGAG
Y152_ANADF       --------------------------------------MNELVNRGGPEVVILTGVSGSG
Y6564_MYXXD      ------------------------------------------MTAPAKQIVIITGMSGSG
Y1884_GEOSL      -----------------------------------------------MRVLVITGLSGSG
Y2968_GEOUR      -----------------------------------------------MRILIITGLSGSG
Y872_GEOBB       -----------------------------------------------MRIVIITGLSGSG
Y2163_GEOLS      -----------------------------------------------MRIVVITGMSGSG
Y977_PELPD       -----------------------------------------------MRIIVITGMSGSG
Y1935_PELCD      --------------------------------------------MKRARLIIITGLSGSG
Y1358_DESAL      --------------------------------------------MERLKIVIITGLSGSG
Y503_DESOH       --------------------------------------------MRNFIIHILTGLSGSG
Y2790_DESAH      --------------------------------------------MNRQSLFILTGLSGSG
Y1217_SYNAS      ------------------------------------------MKMNNLRVVIITGLSGSG
Y2066_SYNFM      -----------------------------------------------MHVVVVTGLSGSG
Y4092_ALKMQ      -----------------------------------------------MKFVIITGLSGAG
Y574_ALKOO       -----------------------------------------------MKFVIITGLSGAG
Y3400_CLOD6      -----------------------------------------------MKFVIVTGLSGSG
Y1284_CLONN      -----------------------------------------------MRFVIVTGLSGAG
Y2495_CLOTE      -----------------------------------------------MRFVIVTGLSGAG
Y511_CLOAB       -----------------------------------------------MRFVIVTGLSGAG
Y4857_CLOB8      -----------------------------------------------MRFVIVTGLSGAG
Y335_CLOPS       -----------------------------------------------MRFVIVTGLSGAG
Y2290_RUMCH      -----------------------------------------------MRFVIVTGMSGAG
Y113_HUNT2       -----------------------------------------------MRLLIITGISGAG
Y1834_CALS4      -----------------------------------------------MRFVIITGLSGAG
Y331_LACP7       -----------------------------------------------MRFVIVTGMSGAG
Y1160_CALS8      --------------------------------------------MILLETVIVTGMSGAG
Y1084_FINM2      -----------------------------------------------MEVVIVTGMSGAG
Y1588_HALOH      -----------------------------------------------MQFLIVTGMSGAG
Y262_SYNWW       ----------------------------------------MGEKNEELQILIITGLSGAG
Y646_HELMI       --------------------------------------MEKGFDKSAIQMVIITGLSGAG
Y258_MOOTA       -----------------------------------------MPETKYPRLVIVTGLSGAG
Y300_DESAP       --------------------------------------------MAGTRLLIVTGLSGAG
Y2729_PELTS      --------------------------------------------MFTPKLVIVTGLSGAG
Y3054_DESRM      -----------------------------------MSDSEGGVEVSSPRLLIVTGMSGAG
Y4845_DESHY      ------------------------------------------MLSKQVRLLVITGLSGAG
Y186_SYMTH       ----------------------------------------MMDVDRSIRLVIVTGMSGAG
Y272_CARHZ       -----------------------------------------------MRFLIVTGLSGAG
Y2024_NATTJ      --------------------------------------MRNENRFHEVRFVIITGMSGAG
Y3015_GEOTN      --------------------------------------MGQNGTVQPTQLVIITGMSGAG
Y2526_ANOFW      ----------------------------------------MSTGSAHVQMVIITGMSGAG
Y3115_BACP2      ---------------------------------------MNTHKQEDIQLVIITGMSGAG
Y3698_BACCN      -----------------------------------------MTENNDIKMVIITGMSGAG
Y3036_BACSK      -----------------------------------------MN-QSEVEIVIITGMSGAG
Y3569_BACHD      -----------------------------------------MNVKEEIDIVIITGMSGAG
Y2468_OCEIH      -----------------------------------------MNQEQETKLVIITGMSGAG
Y448_LYSSC       ------------------------------------MTVVVEGQQRTHELVIITGMSGAG
Y126_LISMH       ------------------------------------------MTSKQLKLVIITGMSGAG
Y5262_BREBN      --------------------------------------MTELGNDKAMNLLIITGMSGAG
Y2405_EXIS2      ------------------------------------------MEQNQPQLVIITGMSGAG
Y1952_STAS1      ------------------------------------MQPDEKEIV-KSELLVVTGLSGAG
Y414_STACT       ------------------------------------MQHEENEIVSKSELLVVTGMSGAG
Y516_MACCJ       ------------------------------------MSNED----TYKRLVVVTGMSGAG
Y526_LACSS       -----------------------------------------MTDT--LNLVVITGMSGAG
Y779_LACPL       -----------------------------------------MAES--LQLVIISGMSGAG
Y1073_LACCB      -----------------------------------------MTES--LDLVIITGMSGAG
Y1171_LACS1      ----------------------------------------MFMSA--LQLVIVTGMSGAG
Y651_LACBA       -----------------------------------------MTED--IRLVIITGMSGAG
Y450_PEDPA       -----------------------------------------MNER--LQFVVVTGMSGAG
Y766_ENTFA       -----------------------------------------MPEN--LQLVIITGMSGAG
Y831_STRT1       ----------------------------------------MKTKI--INLVVVTGMSGAG
Y619_STRS2       -----------------------------------------MSDK--LHLVIVTGMSGAG
YJIE_LACLA       -----------------------------------------MENK--LNIVIITGMSGAG
Y375_LACRJ       ----------------------------------------MVDKK--LKVVIITGMSGAG
Y356_LACF3       -----------------------------------------MAEQ--LEVVIITGMSGAG
Y556_LACDB       -----------------------------------------MHEKYKKQLLILTGMSGAG
Y866_LACJO       -----------------------------------------MAEQ-KKQLLIVTGMSGAG
Y1518_THEAB      ----------------------------------------------MKNLIILTGLSGAG
Y1373_THEM4      ---------------------------------------------MLKNLVVLTGLSGAG
Y1159_FERNB      ----------------------------------------------MKELVILTGHSGAG
Y898_THENN       ----------------------------------------------MKRVVVVTGLSGAG
Y523_PSELT       ----------------------------------------------MKRILVVSGLSGAG
Y154_PETMO       ----------------------------------------MITLLTKPTVFLITGLSGAG
Y125_ELUMP       -------------------------------------------MINNKKIFIITGLSGAG
Y433_ENDTX       -------------------------------------------MI---KLYIISGMSGAG
Y1089_FUSNN      --------------------------------------------MKTKHIIIVTGLSGAG
Y1129_DICTD      -------------------------------------------MDFQVFII--TGLSGAG
Y235_THEYD       -------------------------------------------MNFDKFIVIVTGLSGGG
Y1502_DESVV      --------------------------------MSSPARSADDGFEAGFPVLIVSGLSGAG
Y424_DESVM       ------------------------------------------MAAADFPVIIVTGLSGAG
Y1774_DESAG      -----------------------------------------MKKSESLPVLIVTGLSGAG
Y972_DESDA       -------------------------MSTATHPRPEGPVVETAAPMPPVAVCIVTGLSGAG
Y459_LAWIP       --------------MTLKKIIPNLQKTQNNNNNSISSPLLPHTVQEYFPVIIIVGMSGAG
Y1189_GLUDA      ----------------------------MTDSSHDGV-------PAPRRILLVTGLSGAG
Y815_GLUOX       ----------------------------MASANHPESGSISGYDHGSRRILIVTGLSGAG
Y395_GRABC       -----------------------------------------MSTDQYRRVVVITGLSGAG
Y446_ACICJ       ---------------------------------------------MSARMVIVTGLSGAG
Y4396_MAGSA      ----------------------MSDLHSSPTDQTSAPAHAG----GGNRVVIVTGMSGAG
Y3448_RHORT      -------------MGRSASLLRLRDPAPLPTDIAPDPAEAPPSPAADRRVIVVTGMSGAG
Y2868_RHOCS      ---------------MTGQPLTMETAAGADAGTGAATHPAD----GRRPVVVVTGMSGGG
Y2562_RHOS5      -----------------------------------MSEPAQ-----EYRLVLVTGPSGAG
Y2850_PARDP      ---------------------------MPEAMTAMDSQDER-----AQRLVLVTGPSGAG
Y209_DINSH       ------------------------------MTDTAPTPEKM-----PQKIVLVTGPSGAG
Y713_RUEPO       ----------------------------------------------------MTGPSGAG
Y2438_RUEST      --------------------------MTPKQSPNSETGAVT-----EPPLVLVTGPSGAG
Y1380_ROSDO      ----------------------------------MTDTSTT-----ARRIVFVTGPSGAG
Y539_JANSC       ---------------------------------MPPPNSAP-----PAQVVFVTGPSGAG
Y2120_ERYLH      --------------------------------------MSG-----RLDVLLVTGMSGAG
Y2904_NOVAD      -----------------------------------MSADSA-----PQRILLVTGLLGAG
Y2050_SPHAL      --------------------------------MSGQASPGA-----ESRLLLVTGLSGAG
Y1325_ZYMMO      -------------------------MSRNDLSSAPSSSAAP-----PARILLVTGLSGAG
Y399_SPHWW       ------------------------------MTKAGMTKAGE-----PRRILFVTGMSGSG
Y3333_MAGMM      ------------------------------------MDEHGVQTPQVTSLIVVAGLSGAG
Y725_COPPD       ----------------------------------------------MQKVIVVTGLSGAG
Y723_DEIGD       -----------------------------------------------MPFVVVSGLSGSG
Y1434_DEIRA      -----------------------------------------------MPFVIVSGLSGSG
Y319_THET8       -----------------------------------------------MRFLVLTGLSGAG
Y911_SYNJA       -----------------------------------MDDQATRPTAATSPVLVIAGLTGSG
Y4163_GLOVI      -------------------------------------MTSFSAPGSPVDTVLLTSPAGAG
                                                                       .  *.*

RAPZ_ECOLI       KSVALRALEDMGFYCVDNLPVVLLPDLARTLADRE------ISAA-VSIDVRNMPESPEI
RAPZ_PROMH       KSVALRALEDMGFYCVDNLPVDLLPELAKTLAERD------AAAAAVSIDVRNMPESPEI
Y584_HAEDU       KSVALRALEDVGYYCVDNLPFPLIAELASFLLASD------CSAV-VSLDIRNFPENLTR
Y087_HAEPS       KSVALRALEDLGYYCVDNIPLALIPQLTDYLEKLK------RSVV-VSLDVRNLPEDPDV
Y1718_MANSM      KSVALRALEDMGYYCVDNLPINLLPELADILSTSQ------QSAA-VSLDIRNLPHSPET
Y169_PASMU       KSVALRCLEDIGYYCVDNLPLDLLPQLASILSTNQ------QSVA-ISLDIRNLPHSSKT
Y1595_HISS2      KSVALRALEDIGYYCVDNLTMDLVPQLVDMLENKQ------HLVA-ISLDIRNLPQEPET
Y2532_VIBCH      KSVALRVLEDLGYYCVDNLPVSLLTAFIQSVQGSQ------QNVA-VSIDIRNLPKEPSL
Y2760_VIBA3      KSVALRVLEDLGYYCVDNLPVNLLNDFVESVREIN------QNVA-VSIDIRNLPKEPQL
Y2673_VIBPA      KSIALRVLEDLGYYCVDNLPVNLLDAFVHSIADSK------QNVA-VSIDIRNIPKKLKE
Y445_VIBVY       KSVALRVLEDMGYYCVDNLPVNLLESFIQSVSESK------QNVA-VSIDVRNIPKKLKE
Y495_ALISL       KSVALRVLEDLGYYCVDNLPVDLLAQFVESIQHSS------QNVA-VSVDIRNLPKDPSL
Y3258_PHOPR      KSVALRVLEDLGYYCVDNLPVTLLPQFISTVENNE------QDIA-VSIDVRNMPSESGV
Y571_PSEA6       KSIVLRSLEDLGYYCVDNIPVNLLPTLTHTVADEY------DQVA-VSIDVRNLPKDPNE
Y4546_COLP3      KSVALRVLEDLGYYCVDNIPINLLPALTHTVINDY------ENVA-VSLDVRNLPKDPED
Y2554_PSET1      KSVALRVVEDLGYYCVDNIPVNLLPSLVRSVSDNY------DKIA-VSIDVRNLPKDQQQ
Y318_AERS4       KTVALRVLEDLGYYCVDNLPVNLLPQLIVSVESQY------DKLA-VSIDVRNLPVSADK
Y393_IDILO       KTIALRVLEDLGFYCVDNLPISLLPTLVHAVIEQY------QKIA-ISIDVRNLPEHSEE
Y3091_SHEAM      KSVALRVLEDLGYYCVDNLPLQLIGPLLAQLKGNN------DKVA-ISIDIRNMPEQEKA
Y674_SHEPW       KSVLLRMLEDLGYYCVDNLPLPMMGTLLEQLTGNS------ELVA-ISVDIRNMPEKDTE
Y2894_PSYIN      KTIALHVLEDLGYNCIDGVPFQLLAQLIDTVDPKN------NKVA-ISLDIRNLPTDASQ
Y127_PSYCK       KTSVLNILEDLGFYSIDNLPLSLVPEAAQKLVCDSG----IKRIA-LGVDIRTPRADLSN
Y2129_PSYWF      KTSVLNILEDLGYYVIDNMPLSLLSDAAHKLTEDGG----ITNLA-LGVDIRTLKADSAS
Y3059_ACIAD      KSSALQVLEDLGYYCIDNLPLALLPEIVAKLDHENN----LEQLA-LGVDVRSTRADMQE
Y549_ALCBS       KTTALQALEDQGFYCVDNLPVGMLPTLAKQLSEGDPP--IE--RVAVGIDARNLPAQLLA
Y2229_CHRSD      KSIALQALEDLGYYAIDNLPASLMAPLIDELREGPPS--RT--HIAVSIDARNLPDALRR
Y5324_HAHCH      KSTALHVLEDMGYYCIDNLPIGLLSPLTQEVLDQGKT--QN-QQLAVSIDARNLYRDLSD
Y2718_MARHV      KSTALHVLEDLGFYCIDNLPIGLLFPLTREAATQEAP--GRLKKMAVSIDARNLSAELAN
Y5038_PSEA7      KSTALNVLEDNGFYCIDNLPASLLPDLAQRALLHTEL--LH-PQVAVSIDARNLPSQLQR
Y2809_CELJU      KTTALHVLEDVGFNCIDNLPVSLLPALVAQI-EIHKD--QA-QKFAIGIDVRNAWQDLSL
Y3181_SACD2      KTSALHLLEDEGFTCIDNLPVKLLPALIEQIGDAPHA--SK-HKFAIGIDARNLNSDLSQ
Y739_METCA       KSIALDTLEDCGYYCIDNLPAPLIEPFLQQAIASRSS--AF-DKIAIGIDARNQSANLTG
Y722_THISH       KSVALNALEDAGYYCVDNLHLGLLSAFVRQLMAPRMP--LY-ELAAVGVDVRSGLEELDH
Y2797_NITOC      KSIALHALEDRDYYCIDNLPIYLLPTFAKRM--QRDA--RQ-LRAAIGIDARNLPQELRQ
Y2233_ALKEH      KSVALHTLEDQGWYCIDNLPIGLLSAFARHVNDTCPA--GG-GRYAVGIDARNRPEDLDR
Y2130_HALHL      KSVALHTLEDAGYYCIDNLPVSLIGELARYAQNRDAP--TG-ERFAVGLDARNPPHDLQC
Y950_STRM5       KSVALKTFEDQDYYCSDNLPINLLPDFVRSLLANHDG--SAPRRLAVGIDVRGQ-SNLSQ
Y1354_XANCB      KSVALKTFEDLDYYCSDNLPVELLPDFVRSRLRGNP---LGDQRLAVGIDVRSR-SDLTQ
Y753_XYLFM       KSIALKTFEDLDYYCSDNLPVELLPHFLRRRLRVAE---LSDQRIAIGIDIRSG-SNLSE
Y2629_ACIF5      KSTVLQALEDQGYYCVDNLPATLLVDFGAQLARRDAS--SM--LAAVSIDVRNR-EFLAA
Y3603_ACIAC      KSVALHALEDAGYYCVDNLPPELLAAFVALEHQHH------GNRVAIAMDVRSATALPLV
Y1053_VEREI      KSVALHALEDAGYYCVDNLPPQLLPAFVALEHHHH------GNRVAIAMDVRSATSLHQV
Y831_ACIET       KSVALHALEDAGYYCVDNLPPELLTSFVELEHAHH------GHRVAVAMDVRSATALPLV
Y1300_POLSJ      KSVALHALEDAGYYCVDNLPPELLTPFVALEHQHG------PRKVAIAMDVRSATSLPLV
Y1653_RHOFT      KSVALHALEDAGFFCVDNLPPELFLPFVALQKMHQ------TKRVAIAMDVRTASSLPLV
Y5422_DELAS      KSVALHALEDAGYYCVDNLPPELLSAFVELEHGRH------SNKVAIAMDARSAGGLPHL
Y3490_LEPCP      KSVALNALEDAGYFCVDNLPPELLPEFIRLQRAQ------AVRKVAVAVDVRNAASLPKL
Y3336_METPP      KSVALHALEDAGFYCVDNLPPELLPQFLRLEQARTD---GAMRRIAVAVDVRSARSLPAL
Y3158_BORA1      KSVALRMLEDSGFTCVDNLPLRFLTEFVAVSHDDG------MERVAVAIDVRSPGELAEL
Y322_PARP8       KSVALNALEDAGYYCVDNLPPRFLPELATYLAGDG------KDRLAVAIDARSGASLDDM
Y403_RALSO       KSVALNVLEDAGYYCVDNLPAQFIPELARYLADQG------YTHLGVATDIRSRESLRKV
Y3120_JANMA      KSVGLTSLEDAGYFCVDNLPPTLLRALVATRQEEH------ADKLAVAMDARSASSLIGL
Y1915_POLAQ      KSVALRAFEDAGYDCVDNLPVSLLENLIQTLEGEN------SERVAVAIDARRGQSIAQL
Y399_AZOSB       KSIALHVLEDAGYYVVDNLPSALLLQLVLHLRGAG------YQRVAVAVDMRSGSSIAAL
Y2061_AROAE      KSIALKVLEDVGYYAVDNLPATLLPELVAELSDTG------HERVAIAVDVRSGASLLAL
Y081_NITMU       KSIALTVLEDNGYYCVDNLPANLLLEVTVYLKQSG------HERVAVSIDARSRETLHLL
Y529_THIDA       KSIATAVLEDVGYYCVDNLPLAMLQPLVEYLKQEG------YARVAIAIDARSGASFAQL
Y1559_NITEC      KSIALKALEDSGYYCVDNLPASLLVILINHLQTQH------HSHVAVAIDMRSGDSITVL
Y070_DECAR       KSVALNLLEDSGYYCVDNLPVVMLTVLIGMLKEEH------VHKVAVAIDARSGHGIDLL
Y3336_CHRVO      KSVALRALEDSGFYCVDNLPATMLPEAMAMYDDFG------YQDIAISVDTRSGPSLGAL
Y145_METFK       KSIVLKMLEDSGYYCIDNLPATLLPQASEHLSQGN------HQRVAISIDTRSA-SLEAL
Y2029_LARHH      KSIALNVLEDSGYSCIDNLPLTLVPDTVERLAPLG------YEQLAISIDTRDG--ASRL
Y698_NEIM0       KSVALRQMEDSGYFCVDNLPLEMLPALVSYHIERA-----DETELAVSVDVRSGIDIGQA
Y399_DICNV       KSVALHTLEDLGYYCVDNLPLILLDAFVRDFAQHH------AQPVAVAIDARNAQDISAL
Y2060_FRASN      RSTAAKCLEDLGWFVVDNLPPALLSTMAELGHRSGGA----VSRIAVVVDVRGRAFFSDL
Y5570_STRGG      RSTAAKCLEDLGWFVVDNLPPALIPTMVELGARSQGN----VARIAVVVDVRGRRFFDNL
Y2020_THEFY      RSTAARALEDLDWFVVDNLPPALLPTMIDLAARTRGA----VPQIAAVVDVRSMAFTEDL
Y1111_ACIC1      RSTAAKCLEDLGWFVVDNLPPGLLDTMVDLGVRSGGA----INKIAAVVDVRSRAFTSDL
Y2139_SACEN      RSTAAKCLEDLGWFVVDNLPPELIATMVELGARSSGA----ITRVAVVMDVRSRAFTEDL
Y1815_MYCUA      RGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSR----ITQLAVVMDVRSRGFTGDL
Y2783_MYCA9      RGTTAKVLEDLGWYVADNLPPELITRMVDLGLAAGSR----ITQLAVVMDVRSRGFTGDL
Y3026_RHOE4      LSTAAKVLEDLGWYVADNLPPELISRMVGLSLTSDPP----VDRLAVVIDVRSRLFTGDL
Y3593_NOCFA      RGTAAKVLEDLGWYVADNLPPELIGRMVELGAAADPP----IRRLALVMDVRSRFFTGDL
Y3101_SALTO      RSTVARALENVGYYVVDNLPQALMLDMAELAMKAGGA----ARRTAMVLDVRSRAFSTDL
Y2084_PAEAT      RSTASDALEDHGWYVVDNLPPQMLGTLAEIVSHAPKS----IPKLAVVVDVRSKDLFTDI
Y2275_RENSM      RSTAANALEDHGWYVVENLPPQMLTTLADLVARTPNS----LPKLAVVVDVRGKAFFADI
Y1207_KOCRD      RSTAANALEDLGWYVVDNLPPQMLGTLADLASRTPQS----LPKLAVVIDVRGKALFNDM
Y2934_KINRD      RSTTGKALEDLGWYVVDNLPPQMLEPLAELTARAGLT----IPRLAVVVDVRGRTFFAEL
Y1991_CLAMS      RSTVGNALEDLGWYVVDNLPPQMLKPLVELAGRAGTS----LPKIAAVVDVRGGDFFSEL
Y1149_LEIXX      RSTVANALEDLDWYVVDNLPPQMLRPLIELANRAESG----LPRIAAVVDVRGRNFFADL
Y2527_NOCSJ      RSTAAKELEDLGYYVVDNLPPSLLRDVVRLVDETRGT----AQPIAVVVDVRSGSFFQTL
Y813_CUTAK       RRTAAHAVEDLGWYVVDNLPPAMLGALVDEIAA--NN----IDRLAVVLDVRSRIMFDAL
Y1368_BIFA0      RSHAAHSIEDMGWYVVDNMPPKLLEPMVDMMTASKSG----FHKLAAVIDVRSRDYFMDL
Y1085_BIFLS      RSHAADCVEDMGWYVVDNLPPKLLIPLVDMMTTSGSGSGSGVHKLAAVIDVRS-SYFDEL
Y1710_COREF      LSTAARVLEDLGWFVTHNLPPQMILPLVEMCAREDSP----VDKVAVVCDVRSREFRGGL
Y1313_CORDI      LSSAARVLEDMGWYVTQNIPSQFVVQLVELCADPHSP----VDKIAIVSDVRSKEFSGSL
Y1197_CORA7      LTSAAKVLEDKGYYVAHNIPPKAIVDLLKLCASPESP----VSKIAAVTDVRSRLFPGSL
Y1004_CORJK      RRATAAALEELGWYVADNLPPELIVRMVELSFSDDSP----IEKLAIVTDVRSRDFAGNL
Y2009_RUBXD      KSNALRAFEDAGYFCIDNLPPRMIPEVMEMSAGSPAG----PEGVVVVADIRGRRYFGGE
Y5766_SORC5      KSTALHALEDLGFFCVDNLPTSLVQPAVEACE--SGG----ITRIGLGIDVRVGSFLAGA
Y3782_KORVE      KASVLKAFEDLGYYCVDNLPVDLVPQFADLVAD-----SPEINRAALVLDIREGQGLDRL
Y7395_SOLUE      KGSVLKALEDLGFYSVDNLPVELIPKFAELTCN-----NPSIPAAALVVDIREGSGLKSF
Y619_ACIC5       KGSALKAFEDLGFYAVDNLPIELVPRFAELVAQ-----SVEITRATLVVDVREGQSLAKF
Y152_ANADF       KSTALRALEDAGFYCVDNLPILFLEKLLELSGHT----AGEVSRIALVVDAREGRFLADA
Y6564_MYXXD      KSTAIRALEDSGFFCIDNLPVLLLPKLTELAG------GGHFERMALVVDVREGVFLKDA
Y1884_GEOSL      KSTAVRVLEDEGFFCVDNLPVLLFPTIIDLVCRS----GENVAGVALVMDIRGRDFIKGF
Y2968_GEOUR      KSTAVRALEDEGFFCQDNLPVMLFPTFVELVDKA----KERVRDVALVMDIRGRDFHAGY
Y872_GEOBB       KSTAVRALEDEGFFCLDNLPVSLVTTFIELVEHS----REDIKDVALVMDIRSRDFIKGY
Y2163_GEOLS      KSTAVRALEDEGFYCIDNLPVRLFRQFVELIEKS----GESFKGVVLVTDIRGRDLSTGI
Y977_PELPD       KSTAVRALEDEGFYCIDNLPMRLFRPFVELIEKS----GDSYRGIVLVADIRGREFLKGF
Y1935_PELCD      KTTAARALEDEGFFVVDNLPLVLLPEFLKLHAGS----AVAGSNVAVVVDVRNKPYLEGY
Y1358_DESAL      KSTALAALEDAGFFCVDNLPVALLPKFLELQNQT----VSEVTRFAFVMDLREKGFVSRF
Y503_DESOH       KSTALDVFEDAGFYCVDNMPVALLPKFLEIPVNT----ASGISGLAFVMDLREPDFLATY
Y2790_DESAH      KSTAMEAFEDAGYYCVDNMPIELLPKFLDLPLDS----DTDINGFAFVMDIRAKQFLSQF
Y1217_SYNAS      KSTALRALEDIGFYCVDNMPVVLLPQFLEIQSDK----SKDISQVAMVMDLREKSFIETY
Y2066_SYNFM      KSTAIKAFEDLDYFCIDNLPVPMLPEFLALCEKD----MPDIHKIALGIDIRERKFLKDY
Y4092_ALKMQ      KSQTVKSMEDFGFYCVDNLPPALIPKFAELCHQS----QGVISRAALVIDIRGGMFFDDL
Y574_ALKOO       KSQAIKYMEDFGYYCVDNLPPTLLTKFAELCYQS----QGPMAKVALVIDIRGGMFFEDL
Y3400_CLOD6      KSETMRALEDMGFYCVDNLPPALITKFAELCYQP----NSSIDKVALGIDIRGRKFFEAL
Y1284_CLONN      KSQAIRSLEDLGYFCVDNLPPTLMGKFAEACYQT----DGKIDKIALVIDIRGGEFFDDL
Y2495_CLOTE      KTQAIRSLEDLGYFCVDNLPPTLIPKFAEACYKT----DGRINKIALVIDIRGGEFFDNL
Y511_CLOAB       KTQAIRSLEDLGYFCIDNLPPALIPKFAQVCYES----ESKINKIALVIDIRGGEFFDNL
Y4857_CLOB8      KTQATRTLEDLGYFCVDNLPPKLISKFAEVCTQS----GGNIEKVALVIDIRGGIFFDDF
Y335_CLOPS       KTEATRSLEDLGYFCVDNLPPKLIPKFAEACVQS----EGKIDKIALVIDIRGGIFFDDL
Y2290_RUMCH      KSLVTKYLEDIGFFCVDNLPPALIPKFAEISAQS----EGKMEKIALVIDIRGGELLHDL
Y113_HUNT2       KSLVVKYLEDIGFFCVDNLPPLLIGKFAEICLKS----RGKISKVALVIDIRGGELFNDL
Y1834_CALS4      KTQALKAMEDMGFFCIDNFPPALIPKLADLFYQS----K-NIDKVALGMDLRGGQFFEDI
Y331_LACP7       KSSVLKMLEDSSYFCVDNLPIPFIMKFARLAVKE----SANITKVALGIDIRSGQALEEL
Y1160_CALS8      KSLAIRAFEDMGFFCIDNLPPQFLPKIAELASAS----NDKISRIAAVIDIRGGELFDDF
Y1084_FINM2      KSASSHILEDLGYYTLDNMPPSLLLSFIDLTTKS----KKKINKIACVVDIRGGEFFADL
Y1588_HALOH      KSVALNFFEDMGFFCIDNLPPALISKFAELCLHS-----E-LDKIAVVSDIRGREFFNAL
Y262_SYNWW       KTQAINCLEDIGYYCVDNLPPALMFKFIELSMQS-----EGIKKVALVIDVRGGDFFPDL
Y646_HELMI       KSQAIRALEDLGFFCVDNLPPNLLPKFGELIVHS--K-GK-INKIALVIDIRGGEFFDSL
Y258_MOOTA       KTQAVRCLEDLGFFCVDNLPPSLIPGLVDLLGHPGKE-GEGITKVALVMDIRGGEFFSGL
Y300_DESAP       KTQAVRCLEDLGFFCVDNLPPKLIPKFAELCAQT--T-GK-IERIALVVDIRGGEFFATV
Y2729_PELTS      KTQALRSLEDLGFFCVDNLPPALIAKFAELCAQA--A-SR-INNIALGVDIRGGEFFNAL
Y3054_DESRM      KTQAVQSLEDLGYFCVDNLPPALIPKFAELVSQS--N-GK-VEKVALVVDIRGGAFFHQA
Y4845_DESHY      KTQALQSLEDQGYFCVDNLPPSLILKFAELCTQS--Q-GK-VTRAAIVCDLRGGEFFSSL
Y186_SYMTH       KTQALKYLEDLGFFCVDNLPPSLMPKLAELFGQT--E-GK-VSRLALGIDIRGGRFFHEI
Y272_CARHZ       KTQAMRALEDLGYFCVDNLPPVLMPKFAELVAHA--E-NK-IEKVALVVDVRGQKFFQDL
Y2024_NATTJ      KSIVIQSFEDLGYFCVDNLPPTFIAKFAELIRQS--E-GR-INKIALVSDIRGGQFFESL
Y3015_GEOTN      KTVAIQSFEDLGFFCVDNLPPTLLPKFLELVKESG----NKMNKVALVMDLRSRDFFDHL
Y2526_ANOFW      KTVAIQSFEDLGYFCVDNLPPTLLPKFLELIRESG----NKMNKIALVMDLRSRDFFDRL
Y3115_BACP2      KTVAIQSFEDLGYFCVDNLPPSLLPKFLELMKESN----SKMSKVALVMDLRGREFFDSL
Y3698_BACCN      KTVALQSFEDLGYFCVDNLPPMLLPKFVELMADSK----SKMNKVALGIDLRGREFFEHL
Y3036_BACSK      KSVAVRSFEDLGYYCIDNLPPVLLPKFIELIEGGI----DKVTKVALVMDLRGQSFFDEL
Y3569_BACHD      KTVAVQSLEDLGYFCVDNLPPALIPKFIELIESSS----GKMNKLALVIDLRGQTFFDQL
Y2468_OCEIH      KTVAIQSFEDLGYYCVDNLPPALLPKFLDLMKDAT----NNIQKVALVMDLRGREFFDSL
Y448_LYSSC       KTVAIQSFEDLGYYCIDNLPPALLTTFLTLLRDSG----KNSTRIAAVMDMRGGNFFDAL
Y126_LISMH       KTVAMQSLEDLGYFCVDNLPPSLLPKFWELMKES-----DKMDKIALVMDLRGREFFDSI
Y5262_BREBN      KTVAVQSLEDLGFFCVDNLPPVLIPKFAELVKQSG----GSIERVALVIDLRGREFFENL
Y2405_EXIS2      KTVAMNSFEDLGYFCVDNLPPTLLPQLIEVIGQV-------RPKIAVAIDTRARDFIDSF
Y1952_STAS1      KSVVIQSLEDIGYFCVDNLPPILLPKFVELMGQGN----PSLQKVAIAIDLRGKELFKSL
Y414_STACT       KSLVLQNLEDLGYFCVDNLPPILLPKFVELMEQGN----PSLRKVAIAIDLRGQEFFKSL
Y516_MACCJ       KSVAIQCLEDLGYFCVDNLPPILLPKFIELMNNNT----ESLSRVAIGIDLRGKDFFNSL
Y526_LACSS       KTVAMQSFEDLGYFCVDNMPPSLLPKFWELVKESG----K-VTKIALVIDLRSRAFYDGI
Y779_LACPL       KTVAVQSFEDLGYFCIDNMPPALLPKFSELVEESG----K-IKKVALVIDLRSRAFYDEI
Y1073_LACCB      KTVAMQAFEDLGYFCVDNMPPALLPKFWELVKESG----K-ITKVALVVDLRSRAFYDQI
Y1171_LACS1      KTVAVQSFEDLGYFCVDNMPPKLLPKFYELVKESG----K-ITKIALVVDLRSRAFYDEI
Y651_LACBA       KTVAMQSFEDLGYFCIDNMPPSLLPKFWDLVRESG----K-LSKIALVIDLRSRAFYDEI
Y450_PEDPA       KTVAMQSFEDLGFFCVDNMPPALLPKFWELIKENG----K-ISKVALVVDLRSRGFYDQI
Y766_ENTFA       KTVAVQSFEDMGYFCIDNLPPSLIPKFWELIKESG----K-VTKIALVIDLRSRTFFREI
Y831_STRT1       KTVAIQSFEDIGYFTIDNIPPSLVPKVIELLKHSE----E-TDKIALVVDMRSRVFFDEI
Y619_STRS2       KTVAIQSFEDLGYFTIDNMPPTLLPKFLELIRHSQ----D-NNKIALVVDMRSRSFFSEI
YJIE_LACLA       KTVAIQSFEDMGYFTVDNMPPNLIEKFVGLLNTPD----NKIDKVALVVDMRSRAFFEDI
Y375_LACRJ       KTVAVHSLEDLGYFVIDNMLPGLAERFVDVIEDSR----E-FDKIAMVMDMRSRGFYDEV
Y356_LACF3       KTVAVQSFEDLGYFVIDNMIPSVATKFVDAVKQSG----E-ITRMAMVMDSRSRGFYDQV
Y556_LACDB       KTVAAHSLEDVGYFVVDNLPPELLGNFWDLMNTSE----D-FEKVAVVIDLRVKSFYKDL
Y866_LACJO       KTVAIKALEDMGYFVVDNLPPELLGSFWELINNSS----D-FSKAAVVVDLRVKSFYKDL
Y1518_THEAB      KSTALGLLEDMGFYCIDNLPINLVETILPVI-SMN------VDNIAFVLDARSE-NFERI
Y1373_THEM4      KSTALGLLEDMGFYCIDNLPVKIIDQILPII-SIN------IESLALVIDSRSG-DIDDI
Y1159_FERNB      KSTAAGLLEDLGFFCIDNLPPEVVYQVASIL-SNN------VDKLAIVLDIRSY-LFGNI
Y898_THENN       KTTAMGFLEDLGYFCVDNVPGSILEELLKLFMSSD------LEKMAIAVDVRSE-HFSDP
Y523_PSELT       KSTVARVLEDIGFFCIDNLPPALLNDFMVLLSSSS------IDKVALVVDIRSA-QLGNA
Y154_PETMO       KTLLLQSLEDEGYYTVDNIPPHLIESFLNILCTSN------VKKLAIVSDIRWK-DPQKL
Y125_ELUMP       KTKALQIFGDFGFYCVDNLPLALFEHFVD-HLKNR-------KEENIALGVDIR-EGKDL
Y433_ENDTX       KSQALKIFEDFGFVCVDNIPIQIVADFIDICLKDS------IRYKNVAISVDSR-AGKSL
Y1089_FUSNN      KTTALNILEDMSYYTIDNLPLGLEKSLLD------------TEIEKLAVGIDIR-TFKNT
Y1129_DICTD      KSQSLRILEDLGFFCVDNIPPKLVPTLIDLCLATN------GKISGLAVVIDIR-TENFL
Y235_THEYD       KTVTLRTLEDIGFFCVDNLPPPIVLEFLGM-LNEY------SSFKNIAIGIDIR-VQQFL
Y1502_DESVV      KSTVLNVFEDLRYFTVDGLPVRLAPDMVRVLDAQA---LEQYQGIVLGMDLREAEFVQQF
Y424_DESVM       KSTVLNVLEDLRYFTVDGLPASLAPQMVTILNREA---LSHYQGLVLGMDLRESNFVRNL
Y1774_DESAG      KSTVLNVFEDLRFFTIDGLPVGVVADLLEHLARDA---MGRYRGVVLGMDLRQFDFLDEF
Y972_DESDA       KSTALKVFEDMGHFVVDGLPASLAPEMVDMMSRPS---MSHFKGIALGMDLRQSNFLDEI
Y459_LAWIP       KSTALHVFEDLQLVTADGIPPSLVTSMIHTVQSSS---LEHVQGLALGINQHRIHTMQEL
Y1189_GLUDA      KSSILRILEDLGYEVIDNPPLGMMDEIVTR----------AEQPVAIGVDSRTRGFDAAA
Y815_GLUOX       KSSILRVLEDLGHEVVDNPPLNLIQALASR----------AGQNLAIGIDVRSRGFEASR
Y395_GRABC       KSTILRALEDAGYETVDNPPLPLVHDLVAR----------GEGPLAFAVDARSRGFTADG
Y446_ACICJ       RNSVLRALEDIGYEAVDNPPLRIVETLVR-----------GDKPLAVGVDARTRDFSAED
Y4396_MAGSA      KTMALKALEDMGWEAVDNLPLALAASLVRS-------GGGMARPLALGVDIRTRDFGVEP
Y3448_RHORT      RTTVLRALEDIGYEAVDNLPLSLFEALTQG-------RWDQPRPLVLGIDTRTRGFHAAT
Y2868_RHOCS      LSTALKALEDLGYEAVDNLRLSLLTALVFQ-------AHD--RPLAIGIDSRTRDFSADA
Y2562_RHOS5      RTTAVNALEDMGYEVIDNLPLSFVPRLIE--------GPAIGPPIALGLDVRNRDFNATA
Y2850_PARDP      RSTAINVLEDLGYEAIDNLPLSLIPRLLD--------GPARPMPLALGVDVRNRDFSVAN
Y209_DINSH       RTTAIRALEDLGFEAIDNMPISLVPRLLD--------GPPLARPLALGLDARTRDFSVTA
Y713_RUEPO       RSTAINVLEDLGFEAIDNLPMGLLMRLLD--------GPALRRPLALGLDARNRDFSTEG
Y2438_RUEST      RTTAINVLEDLDFEAIDNLPLRLVPALVA--------AGGADRALVLGLDPRNRDFSTEA
Y1380_ROSDO      RSSALNVLEDAGFEVVDNLPLRLLDAFLD--------VPSSAQPLALGIDPRNRDFSTTV
Y539_JANSC       RSTVINALEDLGFEAIDNLPLSLLPRLLE--------GAPPDRPLALCIDPRTRDFDARD
Y2120_ERYLH      KSTSLRVLEDLGWETLDNFPIRLLEPMIGEVLSS-----DNPAPLAVGFDSRTRGFVPNE
Y2904_NOVAD      KTTALRTLEDMGWEAIDNFPIRLLDRLLETEPGSA--RMEPGAPMAIGFDTRTRGFDPSR
Y2050_SPHAL      KSTVLKVLEDLGWEVVDNLPLALLEALIDAPVKRG----EAERPLAVGIDSRSRGFRPAL
Y1325_ZYMMO      KSTALRTFEDMGWETVDNLPLSLLERLILTPPSSV--AAYKGRPLALGIDSRTRGFTVDA
Y399_SPHWW       KKTALTALEDMGWETVDNLPVSLLERLLAASPAEG--SIDEGRPLALGIDSRTRDFDSRG
Y3333_MAGMM      KSTALKSLEDIGYLWIDNPPLLALPGLMRELSES-----TEDSHVAVGLHMREHGRDPDA
Y725_COPPD       KSTVSKALEDLGYVVVDNVPVDLLHNLLELYEAK-----NQEQLVAVVVDSRSLRHQGEV
Y723_DEIGD       KSTALRTLEDAGFFITDNLPPELWGAMHDLATARG------LERVAVSTDARTRFFLGAL
Y1434_DEIRA      KSTALRTLEDAGFFITDNLPPELWNAMHDLVTARG------IENVAVSTDTRTREFLAAL
Y319_THET8       KTTARGFLEDLGYFMVDNLPPRLWLPLLQEAAARG------LARVGVVVDARALAFFQDL
Y911_SYNJA       KTLAIQQLEQLGYTGLEGIPPDQAVYLIEAIRPRH------PALAVSLNLHTPEYREQFL
Y4163_GLOVI      RTEAIRIFEDLGYLCLNHVWPELVPTFLKHYAPIA------PRLVLCLASRPEADAQAGL
                        . :      .                                           

RAPZ_ECOLI       FEQAMSNLPD----AFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKN-------------
RAPZ_PROMH       FEKALESLPA----EYSPQLLFLDADRNTLIRRYSDTRRLHPLSTKN-------------
Y584_HAEDU       IDELLHQLSQL---TINTKMIFLDCESATLIRRYSDSRRLHPLSNQD-------------
Y087_HAEPS       LEQVLHAFPS----HISKTLIFLDCQRKALVRRYSDSRRLHPLSTHD-------------
Y1718_MANSM      LDTLLQQLADA---QHQVRIIFLEADRSTLIRRYSDSRRLHPLSMQD-------------
Y169_PASMU       LENLLTEVQQ----QHQIKLIFLDADRGTLIRRYSDSRRLHPLSTQD-------------
Y1595_HISS2      LDHILNLLQE----KYPVKIIFLDTDRNTLIRRYSDSRRLHPLSVQN-------------
Y2532_VIBCH      VQDVLDQLKQNN--D--VSMLFLDASKETLLKRYSETRRIHPLSLSQS------------
Y2760_VIBA3      VTATLDQLEAAT--DINLNVLFLDASKRTLLKRYSETRRIHPLSIGQE------------
Y2673_VIBPA      LTGTLEQLKTEL--D--VTVLFLDANKETLLKRYSETRRIHPLSLGGQ------------
Y445_VIBVY       LTTTLQKLKSSI--D--LSILFLDADKATLLKRYSETRRVHPLSLSDE------------
Y495_ALISL       LKNTLTELKKSH--D--VTVIFLDAEDKELIKRYSETRRLHPLSLIGE------------
Y3258_PHOPR      IQKTLNSLDDKL--D--INVIFIDADDKELVKRYSETRRLHPLSKHD-------------
Y571_PSEA6       LVEILDYLPST----WEMTILYLDASDDVLIKRFSETRRLHPLSKQN-------------
Y4546_COLP3      IPEIIAYLPKA----VDVNTLFLDADDNDLIRRFSETRRLHPLIKEN-------------
Y2554_PSET1      FNDILEYLPDF----AKPTLFYLDSDDQTLIRRYSETRRLHPLSIDS-------------
Y318_AERS4       LETLLAQVRNEG--RVEFSSFFFDAENSTLLKRYGESRRLHPLSRKQ-------------
Y393_IDILO       LLDSLSFLPKG----VEPEILFIDSDDNTLLKRFGETRRLHPLSQKE-------------
Y3091_SHEAM      LEKELARLPEG----VELTSFFLNSSDKVLLKRYSETRRLHPLSRSK-------------
Y674_SHEPW       LEKHLTNLPKG----VELLSFFLNSSDEVLLKRYNETRRLHPLSHSN-------------
Y2894_PSYIN      IQTLLSSLQQK----VEVEIIYLDAISAELIRRYSETRRLHPLSKNK-------------
Y127_PSYCK       FDAIHDSLKQTY-GEEAVTVMYVTAQEETLVARFNATRRIHPLMVLDTKGV--------E
Y2129_PSYWF      FSAIYDTLLNSY-GPDKVRIMYVTAQESVLVARFAATRRVHPLMAVN------------D
Y3059_ACIAD      FDLVFEQLQKHG----TVDVIYLTTQDQELIARFSASRRPHPL----------------A
Y549_ALCBS       FDNILHALNEQ---QVRSEIIYLDADDHTLLTRFSATRRRHPLGTD--------------
Y2229_CHRSD      FPVLLEEIRGR---GIQCQVVYLTADSRILLERYSATRRRHPLTRAS-------------
Y5324_HAHCH      FPSIYAALQAH---NIDVEIIYLDANDATLIKRFHATRRKHPLSSK--------------
Y2718_MARHV      FETIYQQLKQT---GVELEIIFLDADEQSLLQRFHATRRKHPLSDD--------------
Y5038_PSEA7      FPELLQEVRDN---HINCDVLYLDADDETLLKRFSETRRRHPLTTD--------------
Y2809_CELJU      FPKMVSTLKEA---HLPFHTIYLDSHPSVLIQRFSETRRKHPLSDK--------------
Y3181_SACD2      IESLIKDNLPA---NAECLVVYLDTSREVLLKRFSETRRKHPLSDQ--------------
Y739_METCA       FPDILGRARQL---GVDCRILFLQAEPETLLKRFSETRRKHPLTDA--------------
Y722_THISH       FDDIMAEIRAQ---GVEAQILFLRADEDILLRRFSETRRKHPLARK--------------
Y2797_NITOC      FPQILEEIERA---GVHCHIIFLDASDTTLLKRFSETRRKHPLSH---------------
Y2233_ALKEH      IPAILDELQAL---GLNSEVLFLFASRETLITRFSETRRRHPLSDG--------------
Y2130_HALHL      LPETLTALREQ---GIATEVLFLYAEDSILMRRYSETRRRHPLAEG--------------
Y950_STRM5       LGNWRQLATDA---GVEVEVLFFEASDEAVLKRYADTRRRHPLSQL--------------
Y1354_XANCB      LAQWRQAAQEY---GIEARLLFFEASDEALLKRYADTRRRHPLSQL--------------
Y753_XYLFM       LDQWRHTAKHY---NIKAHLLFFDASNETLLKRYADTRRRHPLSHL--------------
Y2629_ACIF5      LPQALADLRQRY--ALCPRILFLEADEGTLLRRFSETRRRHPLTDDL-------------
Y3603_ACIAC      PQQLRRLRGEG----VTVHSLFLDATTDTLVRRFSETRRRHPLSRD-----------EWY
Y1053_VEREI      PQELHRLRSQG----VAVQSIFLDATIDTLVRRFSETRRRHPLSHD-----------DPQ
Y831_ACIET       PQQLAGLREQG----VQVRQLFLDATNDVLVRRFSETRRRHPLSQA-----------EMR
Y1300_POLSJ      PQQLRQLQAQG----VTVQSLFLDANTETLVRRFSETRRLHPLSRG-----------DTA
Y1653_RHOFT      PEQLATLQAQG----VMVKSLFLDATTGTLVRRYSETRRKHPLSQAAS-------EHSPL
Y5422_DELAS      PGQLERLQRQG----VVPHLVFLDATTGTLVRRFSETRRRHPLSQG-----------PVA
Y3490_LEPCP      LPLVDQLRREG----TRILPMFLESRSDTLVRRFSETRRRHPLSSRQ--------DDQG-
Y3336_METPP      LPSLSQLGSEG----VKVRAIFLDASTHALVRRFSETRRRHPLSTGA--------PGEAL
Y3158_BORA1      PNVITALRAMG----TQLSVVFLDASTETLAQRYSESRRRHPLTDRA----------SRG
Y322_PARP8       PQMIRDLSGQ-----HDVRVLFLNASTQALIQRFSETRRRHPLS---GSP----AHDADV
Y403_RALSO       PETITQLRKE-----HDVRMLFLTASTNALVQRYSETRRRHPLSIRNGRPDAGNPPSAAK
Y3120_JANMA      PADIAWLQSQG----HEVKVLFLTAKTDSLIARFSETRRSHPLSHR-------GFSSTAA
Y1915_POLAQ      PSILENLRRN-----HQVRVVFLNADTNTLVQRFSETRRRHPLS-----------TSAQQ
Y399_AZOSB       PEQVESLRGMV----DDLRFIFLEARDDTLIARFSETRRRHPLADE--------------
Y2061_AROAE      PQQVEHLHALA----SDLRLIFLDARDDTLIARFSETRRRHPLASE--------------
Y081_NITMU       PQRLADLRRQK----MDIHLLFLDTKTDTLLKRFSETRRRHPLSDN--------------
Y529_THIDA       PQIAENLRAQG----ADLRVIFLEAKTLSLVKRFSETRRRHPLSSD--------------
Y1559_NITEC      PWQFKMIDKS-----IRTEFIFLDTRTDTLIQRFSETRRRHPLSDK--------------
Y070_DECAR       PGKLDKLKRSG----INLTFLFLFSHEETLLKRYSESRRRHPLATK--------------
Y3336_CHRVO      PQVVEGLKTQG----IDVRLLFLEAKPETLVKRFSETRRRHPLSGS--------------
Y145_METFK       PGNIRKLKDEG----IEVQVLFLEANVETLVKRYSETRRRHPLSSD--------------
Y2029_LARHH      LEVIHALETAG----HNVRFLFLEARTDTLIRRFSETRRRHPLSRT--------------
Y698_NEIM0       REQIAYLRGLG----HRVEVLFVEAEESVLVRRFSETRRGHPLSNQ--------------
Y399_DICNV       SDKLQTMKSVT-----RIQILFLNAQTNVLARRFSESRRPHPLRNFG-------------
Y2060_FRASN      -RAAVEALDSR---GMHPRMLFLEASDDALVRRFDHVRRPHPLQG----D----------
Y5570_STRGG      -RESLADLEAK---HVTRRIVFLESSDDALVRRFESVRRPHPLQG----D----------
Y2020_THEFY      -LSTVEDLRSR---GIGARVVFLEASDETLVRRFESVRRPHPLQG----D----------
Y1111_ACIC1      -YGALGVLRNR---GTALRIVFLEASDDELIRRFENVRRPHPLQG----D----------
Y2139_SACEN      -GSVIKDLDAR---GYKPKVLFLEATDEVLIRRFEQVRRGHPLQG----E----------
Y1815_MYCUA      -DSVRNELATR---NITPRVVFMEASDDMLVRRYEQNRRSHPLQG----G----------
Y2783_MYCA9      -ESVRADLATR---GISPRVLFLEASDESLVRRYENNRRSHPLQG----G----------
Y3026_RHOE4      -GWVLTELEAE---PIHTRVLYLEASDDVLIRRFEQVRRSHPLQNDGI-D----------
Y3593_NOCFA      -SVVADQLRAL---GLRTRVLFLEASDDVLIRRFGFARRRHPLQSESA-D----------
Y3101_SALTO      -VGAIRELKER---GFGPRVVFVDADDEVLIRRFESVRRSHPLQG----E----------
Y2084_PAEAT      -QTALGALSAS---GITFRVLFLDANDDVLVRRFEQGRRPHPLQG----G----------
Y2275_RENSM      -RDSLNTLAAS---GISYRVLFLDASDNTLVRRFEQGRRPHPLQG----D----------
Y1207_KOCRD      -KETLAALEHS---GVEFSVLFLEASDEVLVSRYELQRRPHPLQA----G----------
Y2934_KINRD      -TGALAALDTR---HVSPRVLFLDATDEVLVRRFESVRRPHPLQG----D----------
Y1991_CLAMS      -RDILHTFGT----GPRLRVLFLEATDAALVRRFEQVRRPHPLQG----N----------
Y1149_LEIXX      -QEMIQSLRE----GTKVRVLFLEAADVTLVRRFEQVRRPHPLQG----N----------
Y2527_NOCSJ      -QANLAQGAT----GRHATLVFLEADDDVLVRRQEAARRPHPLQG----G----------
Y813_CUTAK       -GVAVNALDER---GIDPAIVFLEASDETIVRRQESSRRPLPLQQ----G----------
Y1368_BIFA0      -SSVLSHLDDL---GLKTRILFLDADDNVLVKRFESVRRPHPLQQ----G----------
Y1085_BIFLS      -AAVLGHLDDL---GVKTHILFLDASNEVLIKRYESVRRPHPLQH----G----------
Y1710_COREF      -RETITELEEK---NLAPTVLFLDARDDELIRRFDNVRRTHPLQG----S----------
Y1313_CORDI      -EEVISELSGL---GLKPLVVFMDARNDVLIKRFDNLRRTHPLQG----S----------
Y1197_CORA7      -AETLDELEQL---DMKPTLLFLDARDDVLIRRFDSVRRTHPLQD----G----------
Y1004_CORJK      -TSVLHDLHTG---GRRPTVLYLDATDEALIARFDAVRRTHPLQQ----K----------
Y2009_RUBXD      LERVIDGVEGAG--GWEKRLLFLEADDATLIRRYKESRRPHPAARGGD------------
Y5766_SORC5      -TAALDSIRT----GRDVVILFLDASDETLLRRFSETRRPHPLTTGGSGA----------
Y3782_KORVE      -PATLRSVRQI----VKSNVVFLEADDEILLRRFSETRRPHPLG-ISMP-----------
Y7395_SOLUE      -PKVFAKIRKS----VTARLIFLEADNDAIVRRFSETRRPHPLG-TGKS-----------
Y619_ACIC5       -PQILQEVRQT----LQTTVVFLEASQAVLLRRFSETRRPHPLG-REEQ-----------
Y152_ANADF       -PRVIQEIRQQG---ADVEVLFLDASDESLVRRYSETRRRHPLAGESGT-----------
Y6564_MYXXD      -PRILAEVRRAG---HQVEVLFLDASDDSLIRRFSETRRRHPLA-PNGT-----------
Y1884_GEOSL      -EKVFQQISEAG---HTVEVIFFDATDEVLVRRFSETRRRHPAL-ESGS-----------
Y2968_GEOUR      -EKVFQEISEAG---HFVEILFFDATDEVLIRRFSETRRRHPAM-ESGS-----------
Y872_GEOBB       -DQVFQAIASAG---HSVKIFYFDATDEVLIRRFSETRRRHPAL-EGAT-----------
Y2163_GEOLS      -VESFRELRSVG---HELEVLFFDASDEVLIRRFAETRRRHPAD-EHCT-----------
Y977_PELPD       -ENTFQTLRDQG---HGVEIFFIDASDDVLIRRFSETRRRHPAE-EQCT-----------
Y1935_PELCD      -KQTLAEVRSAG---HVVDIFFFDAVDDVLLRRYSETRRRHPLS-QKEG-----------
Y1358_DESAL      -ENVFKDLEDQG---YAFEIIFLESDEDTLIRRYSETRRQHPLSKDKG------------
Y503_DESOH       -PSVFNDLKAQG---YRLTVLFFEAGENVLIQRYSQTRRHHPLAGDKG------------
Y2790_DESAH      -PSVLESLGKNG---HIPEIIFLEADENILLKRYSQTRRHHPAGQDKS------------
Y1217_SYNAS      -KGIFEQIKARG---YKIEIVFLYATDDALLHRFSETRRVHPLSSVS-------------
Y2066_SYNFM      -AKIFQDLEESG---YRFEIIFLEAATDTLQRRYSQTRRVHPAASSQSL-----------
Y4092_ALKMQ      -FESLKELEHL---GHQYEILFLDADDEVLMKRFKETRRSHPLNV---D-----------
Y574_ALKOO       -FSSLERMTEA---GYQYEILFLDASDKALIKRFKETRRSHPLSV---D-----------
Y3400_CLOD6      -HESLNYLEKE---NYEYEMVYLDCNDDVLLKRYKMTRRNHPLAK---D-----------
Y1284_CLONN      -FENLKYLKEQ---NYRYEILFLDASDKVLVKRYKESRRTHPLAP---G-----------
Y2495_CLOTE      -FESLNYIKDQ---NYKYEILFLEASDEVLVKRFKETRRNHPLSS---G-----------
Y511_CLOAB       -FESLKYLKEA---GYKYEILFLDADNEVLIKRFKESRRKHPLAP---N-----------
Y4857_CLOB8      -FEALNYLKKN---EFKYEILFLEATDEVLIKRFKETRRSHPLSP---D-----------
Y335_CLOPS       -FESIEYLKAN---DFNYEILFLEASDEVLVKRFKETRRSHPLSP---D-----------
Y2290_RUMCH      -FPALEEVKKS---GFSYEILFLEADDDVLVKRYKESRRQHPLAP---E-----------
Y113_HUNT2       -VPELNALKES---GIDYEILFLEASDQVLIKRYKESRRIHPLAP---E-----------
Y1834_CALS4      -YSSLDFLKKN---NYDYEIVFLEASDEVLIKRFKETRRRHPLSE---E-----------
Y331_LACP7       -GKVLEDVKSA---GYQYEILFLEASTEILVKRYKETRRMHPLSG---T-----------
Y1160_CALS8      -KDVLNDLKKG---TYNFKVLFLDAHDNVLVQRYKETRRKHPLSFE-SD-----------
Y1084_FINM2      -MKSITLLKNQ---SIDVKILYLDASDEILIRRYKEHRRPHPLAI---N-----------
Y1588_HALOH      -FSELSSLEKR---GIDYEILFLEASDEVLIRRYKETRRRHPLDEE--------------
Y262_SYNWW       -SLVLEELEDS---QINYQIIFLEASDEVLVRRFKESRRRHPLGSS--------------
Y646_HELMI       -SDGLHQLGAQ---GIRCEILFLEASDEVLIRRYKESRRRHPLSGD--------------
Y258_MOOTA       -DAALNYLDGL---GIPYEILFLEAADEVLVRRYKETRRRHPLSSG--------------
Y300_DESAP       -LDVLKDLKNQ---GLRYEILYLEASNETLVRRFKESRRPHPLSTS--------------
Y2729_PELTS      -FQVLSDIDAQ---GIQYEILFLEASDETLVRRFKESRRPHPLSTH--------------
Y3054_DESRM      -IEVLHDLGEQ---GYRFEVLFLEASDETLVRRYKESRRRHPLDNH--------------
Y4845_DESHY      -AEALGDLHRE---GFHYEILFLEASDEVLVGRYKESRRRHPLSPS--------------
Y186_SYMTH       -LGALRQIAEI---GVAYQILFMDASDEVLVRRYKETRRRHPLAAQ--------------
Y272_CARHZ       -DWALGELTKL---GIKYEILFLEARDEVLLKRFKANRRGHPLGVRG-------------
Y2024_NATTJ      -QSALYQLNEL---GIEYEILFLEADTTELINRFKETRRKHPLWNQY-------------
Y3015_GEOTN      -FVALDELAEQ--EWIVPQILFLDAQDSTLVARYKETRRTHPLAPNE-------------
Y2526_ANOFW      -FVALDDLAET--SWVTPKILFLDANDATLVSRYKETRRSHPLAPSG-------------
Y3115_BACP2      -IAALDEMSDL--GWITPRILFLDANDKVLVSRYKETRRSHPLATTG-------------
Y3698_BACCN      -WGALDDLSER--TWIIPHILFLDAKDSTLVTRYKETRRSHPLAPTG-------------
Y3036_BACSK      -FKAIDELNETPASRLKIQILYLDAKDSKLVQRYKETRRTHPLAKGG-------------
Y3569_BACHD      -FESIDLLDQSSLSKYNIQILFLDAKDAKLVQRYKETRRSHPLAKHG-------------
Y2468_OCEIH      -FEALDVLAKE--NWLEDHILFLDAKDEALVTRYKETRRSHPLATDG-------------
Y448_LYSSC       -IGALDHILKE--GDIVARILFLDADDATLVRRYKETRRAHPLAVSG-------------
Y126_LISMH       -EPALDELDNT--NFITTKILFLEADDKVLVSRYKETRRHHPLEPNG-------------
Y5262_BREBN      -AVTMESLNQM--NGLSYHILYLDANDQTLVSRYKETRRRHPLSPNG-------------
Y2405_EXIS2      -FVVYEDLKKT---NLQIRMLYLDARNDVLVRRYKESRRSHPLAPTA-------------
Y1952_STAS1      -IHEMDLIKSN--SDVIVDMMFLEASNERLISRYKETRRAHPLNGNG--Q----------
Y414_STACT       -VKEVDLLRSQ--NRVIVDVMFVEASEAKLISRYKETRRAHPLNDNG--Q----------
Y516_MACCJ       -QEEIQNIINL--NEVLVQVLFVEASDHILVSRYKETRRTHPLQDN--------------
Y526_LACSS       -IEMLSGLDNT--QFVTTKILFLDASDEELVSRYKETRRSHPLARNG-------------
Y779_LACPL       -MDMLANLDNT--DFVSTRILFLDASNEELVSRYKETRRSHPLAMEG-------------
Y1073_LACCB      -IDMLANLDNN--AYVHSRILFLDATDEELVSRYKETRRSHPLAMEG-------------
Y1171_LACS1      -VEMVRELDEN--EFNSSRILFLDASDEELVARYKETRRSHPLAMEG-------------
Y651_LACBA       -VRMLNDVAVH--GTMNAQVLFLDASDAELVSRYKETRRSHPLARNG-------------
Y450_PEDPA       -LGLLTGEEEQ--HNIKTDVVFLDATDEELVARYKETRRAHPLAMDG-------------
Y766_ENTFA       -QDMLVELENT--NFIDTTILFLDATDEELVSRYKETRRAHPMAMDG-------------
Y831_STRT1       -NDILDQLESN--EKLNFKILFLDATDGELVSRYKETRRSHPLAADG-------------
Y619_STRS2       -REVLDEIEGA--EDLDFKVLFLDATDSELVARYKETRRSHPLAADG-------------
YJIE_LACLA       -QSIVTELTDN--GSVNFKLLFLDANDTELVSRYKETRRSHPLAIDG-------------
Y375_LACRJ       -LPNFEKLKKR--ADLDVKLLFLDANDVTLISRYKETRRSHPLSPQG-------------
Y356_LACF3       -VPCVAQLRGR--SDLTLRLLFLEATDEELVSRYKESRRAHPLSHQD-------------
Y556_LACDB       -IDEINSLEDS--GQTQATIVFLEASDDTLVARYKETRRLPPLAENG-------------
Y866_LACJO       -VDEIKSLEDS--QNVQSTVLFLDASDDVLVSRYKETRRLPPLAHTG-------------
Y1518_THEAB      -DEILNNLK--KKYASNLKVIFLTAKDAIIINRFAHTRRNHPLLKRV-------------
Y1373_THEM4      -VSVIENMK--AKYP--VKVIFLNAKDEVLINRFAHTRRNHPLLKEE-------------
Y1159_FERNB      -QNAIKDVK--ERYP-FTKVLFLTAAKDTLIQRFAHTRRSHPLSKQT-------------
Y898_THENN       -VEAIEKIK--KKTNALI--VFLEASKEELLRRYALTRRRHPLQRND-------------
Y523_PSELT       -VQAIKKLV--DNYSNIVTVLFLEASDEELLKRFATTRRRHPLE-GQ-------------
Y154_PETMO       -IELFKNVESLAKCTMEIHKVFLKADKSELINRYKKTRRTHPLG----------------
Y125_ELUMP       -KTLPKIIANIKKADFHVYTIFLDASDSKLVQRFSETKHKHPIQK---------------
Y433_ENDTX       -TSFKDLLIVFKKKNIGYKIIFFNATDSVLLRRYSETRRRHPLGK---------------
Y1089_FUSNN      -KDFFTFINYIKESGVKMDIIFIEAHEAIILGRYTLSRRAHPLKEV--------------
Y1129_DICTD      -ESFKEMVEIIKSRNIPYKILFLEAKDEVIVKRYNETRRIHPLLKEG-------------
Y235_THEYD       -EKATELIKRIKDI-YKIEVLFLEADDDTILLRYKETRRPHPLSTHY-------------
Y1502_DESVV      -EQALARLQEM---GVRPVLLFIEAEQGELMRRYATTRRPHPLESEG-------------
Y424_DESVM       -EKSLERLQGM---GVRPAVVFIEATPAVLNRRYATTRRPHPLESEG-------------
Y1774_DESAG      -EGALMRLEKM---GVSPRIIYLEADSDTLVRRFATTRRPHPLEGGD-------------
Y972_DESDA       -NEALSDLAAV---NIRPMLLFMECDAQELIRRYATTRRPHPLEREG-------------
Y459_LAWIP       -EHTFQEMRSQ---HIYFTLLYLEADMPTLIKRYAATRRPHPLEQYH-------------
Y1189_GLUDA      VLAALGRLRVNP--DLQAELIYATAEESVLLRRYTATRRRHPLAMRGTVK----------
Y815_GLUOX       VLEELERLRLLP--DCSVQLLYATAEPEILLRRFTATRRRHPLVTSGTIL----------
Y395_GRABC       LALAMERMRQLP--GVRADLVFVRADTAALLSRYTETRHRHPLASGVGVR----------
Y446_ACICJ       VLSTIDRLQTRG--CVRPELIFITASPEALQRRFSETRRRHPLALAGTVS----------
Y4396_MAGSA      VLAALDHLMGES--GLDVRLLFLDCEDDVLCRRFTETRRRHPMAVDRPLL----------
Y3448_RHORT      VLAAIERLVAAT--GFDVRLLFIDCDDEVLVRRYTETRRRHPLAVDRPLA----------
Y2868_RHOCS      LLQELDALRAHP--DLRVRLLFMEATEEVLQRRYTETRRPHPLAVDRPVP----------
Y2562_RHOS5      LIELIDGLTQDA--RVQLEVLYVDCSASELIRRYSQTRRRHPLAPAETPA----------
Y2850_PARDP      LIELIDRLTRLP--EYAPEVLFLDCTTEQLLRRFNETRRRHPLRGEGSPL----------
Y209_DINSH       VADLLHLLAEDP--RADAQLLFLDASPRVLTRRFSETRRRHPLAPLESPM----------
Y713_RUEPO       FLDLSKRLASLE--GFQVTTLYLDCSADILLRRFSETRRRHPMSPGSSPL----------
Y2438_RUEST      MVDMIDMLKARR--GLKTTVLYLDADAEILLRRFSETRRRHPLSPAESPE----------
Y1380_ROSDO      IVDALGKLTGIP--GLAPELLYLDCSTEVLLRRFSETRRRHPLAPVDRPS----------
Y539_JANSC       LIHAYEKLEQDP--AYTADLVFIDCEPATLQRRYSETRRRHPLAPDADPA----------
Y2120_ERYLH      IIELCKRLVQRD--DLTLTTLFLDCTSEELERRFNETRRHHPMARGRTAL----------
Y2904_NOVAD      TIELVKKLSQRS--DLQITTLFLDCAGTELERRYNETRRRHPMSEDKPAA----------
Y2050_SPHAL      LVRRIKELREGG--GRDIQTLFLDCAGAELERRFSETRRRHPLAEDRPAA----------
Y1325_ZYMMO      FLKGVEQLRQHH--SQPIDILFLDCSDSELMRRFDTTRRRHPLALDRPME----------
Y399_SPHWW       VVRRVRSLRDG---GRDASILFFDCSNTELSRRYSETRARHPLARDRQVE----------
Y3333_MAGMM      WQRLQPILQ-EM--TARLELLYLEADSDILVKRFRETRRRHPLAGRNMAGGG-------G
Y725_COPPD       SKFVADLKDLKN--RMPLDVIFLEASTDTLLSRFNLTRHLHPLVHATGSR----------
Y723_DEIGD       EDSYLRLSRRRE----DLRVLFLEATSEVLLRRYNLTRREHP--LGE-------------
Y1434_DEIRA      EPSYVRLSRRRE----DLRVLFLEANAEVLLGRYNLSRREHP--LGE-------------
Y319_THET8       EEVLEALRPT---------VVYLEARPEVLLRRYNLTRRVHP--LGAG------------
Y911_SYNJA       AFDR---WRQAQ----GIPFLFLEARPLVLLNRLSAHRRPHP-HRPGL------------
Y4163_GLOVI      IAARVALRSLAR----TTVHVHLDCPEGVLLSRYALTRRPHPWFDHGK------------
                                     ..       :  *    :   *                  

RAPZ_ECOLI       ---LSLESAID----KESDLLEPLRSRADLIVDTSEMSVHELAEMLRT--RLLGKR---E
RAPZ_PROMH       ---LSLEMAID----TESDLLEPLRSRADLIIDTSEMSVHELAEMLRT--RLLGKR---E
Y584_HAEDU       ---LSLASAIE----LENTLLDPLRQQADYLIDTTHSSPHELAANLRH--ILRGST---E
Y087_HAEPS       ---LSLENVID----LENHLLEPLFQHADYIIDTTYFSSHELAEKLRE--LLNGSS---E
Y1718_MANSM      ---LSLEAAIE----AEAGYLEPLLQNAELVINTSEISTHELAQRLRE--FLKGKP---D
Y169_PASMU       ---LSLEAAID----AERKYLDPLTQHADLIIDTTRLSTHELAERLRD--FLCEKS---D
Y1595_HISS2      ---LSLEAAIA----AEKEHLEPLVQHANVIIDTTPLSPHELAERLRE--FLRGNT---E
Y2532_VIBCH      --KPSLAQAIE----LEKQLLGPLKEQADLLLDSSNQSLHELSETVRM--RIEGRE---R
Y2760_VIBA3      --KLSLEQAID----LEKTLLAPLVEQASIVIDSSDCNLYELSEQVRF--KVEGKE---K
Y2673_VIBPA      --SLSLDQAIE----REKEILTPLKAHADLILNSSGQSLHELSETVRM--RVEGRD---R
Y445_VIBVY       --CHTLDQAID----LEKKMLKPLKEIADILLNSSNQSLHDLSEDVRY--RIEGKE---R
Y495_ALISL       --QCSLEQAVE----LEKSILCHFKEDADLVLDTTSKSIHDLSETLRS--RILGRE---S
Y3258_PHOPR      ---MSLEQAIQ----SESAIVADIKEHADLVIDTTNKSIHDLSETVRA--RVLGRE---S
Y571_PSEA6       ---KSLSGAIQ----AESQLLAPIAERADLYIDTDQLSIHQLAELVRE--RILGKK---S
Y4546_COLP3      ---MALDQAIA----LEKSLLEPISTNADLYINTSQLSPHQLADLVRE--RILGKK---T
Y2554_PSET1      ---LPLDLAIK----KEKELLDVLVTRADHVIDTTDLSVHQLAESMRE--TILGKK---D
Y318_AERS4       ---LSLDEAIR----EETNLLAPLSSTADLRIDTTSLSIHDLSELIKT--RVLGKK---E
Y393_IDILO       ---LPLLEALQ----AEHKMLEPIMERATWRLDSSDLSLHQLSEQVTE--RVLGRA---D
Y3091_SHEAM      ---VSLQEAIK----LEGKMLAPISNMVDHFIDTSNLNVYELADAVRQ--ILLGRT---D
Y674_SHEPW       ---ISLKEAIQ----LEGRQLEPLAKIVDHYIDTSNLNIYDLNDQVRE--ILLGNI---D
Y2894_PSYIN      ---LSLSQALE----LENELLEPIHKRAALSIDTTTLSIHNLNERLKI--HLQGST---K
Y127_PSYCK       NNVYNLPAAIE----KEIQLLQPIFKHADIKIDTSMLNIHQLKERLRD--YVG--V---D
Y2129_PSYWF      YEIKNLPSAII----KETETLRPISGNADITIDTSQLNIHQLKELVRE--YVG--A---D
Y3059_ACIAD      SRFKSLNECIQ----EEKQLLLPIQFRSTVHIDTTDKSVHDLKHTLLS--KLG--Q---S
Y549_ALCBS       --QRSLADAIG----HERELLANIRQRADLVIDSSNHDVHTLRNLMRE--RVARRE---A
Y2229_CHRSD      --EMTLAEAIE----QEQTYLAPIRDIGDLVIDTSSLSVHELRGRIAE--QVARHS---G
Y5324_HAHCH      --STSLKEAIA----KEKQLLEPIATLANLYIDTSDLSIYQLRDQVKI--RVIGHK---T
Y2718_MARHV      --KTSLREAIT----NEKQLLEPLSKLADLYVNTTGLSMYELRDMIKQ--RVAGRK---D
Y5038_PSEA7      --TRSLAEAIG----DESQLLGPIADLADLKLDTTSLNLYQLRDTIKL--RLLNKP---E
Y2809_CELJU      --STSLEEAIA----LEQNLLEPIRDAADQTIDTSHLNLHELRDLVKD--RVVGRT---E
Y3181_SACD2      --NTGLNEAIA----KEKVILEPVAAAADITVDTSHMSLHELRSTIKR--LVVGEE---S
Y739_METCA       --SVPLAEAIE----LERHLLEPVLSRADLHIDTTYTTIHQLRELVRQ--RVGIPS---G
Y722_THISH       --GMPLVEALR----LERSLLARIAVRADLTLDTTRTNVHQLTHLIRD--RVEQAG---G
Y2797_NITOC      ---IPLAEAIH----CERALLGTIAEKADLRIDTTCTTIHQLRDLISE--RIGDDA---R
Y2233_ALKEH      --DAALADAIA----REEALLAPLRARADLTLDTSNTNVHQLRDLVRE--RIEHDP---G
Y2130_HALHL      --DQPLADALR----AERTLLEPLREVADWSIDTSRTTVHDLRGLISE--RVAGER---S
Y950_STRM5       --GLSLPEAIA----RERELTAPLRREADAVIDTSTLNVHQLRRRIIT--EFALDH---A
Y1354_XANCB      --GLALPEAIT----RERELTAPLRAQADAIIDTSALNVHQLRRRVVT--EFALGN---S
Y753_XYLFM       --GLSLPEAIA----LERELTAPLREAAEAVIDTSTFNVHQLRRHVVT--EFALTH---S
Y2629_ACIF5      --AAALGESLLTVLRREREMVQPLADVADKRLDTSQINTHQLRLRVQAW-SLASRH---Y
Y3603_ACIAC      GEPHALLETLE----LERELLADLREQS-HVIDTSAIRAAQLQGYVKSLMPAL------P
Y1053_VEREI      QERKALVQIID----LERELLADLREAS-HVIDTSQIRASQLQSYVKSLMPGA------Q
Y831_ACIET       EGPRPLLHTMR----LERELLAPLREQA-HVIDTSTLRSSQLLSYVKDLLSVP------P
Y1300_POLSJ      DQHRALVDAIE----LERELLGDMREQS-HVLDTSMIRASQLQAYVKSLIAAP------A
Y1653_RHOFT      DQRRALVDAIE----LERELLADLRENA-HVIDTSIIRPSKLQGYVKSLISTA------S
Y5422_DELAS      EGRRALVQDIE----TERELLGDLREKS-HVIDTSHLRSSQLQSYIKELIAAP------V
Y3490_LEPCP      QTRSALIDAIE----HERELLASLREVS-TVIDTSDLRPAQLRTWVRQLVGAA------H
Y3336_METPP      DQHRALTDAIE----LERELLADLREAS-TVLDTSQLRAAQLRAWVRQLVQAP------A
Y3158_BORA1      EKSASLTDCIA----LERELLAPLRDQE-HVIDTTDLTPGQLRSWIRELIDAD------R
Y322_PARP8       GLLTSLAEAIE----RERELVAGLAEFG-HQIDTSNLRANVLRMWVKRFIEQE------H
Y403_RALSO       GPDTSLIEAIE----MERELLSPLADPA-HRIDTSTLRTNALRAYIKEFISDE------P
Y3120_JANMA      EDRRTLTECIR----EEREMLSGVEEIS-HVIDTSGMSANKLRGWIKALIESD------H
Y1915_POLAQ      TQSATLIEAID----RERNLLEPLRAQA-HSIDTSSLPAHALRSWIQDLLKDK------P
Y399_AZOSB       --NVSLDEAIQ----RERDALASVAELG-HRMDTSDIHANTLRAWIKDFIGAA--A---S
Y2061_AROAE      --DVSLAEAIQ----SERDALASIAELG-HRIDTSELHANTLRAWIKDFLAIE--A---T
Y081_NITMU       --QSTLPECIE----MEREMLREIHDLA-NRIDTSDLSASSLRAWIRDFIGLE--P---G
Y529_THIDA       --TVSLPEAIQ----LERETLADVAPLA-HRIDTSDLSASALRLWIKDLVGPD--R---S
Y1559_NITEC      --NITLEEAIQ----HEREVLATVSDLG-HHIDTSSLRPNALRAFIRDFISDSRDP---S
Y070_DECAR       --GQTLEEAIR----AERALLDPISDLG-HRIDTSGMKANALREWVRQFIEAE--P---G
Y3336_CHRVO      --GITVEESIL----LEQEMLADVLELG-TRIDTSELSANALRSWVRELVDAD------G
Y145_METFK       --TSTLAESIS----HERHMLEPLVDLG-LRIDTSSLSANALRNWVKEFVTQK------N
Y2029_LARHH      --ALTIPEAIA----RERQLLQAIAGLG-HRIDTSDLSPNQLRRYLRDVIAQA------P
Y698_NEIM0       --DMTLLESLK----KEREWLFPLKEIA-YCIDTSKMNAQQLRHAVRQWLKVE------R
Y399_DICNV       --SEQIIEAIE----KERKLLGSLNNIADMLIDTSNYRAADLRQQLMQ---LLNTT---A
Y2060_FRASN      ---ERVVDGINR----ERTLLAELRGEADLVLDTTDLNVHELRAKIDAAFGQPRAN----
Y5570_STRGG      ---GRIVDGIAA----ERDLLRELRGDADLVIDTSSLNVHELRAKMDAQFAGESEP----
Y2020_THEFY      ---GRLTDGISR----ERELLRSIRGEADLVVDTSQLNVHQLKAKMVGFFGKARET----
Y1111_ACIC1      ---GRLADGIAR----ERELLRDVRGVADLVIDTTNLNVHELRGKIIAAFSDDNQP----
Y2139_SACEN      ---GRLADGIAA----ERSLLSRLRSEADLVLDTTALSVHQLRAKIEDAFGTEAST----
Y1815_MYCUA      ---HTLAEGIAA----ERKMLEPVRATADLIIDTSTLSVRGLRENIERAFGGDAAA----
Y2783_MYCA9      ---QTLAEGIAA----ERALLSSIRASADLVIDTSSLPVPALRAAIERAFSSESVA----
Y3026_RHOE4      ---GTLSEGIAA----ERRQLAVVKAAADLVIDTSALKAHQLRQKIETAFGNDANR----
Y3593_NOCFA      ---GTLSAGIAV----ERVRLAGVKAAADLVIDTTELSIHQLHRKLEEAYGGGAPA----
Y3101_SALTO      ---GRLADGIAV----ERGLLEGARDQADVFVDTSHLNVNQLRRRIEELFGAEDAR----
Y2084_PAEAT      ---GRILDGIGI----EREVLRELREHADVVLDTSEFNVHGLATAITELFSDTGPV----
Y2275_RENSM      ---GRMLDGIAA----EREILALLRDSADVVVDTTSLNVHELANQVTGLFSDSGPV----
Y1207_KOCRD      ---GRILDGIRA----ERELLKDLRETADSVLDTTSFNVHALTRAVADMFSTSGPV----
Y2934_KINRD      ---DRIVDGIAR----ERALTGELRARADVVVDSSSFNVHQLGSLVASLFESERDE----
Y1991_CLAMS      ---GTLLDGIAA----ERARMIEIREASDLVIDTSELNIHQLATTITEQFSGADDA----
Y1149_LEIXX      ---GTLLDGITA----ERARLREIRESSDIIVDTSDLNIHQLATRITDIFADENTA----
Y2527_NOCSJ      ---GRLIDGLVR----ERGVLADLRGDADLVIDTTGLNVHQLTDRIADAFGTPDTV----
Y813_CUTAK       ---GHLLDAVAL----ERRMLSDLRAEADLVIDTTSITARQLAQRIDHAFAEGIDE----
Y1368_BIFA0      ---NRLIDGIHE----ERRLLENLEERADIVINTSKLSIHQLSTKLYEALTGNGPT----
Y1085_BIFLS      ---NRLIDGILE----ERHLLEDLKERADWVIDTSSLSIHQLSTKLYETMLGSGPT----
Y1710_COREF      ---QTLQVGIER----ERQMLSDLKEEADVVIDTSELSVHDLRRAIESSFRTIAKR----
Y1313_CORDI      ---GTLLVGIER----EREIMNQIKESADVVIDTSDLSIHDLRRSIELNFNGIANK----
Y1197_CORA7      ---ETLKAGIQR----ERAAVQSIRERADIIIDTTNLSVHDLRRAIEASFGEMGHE----
Y1004_CORJK      ---GTLQDGIDR----EREMLTSIRERADIVLDTTNRSIHDLRRELEKFFAAADHS----
Y2009_RUBXD      -----VLEAIRS----ERRELAPLRERADVVVDTSGLSALDVR---LRFKRLAESLS---
Y5766_SORC5      ---IAMLDGVLL----ERERLASLRARATIELDTTRLSTHDLRRVVIERLRPARVEV---
Y3782_KORVE      -----VKASIES----ERRRLAPIRKVADMMIDTSKFNVHELRALIFDRFGHARTQ--DH
Y7395_SOLUE      -----ITRSIQS----ERTQLAPIRAMADLTINTSKFTVHELRDFIGERFRGRR----DQ
Y619_ACIC5       -----VVHAIAD----EKQRLEPLRNVADMIVDTSRFNVHELRAYIQSKFTREG----NA
Y152_ANADF       -----VPDGIAA----ERQALAALKAIADEVIDTTTLNVHELKRLVTRRFATSE-----G
Y6564_MYXXD      -----VAEGIKA----ERQALRDLRELADQVIDSSTLNVHDLKRMVQARFSPEP-----A
Y1884_GEOSL      -----VPEGIRY----EREQLAGLRRLATHVIDTSELNVHQLKELVHSRIKGES----GT
Y2968_GEOUR      -----VPEGIRY----EREQLAGLRRLATMIIDTSELNVHQLRELVISHVKGNH----GG
Y872_GEOBB       -----VPEGIRF----ERDQLAGLRRIATAIIDTSEMNVHRLKELVIGLVKGGE----GV
Y2163_GEOLS      -----VPEGIRI----ERERLAALRQNATLIIDTSEFNVHQLKEQVIRAIKGEQ----GS
Y977_PELPD       -----VSEGIRI----ERERLSTLRQMATRIIDSSDFNVHQLKELILRIVRGED----AE
Y1935_PELCD      -----VAESIRQ----ERALLGGIMDLSTEIIDSSWLTPHQLRARVVHMVCGDD----KG
Y1358_DESAL      -----LLEGIRL----EKQVLEPLRSIAHRVVDSSNLNVHQLKAMIQEMGAQKN----ER
Y503_DESOH       -----LVSGIRR----ERELLEELRASSDTVIDTSTLTIHELKIRLLARIRKSA----DH
Y2790_DESAH      -----LIESIKS----EKSLMLPIRKISKRIIDTSNYNVHQLKAEIRNIAHHHAL---KP
Y1217_SYNAS      -----IMEGIRL----EREQLRALEEMADKVIDTTSCNVHQLKDIVQRHFLPSS----TA
Y2066_SYNFM      -----LVDAIHQ----EREQLRALRSRATRIIDTGTLSVHQLKAMITRTYSMIG----DT
Y4092_ALKMQ      ---GSIENGITR----ERELLQELKDRASHIIHTTKLIPAQLKEELRNIYVEGN----QM
Y574_ALKOO       ---GSIPEGIAL----EREKLKELKQKAKHIIDTTNLRSAQLKEELNNIYVEGN----QS
Y3400_CLOD6      ---MQIPEGIKM----ERKIMEPLKELSTCIIDTTNMKPKDLKEEIKKIYSSGE----DN
Y1284_CLONN      ---GRLIQGIEL----ERRRLNEVKYKANNIIDTSNMTQMQLREKIWRIYGDDEQ---IE
Y2495_CLOTE      ---GRILNGIAL----ERSRLKEVKDVASNIINTSKFTNMDLRQEITRIYGDGDQ---VE
Y511_CLOAB       ---GRILNGIQM----ERKKLKTLYNMANNVIDTSKLATRELREKINSIYQEEGQ---IE
Y4857_CLOB8      ---GRVLTGITQ----EREKLREVKNIADIIIDTSKYEIRHLREKINKNYGDHTY---PE
Y335_CLOPS       ---GRIITGISE----ERMRLRELKDRADNIIDTSNYPIRNLREKINLLYGDGKP---VE
Y2290_RUMCH      ---GRLLLGIRE----ERKALQTIKSKANYIIDTSTLVTRQLKQEINGIFLEGK----IF
Y113_HUNT2       ---GRLIKGIKT----EREILSQIRKNATYIIDTSNLTPRQLKEEILAIFVEGR----KF
Y1834_CALS4      ---GRIVDGINE----ERKRLSDIRKIANYIIDTSNLTSSQLKEELSNIFLKGK----KF
Y331_LACP7       ---GRVDKGIEL----ERRKLRFLKERADYIIDTSRLLVRELKTEIDNIFVQDG----TY
Y1160_CALS8      ---GSILEAIQK----EREKLEDIKRYADFIIDTSTLSPRDLKEKLFEIFSAQR----SR
Y1084_FINM2      ---GNISQGISN----ERELLSEVRNSADSIINTSNLTLGELRRKILYVFSLKD----VD
Y1588_HALOH      ---GRVLDAIRK----ERHLLEEIKGKANKIIDTSKLSKQELNHELKKVYSSYFI---GK
Y262_SYNWW       ---SRLLEAIQE----ERRMLQELRGKAHFLIDTSNLSPRELKEKLDLRYSED-----ET
Y646_HELMI       ---ARIFDSIQL----ERQMLADLRGRADKVIDTSDLSARQLKNQVFELFGKD-A---RH
Y258_MOOTA       ---GQILEGIIE----ERRRLEELRGRASKIIDTSELTPRQLKEQVSELFGSS-Q---R-
Y300_DESAP       ---GEIVEGIEA----ERLALRELRGLAHKIIDTSNFSVAQLKQEIANLYGGN-E---DR
Y2729_PELTS      ---GEILDVIRE----ERNRLRDLRGMANKIIDTSNMEVKQLKEEIAAIFGDS-T---VA
Y3054_DESRM      ---GEVLKVIQE----ERELLREIRGRATKVIDTSNVSNNQLKEQIITQYGGDKE---NS
Y4845_DESHY      ---GGILEGIQM----ERQMLTELRGVAHKIMDTSNLSSQQLRHQVAESFGNE-Q---AS
Y186_SYMTH       ---GRVLDGIQR----ERRLLQELRGLATFIIDTTHMTPADLRKELNRRFGQD-R---ES
Y272_CARHZ       ---SQILDNIKK----ERKFLENLRARADKVIDTSDLQPADLRNEILNYYGEE-Q---KR
Y2024_NATTJ      ---NSIKKAIEE----ERKELEVIRTQSHLIINTSNMSPRQLKDKIRRQYTPEGE---YE
Y3015_GEOTN      ----PPLEGIRL----ERQLLEEIKGRAQIIYDTTGLKPRELREKIVRQFSVHA----QS
Y2526_ANOFW      ----LPLEGINL----ERQLLEELKGRAQMIIDTSNLKPRELREKIVQTFATPT----TT
Y3115_BACP2      ----LPLEGIAM----ERDLLEELKGRAQMIFDTSDLKPKQLREKIVAHFATSQ----GQ
Y3698_BACCN      ----LPLKGIEA----ERGLLTDMKARANIVLDTSDLKPKELREKIVQLFSTET----EQ
Y3036_BACSK      ----LPLEGIQK----ERNLLEEIKGRAQQIIDTTELKPLQLREKIMQRFAGND----RQ
Y3569_BACHD      ----LPLDGIKK----ERELLEDLKGRAQQIIDTTDLKPIQLREKIIQRFSCEE----HH
Y2468_OCEIH      ----LPLDGIKQ----EREILDELRGRAQRIIDTTSLKPRNLREKILKVYKEEK----QE
Y448_LYSSC       ----LPLDGIKQ----ERALLSEVKGRANFVYNTSNMKPKQLREKIVKEFASEA----DT
Y126_LISMH       ----SVLDGINA----ERELLSDLKGRSQLVINTSNMAPRELRERINNEFQTED----KD
Y5262_BREBN      ----SPLEGIHA----ERRLLEEMKGWAHQIIDTSQMKPVQLREKIINQYG-QQ----GS
Y2405_EXIS2      ----SPLIGIER----ERTLLEGFRDKAQLLMDTSDIKPLALKERILKEFTEGE----RI
Y1952_STAS1      ---RSLIESINE----ERELLTEIKSLANYTIDTTQMKPKELRKRIGDYFNKSN----VQ
Y414_STACT       ---RSLIDAIEE----ERNSLTEIRSIANYVIDTTVLKPKELRAQINHLFNRND----IE
Y516_MACCJ       ---ISLIDAIQE----ERKLLADLRGVATHIIDSSESKPKALRSKVIEIFGSGK----DN
Y526_LACSS       ----RLMDGIHK----ERELLTEIRNQSQMVVNTSMLSPRELREQIFRVFKTS-----DN
Y779_LACPL       ----RVMDGVRK----ERELLAPLKDRASYVIDTSTLTPRELRESIFDKFETD-----QD
Y1073_LACCB      ----RLMDGIKK----ERALLTELRNRAQVVIDTTTLSPRQLREKIFLNFKESG----SQ
Y1171_LACS1      ----RILDGIHL----ERELLAPIKSNAQIIIDTSKLSPRQLREEIFKNFEAR-----DT
Y651_LACBA       ----RVLEGISR----ERELLAPIRQAAQLVIDTTKLSPRKLREEIFHNYETE-----TT
Y450_PEDPA       ----RVADGVRK----ERELLSPIKSEAQIVIDTTNMTPRELRSDIFGHFSTNK----TI
Y766_ENTFA       ----LVTEGIRK----ERAMLEEIKADAQLVIDTTDLSPRQLRERLNKELATR-----ET
Y831_STRT1       ----RVLDGIKL----ERELLSPLKSLSQNVVDTTKLTPRQLRKAISEQFSSKQ----DQ
Y619_STRS2       ----RVLDGIQL----ERELLAPLKNMSQNVIDTTELTPRNLRKVISEQFASQD----NQ
YJIE_LACLA       ----RTLDGITK----EREILADLKNLSEVVIDTSELTPRNLRARILQKFAS-S----TE
Y375_LACRJ       ----RILDGVEL----ERKLSTDLKSQADIVIDTTNVTPRNLKLRLNKLFGHG-----EG
Y356_LACF3       ----GVLPGIMR----ERQLLNDLKSQADLVVDTTTLTPRQLKQRITERFSPD-----EA
Y556_LACDB       ----RLLDGIRD----ERRILTPVRNRSNYILDTSKMTTKELKQKLQSKFGEL-----HK
Y866_LACJO       ----RLLDGIQE----ERNILSRTKNISNIIIDTSHLSTKELKTKLVDKFGDN-----RT
Y1518_THEAB      ---NSLEKAIQL----EREILTKALEFSDIVIDTSNLNPHQLREKLVEILGS------VK
Y1373_THEM4      ---TSLEKAILE----ERKLFIKILELSDIVVDTSNLNPHQLRERLVGILTS------VK
Y1159_FERNB      ---NSIGEAIEL----EFEIMKEIMEIADLVIDTTMLNPHQLRTKLTTFLEEK-----SE
Y898_THENN       ---VGLEEAIEK----ERQILLPIKEMADFVIDTTKMTSHQLREILGQSLMN------QS
Y523_PSELT       ---LSLQEAISK----EKELLRDMKEMS-VVIDTTGLDIHTLREKIG-SLLK------EE
Y154_PETMO       ---LSLENAIDE----EIKVMSEIESSCDIVIDTSSTEPTEFKKRFFQMIKE------DM
Y125_ELUMP       ----KLIAAIAQ----ERKQLEPLRNIADKEIDTTNLTLGELKEKLSKVLVCNL---KKD
Y433_ENDTX       ----SVSEGIKL----ERKIMDRIFTVADEIIDTSDLTIGELKKVISMLADICQ---SGK
Y1089_FUSNN      ----TLLRSILK----EKKILFPIREIADLVIDTTEIKTVELEKRFKKFILAKDGE-NTD
Y1129_DICTD      ---GTILESIRL----EKEKLWEIRNLATDIVNTSDFSIKELKEVILKIVTSLNT--TVK
Y235_THEYD       ---NDLHKAIKQ----ERELLYPLRCLSDRIIDTSNLNPHELKFLI----RSMYG--AEK
Y1502_DESVV      ---MGLELALAE----ERRRLAPVREAADLVFDTTSFSIHDLRRVIQRRWSSLKG---RM
Y424_DESVM       ---MGLEQALEQ----ERLRLAPVRETADLVVDTSSYSIHDLRRVIQKKWSSIQG---RI
Y1774_DESAG      ---LGLEAAVEH----ERNLLAPVRERADLILDTSEFSIHDLRRIVQKKWSSLGG---SL
Y972_DESDA       ---MGLEASLLS----ERNSLSPLREMADLVIDTSRFSIHDLRRAIQKRWSDSKS---KL
Y459_LAWIP       ---IGLEHALEE----EAKRLIPIRQTADIVLDTTTYSIHDLRRFLQKSWNPYPE---KI
Y1189_GLUDA      -------EGIEA----EIELTARLRAAADMVIDTSDLPPPELRQVVEMRFAPRHDRM--A
Y815_GLUOX       -------PGIEQ----ETALLAPLRANADLVIDTSDLPSPELRQLIETRFGSTG-----G
Y395_GRABC       -------DGIRA----EEILTASLVDVADLVVDTTDLPVTRLRAMIAERYGPEET----G
Y446_ACICJ       -------EGIET----EQALTRTLRNAADWVIDTSELSLAGLRQIIDQRFGLG------G
Y4396_MAGSA      -------DGIRH----ERALVSPLKRRADVMIDTTNQPPGEFKRLLAGHFGLESN-----
Y3448_RHORT      -------DGIAL----ERALVAPLKERASRCLDTSILPPAKLRAVIEAEFSLDHR-----
Y2868_RHOCS      -------DGIAL----ERTLLVPLREAAEVVIDTSQLSIHDVRRLLTGHFRLDGD-----
Y2562_RHOS5      -------EGVER----EIDLLAPVRARADHLIDTSEMSPHDLKAELARWFDRGAA-----
Y2850_PARDP      -------DAIRA----ERDMLGPIRARADVLVDTSELSPHDLKAELARWFETEPG-----
Y209_DINSH       -------DGIAR----ETDLLAPIRARADVVIDTSELSPHDLRAEMLRWFGDRDS-----
Y713_RUEPO       -------EGVEH----ELELLRPIREAADTLIDTTALNVHQLRREVERWFAPSGG-----
Y2438_RUEST      -------LGVSR----ELDLMQPVKERSDVVIDTSDLNVHQLRAEVERLFAPSG------
Y1380_ROSDO      -------EGIVR----ELEMLGPLKARADVLIDTTHLNVHELRAEVEHWFAPGGK-----
Y539_JANSC       -------DGIAI----EREMLAPLRTRADVLIDTTPLTVHRTRDEVIRLFALDRA-----
Y2120_ERYLH      -------EGIRA----EREVMEPLRRWAEAVIDTSELAANELQQLIREQFHHDDP-----
Y2904_NOVAD      -------TGIAA----ERELLEPLRRWADVVITTTSFTTNDLQQAIRDQFGGEIA-----
Y2050_SPHAL      -------DGIAR----EREMMEPLRRWAEHVVDTTNYSSNDLQQEVRQRFGEADD-----
Y1325_ZYMMO      -------DGISE----ERAFLAPVREIADFLIDTTTTSSHSLQSELRQQFAPENS-----
Y399_SPHWW       -------DGISY----ERELLAPLREAADELIDTTDSSTNELQALLRRRFGDSAG-----
Y3333_MAGMM      EALRTVKEAVEE----ERLRMQPVRAQANLVIDTTYLRPQMLQERVADLFRMDAHN---T
Y725_COPPD       ---IALIEAIER----EKELMSELRDVSDVVLDTTGMKERDLVYQVENFIGKD-------
Y723_DEIGD       ----TLLVDFAR----ERELLAPLRALADIVIDTTDLTAAELSQKVLQMLR-LEQD----
Y1434_DEIRA      ----TLMVDFAR----ERELLAPLRGIADTVIDTTDLSAAQLSQRVMHLFR-LEHA----
Y319_THET8       ----NLMREIAE----ERRALAGLRGRAHLVVDTSELSPRGLKEALARFLG-EEGG----
Y911_SYNJA       ----GLLEAIEQ----EVRDLAPVRERCTHLLDTSELNSQQLRQQLQALVHGIPQP----
Y4163_GLOVI      ----GLLAAIRA----ERTALEPVRALADEVVDTGPLELAQLRVHLGALVGGRPTE----
                          .      *                :                          

RAPZ_ECOLI       RELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHN
RAPZ_PROMH       RELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDRPVAAFLDRHTEVHN
Y584_HAEDU       KELNIVFESFGFKYGLSADADYVFDVRFLPNPHWHAELRAMTGLEQPVIDFLERQTEVHN
Y087_HAEPS       KELNIIVESFGFKYGIPADADYVFDVRFLPNPHWNLELRPMTGLEKPVIDFLENQSEVHQ
Y1718_MANSM      KELKIVVESFGFKYGLPLDADYVFDVRFLPNPHWNPDLRPMTGLDQPVIDFLGKYSEVNN
Y169_PASMU       KALKIIFQSFGFKYGLPLDADYVFDVRFLPNPHWIPELRPLTGLDAPVAEFLNKQNEVNH
Y1595_HISS2      KELQIIVESFGFKYGIPLDADYVFDVRFLPNPHWNQELRPMTGLEKPVIEFMQKHIEVDN
Y2532_VIBCH      KDLVMVFQSFGFKYGLPTDADYVFDVRFLPNPHWEPDLRPLTGLDAPIKSFLEGHSEVME
Y2760_VIBA3      QELIIVFQSFGFKFGLPSDADYVFDVRFLPNPHWEPALRPLTGLDAPIHSFLEKHAEVLE
Y2673_VIBPA      KGLVMVFESFGFKYGLPSDADYVFDVRFLPNPHWEPALRPLTGLDAPIAAFLEQHQSVLS
Y445_VIBVY       NKLIMVFESFGFKFGLPTDADYVFDVRFLPNPHWEPALRPMTGLDAPIKTFLESHDEVLE
Y495_ALISL       KELVMVFESFGFKHGLPTDADYVFDVRFLPNPHWEPTLRPMTGLDKPVADYLEKHAEVIQ
Y3258_PHOPR      RKLILVFESFGFKHGLPTDADYVFDVRFLPNPHWVPELKPQTGLDQEVKEFLVGHAEVNK
Y571_PSEA6       SRLVLVFESFGFKHGIPKDADYVFDARFLPNPHWEPDLKPLTGLDSPVEIFLGSQPIVTK
Y4546_COLP3      GSMVLVFESFGFKHGIPVDADYVFDARFLPNPFWEKSLKGQTGVDQEVKDFLASQAIVTK
Y2554_PSET1      KQLIITFESFGFKHGIPKGADYVFDARFLPNPHWEPELKPLTGLDQPVKDYLASHSIVQK
Y318_AERS4       NELVLVFESFGFKYGIPKDADFVFDARFLPNPHWIPELKPFTGKDEPVARYLSSQPDVMQ
Y393_IDILO       KKLIIVFQSFGFKYGLPKDADFVFDARILPNPHWQPELKLLTGLDTDVQIFFRQEPLVTK
Y3091_SHEAM      KELVIIFESFGFKHGMPTEADFMFDARFLPNPHWEPELRPLTGLDEPVKLFLERQVLVNK
Y674_SHEPW       KELMIKFESFGFKHGMPTEADFMFDVRFLPNPHWEPELRPMTGLDKPVQDFLNQRPLVNK
Y2894_PSYIN      SNLLIIFQSFGFKNIHPDDADYIFDVRFLPNPHWEPTLQKYTGKDQPVKAFLNGHLVVKQ
Y127_PSYCK       NQIVINLLSFGFKYGSPIDADFVFDVRILPNPHWNPTLRSATGLDAEVSAFFADYPEVAE
Y2129_PSYWF      NQITVNVLSFGFKYGVPIDADFVFDVRILPNPHWEPQLRVKTGKDTEVAAFFANFPQVEE
Y3059_ACIAD      DKLILILQSFGYKHGIPLDADYVFDVRHLPNPHWDLELRRFSGLDEPVRRFLESSDQTNE
Y549_ALCBS       -TLSLQLESFGFKNGLPTDADLVFDVRVLPNPHWHADLRPFTGKDDCIIEFLSQHQASHD
Y2229_CHRSD      RHLTLTFESFGYKRGVPLDADMVFDARCLPNPYWDPQLRGFDGRDAQIVTFLEAYPDVRA
Y5324_HAHCH      QELALLFQSFGFKHGVPSDSDMVFDVRCLPNPYWDTALRGYKGTDQEIIEFLKQHPEPEQ
Y2718_MARHV      QELALLFQSFGFKHGVPVDSDYVFDVRCLPNPYWDTSLRKHTGVDQPVIDFLEREPLTRQ
Y5038_PSEA7      PGTAFLVESFGFKRGMPVDADLVFDVRCLPNPYWKPELRDHSGLEPEVREYLAAQPDVEE
Y2809_CELJU      ATMAILFESFGFKHGTPVNADLVFDARCLPNPHWKPHLRPQTGLDADVVEFLEEQVTVQE
Y3181_SACD2      KGMAIMFKSFGFKYGVPVDADFIFDVRCLPNPYWSPELRSQSGLEAGVIEFLNSQQEVDD
Y739_METCA       GLMSLCLQSFGFKHGVPMDTDFVFDARCLPNPHWTASLRPKTGKDPEVVAFLAESADVHD
Y722_THISH       DALSLLFQSFGFKHGSPVDSDFVFDVRCLPNPYWEPRLRSLTGRDPDVGAYLDEHAVVQE
Y2797_NITOC      PGMSLLFQSFGYKHGVPLDADFVFDVRCLPNPHWEPHLRPLSGRDSEVIAYLKRHETVTQ
Y2233_ALKEH      -RLSLLFQSFGYKHGIPPDADYVFDARCLPNPHWEPRLRPLTGLDAPVQHYLEAQPEVAE
Y2130_HALHL      -GLSVLVQSFGFKHGIPTDADYVFDARCLPNPHWEPQLRAYTGCDDCVRAFLESQPETEI
Y950_STRM5       TRLSLLFESFAYKRGVPAEADFVFDARVLPNPHWDPDLRALSGREPGVRDYLEAQPDVQH
Y1354_XANCB      DRLSLLFESFAYKRGVPAEADFVFDARVLPNPHWDPELRPLTGRDAGVRDYLDKEPDVIR
Y753_XYLFM       DKLSLLFESFAYKRGIPTEADFVFDARILPNPHWKPELRSLTGRDSNVRDYMEQQPDVIL
Y2629_ACIF5      SGLVLLLQSFAFKKGLPLDSDFVFDLRALPNPHYDPELRALTGRDAPVRDFLEKSPEVAR
Y3603_ACIAC      GQLTLVFQSFAFKRGVPVDADYVFDVRMLPNPHYEPGLRNLTGKDQPVVHYLEQAREVRQ
Y1053_VEREI      GQLTLVFQSFAFKRGIPMDADYVFDVRMLANPYYEPALRELTGLDEPVADFLQLQPDVDL
Y831_ACIET       SRLTLVFQSFAFKRGISMDADYVFDVRMLPNPHYEPLLRALTGKDAPVIDYLRQQPEVAL
Y1300_POLSJ      PQLTLVFESFAFKRGVPLDADYVFDVRMLPNPHYEPDLRHLTGCDLAVADYLKAHAEVND
Y1653_RHOFT      EQLTLVFESFAFKRGIPGDADYVFDVRMLPNPHYEPELRQLTGRDLPVADFLKEQADVAL
Y5422_DELAS      GQMTLVFQSFGFKHGLPSDSDYVFDVRMLPNPHYEPQLRPLTGMDAPVAEFLRQQPGVDQ
Y3490_LEPCP      SSLTLVFESFAFKHGVPRDADLVFDLRVLPNPHYVRELRPLNGRDAGVIDFMHAQPEAAE
Y3336_METPP      GALTLVFESFAFKHGVPLDADLVYDVRVLPNPHYIDELRPLTGRDAPVADYLQQQPEVGE
Y3158_BORA1      APLVLTFQSFAYKRGVPNDADLVFDVRCLPNPYYDRNLRPLTGRDQPVADWLAGFEIVQR
Y322_PARP8       TGLALMFESFGFKRGVPLDADFVFDVRTLPNPYYDRELRPLTGLDRPVIDFLEALPVVQQ
Y403_RALSO       HDITLMFESFGFKHGVPTDADLVFDVRSLPNPYYDTQLRPLTGRDQPVIDFLQSQPMVLA
Y3120_JANMA      SPLTVLFESFAFKFGVPLDADLVFDVRMLPNPHYDSQLRPLTGRDAPVQAFLQDQPDATA
Y1915_POLAQ      TGLTVVFESFGFKKGVPSEADLVFDVRCLPNPHYDKILRPLTGNDKPVKEFLEKIPEVIS
Y399_AZOSB       EGLTLMFQSFGFKYGIPLDADLVFDVRCLPNPYYDPLLRPLTGRDQGVIDYLEKVPEVGR
Y2061_AROAE      EGLTLMFQSFGFKYGIPLDADLVFDVRCLPNPHYDLRLRPFTGKDQPVIEFLDSFPEVGR
Y081_NITMU       R-LTLLFQSFGFKHGIPLDSDMVFDVRCLPNPHYEALLRPLTGKDGAVIEYMDANSSVNR
Y529_THIDA       R-ITLLFESFGFKHGIPLDADLVFDVRCLPNPHYVEELRPFTGRDPGVREFLEASPDAMA
Y1559_NITEC      Q-LTLMFQSFGYKHGIPLDADLVFDIRCLPNPFYDPHLKELTGHDLEVIRFMEAQPNAAK
Y070_DECAR       QGLTLMFESFGFKYGIPLDADLVFDVRCLPNPHYDPELRPFNGKDKPIIDFLEGEDEVCR
Y3336_CHRVO      NRLTLIFESFGFKHGVPQDADFVFDARCLPNPYYDPQLRPFTGRDEPIIDFFSGNKAVAE
Y145_METFK       GELILLFSSFGFKHGIPLDADYVFDVRCLPNPYYDPALRPQTGQDKPVCAFLEAHDSVQN
Y2029_LARHH      GRMLVVIQSFGFKHGVPLDADFVFDVRCLPNPYYDPALRPFTGRDAPIINFLTAEPLVQA
Y698_NEIM0       TGLLVILESFGFKYGVPNNADFMFDMRSLPNPYYDPELRPYTGMDKPVWDYLDGQPLVQE
Y399_DICNV       PHLLITLQSFGFKHGIPVNADFVFDVRFLPNPYWEARLRAFNGKEQPIIDWLEQFAEPRQ
Y2060_FRASN      -RLNATVISFGYKYGLPLDADLVADCRFLPNPHWVEALRPYTGRDSQVRDYVLAQPGATE
Y5570_STRGG      -ELRATVMSFGYKYGLPVDADLVVDCRFLPNPHWVPELRPFTGVNEEVSDYVFDQPGAKE
Y2020_THEFY      -RLRANVVSFGYKHGLPVDADLVLDCRFLPNPHWVPELRPLTGQDEPVRDYVLAQRGAKE
Y1111_ACIC1      -ALRATVVSFGYKYGLPADADLVVDCRFLPNPHWVDELRPLTGRDDAVREYVLAQPGAQD
Y2139_SACEN      -RTRVTVLSFGYKYGLPMDADLVMDCRFLPNPFWIPELREFNGLDEEVRNYVLGQEGAEE
Y1815_MYCUA      -ITSVTVESFGFKYGLPMDADMVMDVRFLPNPHWVDELRPLTGQHQAVSDYVLGRPGASE
Y2783_MYCA9      -HISVTVESFGFKYGLPMDADMVVDVRFLPNPHWVDELRPHTGQHPSVSHYVLSQPGADE
Y3026_RHOE4      -TMKVTVQSFGFKYGLPMDADLVCDVRFLPNPHWIPELRPHTGQDADVRDYVLSREGAED
Y3593_NOCFA      -ALQLTVQSFGFKYGVPLDADMVLDVRFLPNPHWIPELREHSGQETVVSEYVLSRPGAQD
Y3101_SALTO      -RLRVTVVSFGFKYGVPPDADFVCDARFLPNPYWVPELREHTGQVEAVSSYVLGQAGAED
Y2084_PAEAT      -TLRLNVMSFGFKYGLPVDANFVADARFIPNPHWVPQLRPHTGLDEDVSDYVLGAEGVQE
Y2275_RENSM      -VLRLTVMSFGFKYGLPVDANYVADVRFLPNPHWVPALRPHTGLDQDVSDFVLIENDANE
Y1207_KOCRD      -VLRLTVMSFGFKYGVPADANFVADVRFIPNPHWVPALRPRTGKDPEVRDYVFATDGAQT
Y2934_KINRD      -DLRVTVMSFGFKYGTPADAEHVADVRFIPNPHWEPDLRPLTGQDVPVAEFVLAAEGAGT
Y1991_CLAMS      -GVRVTVMSFGFKYGTPADADMVADMRFLPNPFWTPELRPLTGRDKAVSDYVLGQEGAEE
Y1149_LEIXX      -DVQVTVMSFGFKYGLPADADLVADARFLPNPFWKPELRPYTGLDEVVRNDVLQQNGAEE
Y2527_NOCSJ      -RLKVTVISFGFKYGIPVDADFVADMRFLPNPHWIPELRPRTGRDAAVADYVMAQPAAAE
Y813_CUTAK       -GLAFQVMSFGFKRGVPIDADLVFDVRFLPNPYWVPELRPKTGLSSDVASYVMAQAGATE
Y1368_BIFA0      -TVSVHIFSFGFKYGIPIDADFVADVRFLPNPYWVPQLRELNGHDAPVSEYVLSNDKATQ
Y1085_BIFLS      -TVAVHIFSFGFKYGMPIDADFVADVRFLPNPFWVPNLRELTGHDKPVADYVLSSKGAKE
Y1710_COREF      -VQHVTIESFGFKHGSPRDADFIIDARFLPNPFWVPELRPFRGVDKPVSDYVLSQKGAGE
Y1313_CORDI      -LQHVTVQSFGFKHGSPRDTDLLIDVRFLPNPFWVPELRPFRGTDKPVSDYVLADEGAQK
Y1197_CORA7      -LQHVTLESFGFKHGSPRDADLVVDVRFLPNPYWVPELRGYRGTDEPVADYVLSQDAAEP
Y1004_CORJK      -SVRINVQSFGFKHGPPKDIDMLLDARFLPNPYWDPELRPFKGIDAPVSDFVLSQPGAQA
Y2009_RUBXD      GRLTVSLISFGFKHGAPLDVDTLFDVRFLPNPHYDPALRPLTGRDPAVREAVLAHPDARE
Y5766_SORC5      PRMSTRFVSFGYKYGIPLDADLLFDVRFLDNPYFVHGLRELTGNDEPVREYILKNPDALE
Y3782_KORVE      KKILVSCVSFGFRKGVPDDADLLFDVRFLPNPHFVPEFRPFTGRHPKVAKYIRSFPQTQE
Y7395_SOLUE      SDIMIYVASFGYRNGVPPDSDLVFDVRFLPNPNYIPRFKNLTGRNPDVAGYIRSFPQTVE
Y619_ACIC5       KSMLITCMSFGYKNGVPLDADLVFDVRFLPNPHFIPQFRPLTGKDAKVVRYIRKFEQTRT
Y152_ANADF       ARLGVTVVSFGFRFGLPTHADVVLDVRFLPNPYFIPELKPHPGTDPRVARFVLGQPDAKA
Y6564_MYXXD      AGPSLSIMSFGYRYGVPPQADLVLDVRFLPNPYFVPEMKGLTGKVPKVAAYVLEREETQQ
Y1884_GEOSL      RPLTIHLQSFGYRFGIPLESDIVMDVRFLPNPHFVPELKAGTGLDENVRTYVLEKPETRQ
Y2968_GEOUR      REMTIHLQSFGYRYGIPLESDLVMDVRFLPNPYFVPELKEFSGLNPNVRDYVLKYEETRI
Y872_GEOBB       LEMQVNLQSFGFRYGLPLESDLVMDVRFLPNPYFVATLRPFSGLDQGVREYVMGHKETVV
Y2163_GEOLS      SNFTVEVVSFGFRYGVPLDASLVMDVRFLPNPHFVPALRPYSGQEPAVRQFVLEQPDTTA
Y977_PELPD       TPMVIEIKSFGFRYGIPLESSIVMDVRFLPNPFFVPRLKPGSGLDDEVREYILDNPKTAT
Y1935_PELCD      NPLAVLVQSFGYRYGIPQGSDLVMDVRFLPNPHFVPDLRPQTGLSQGVRDFVLGQPACRE
Y1358_DESAL      KSIQISVLSFGFKYGIPRGADLVMDVRFLPNPYFVPELKNLTGLQAPVQEFVLEKPVTQE
Y503_DESOH       MPMRIHVMSFGYKYGIPHDADIIMDVRFLPNPYFVDPLKHKNGTDADVAAHVLNHSTGSA
Y2790_DESAH      VSMKINLLSFGFKYGIPTDADLVVDMRFLSNPFFVPELKALNGRTKEVKDFVLETIQAKT
Y1217_SYNAS      RRLFIHLISFGYRYGLPADADLVLDVRFLPNPYWVESLKSFNGHHQDVRRYVLSAEASSI
Y2066_SYNFM      ELLSIQVLSFGFKYGLPFEADMVMDVRFLPNPYFVEALKNLDGRSEEVSSWVLRWTATRE
Y4092_ALKMQ      NNLMISIASFGFKHGIPLDSDLVFDVRFLPNPFYIEELKDFTGNDVKVRNYVMNSPISVE
Y574_ALKOO       NNLIISIVSFGFKHGIPLDADLVFDVRFLPNPFYIEDLKELTGNDKKVRDYVMNAPISVE
Y3400_CLOD6      PNLTISVVSFGFKHGILADADLVFDVRFLPNPYYVEELRAKTGDDKEVRDYVMNSKISEE
Y1284_CLONN      NRLIIDVLSFGFKYGIPVDADLVFDVRFLPNPYYIPELKQFSGDDKEIQDYVLGFKETKE
Y2495_CLOTE      AQLTITVVSFGFKYGIPLDSDLLFDVRFLPNPYYIPELRNFSGNDKPVYDYVLEFNQTKE
Y511_CLOAB       SKLIVTVVSFGFKYGIPVDSDLVFDVRFLPNPFYIPELKRFSGIEKPVKDYVMSFDQTKE
Y4857_CLOB8      KQLSITVLSFGFKYGIPVDSDLVFDVRFIPNPFYIPELKQYSGNDEPVKDYVLKQEETVN
Y335_CLOPS       QNLSITVLSFGFKYGIPSDSDLVFDVRFIPNPFYIPELKPFSGEDEPVKNYVLAQEETKG
Y2290_RUMCH      KGIIINVVSFGFKYGIPTDCDLVFDVRFIPNPYYIAPMKNQTGKDQMVKEFVLNASETKE
Y113_HUNT2       DGMIVNIISFGFKYGIPIECDLVFDVRFIPNPYYIESMKYKTGKDEEVRNYVMSFAETAE
Y1834_CALS4      KGIIIDVMSFGYKYGIPLEADLVFDVRFLPNPFYIDELRPLTGNDEKVKEYVMKWEEAKE
Y331_LACP7       RNFFITVLSFGFKYGLPNDADLVFDVRFLQNPYYVPKLKSKTGNEPEVRDFVLSLEQAEE
Y1160_CALS8      ETMLITVMSFGFKYGLPLDADLVFDVRFIPNPFYVEELKHKTGKEKEVKEYVLKWDVTKE
Y1084_FINM2      TKLAISVVSFGFKHGILLDADLVFDVRFLPNPYYIEELKKSSGLNTDIKDYVFGFDEANE
Y1588_HALOH      QSMSVTIISFGYKYGIPMDADLVFDVRFLPNPYYVRSLKERTGEETVVQDYILKWPVTQK
Y262_SYNWW       LRFSASIVSFGYKLGLPMDSDLVIDVRFLPNPFYDPLMRTMTGKDPMVIDYVLESSVTKS
Y646_HELMI       SQLRITIVSFGYKYGTPRDADLLMDVRFLPNPFYEPALRNLTGNDEPVQEYVLSSPTTKV
Y258_MOOTA       -RLIVSIISFGYKYGIPLDADLVMDVRFLPNPYYVPALRPFTGHDRCVEEFVMASPVTRQ
Y300_DESAP       ERLAITAVSFGYKYGIPLDADLVIDVRFLPNPHYEPQLQPLTGLDEPVREYVFEAPTTSE
Y2729_PELTS      SRLHITVVSFGFKYGIPLDSDLVIDVRFLPNPYYQPSLRVLTGNDPAVRDFVFSSPVTEE
Y3054_DESRM      NRLLITVISFGYKYGIPMDSDLVLDVRFLPNPYYIPELRCLTGNDEPVQQHVMSQDVTKE
Y4845_DESHY      GHLAVSVVSFGFKYAIPLDVDLLIDVRFLPNPFYVAELRPLTGEHPQVQDYIFSNPVAQE
Y186_SYMTH       PHFHVNVVSFGFKHGAVLDADLVFDVRFLPNPHYVPDLQPLTGEDPAVVEYVMKWNVTQQ
Y272_CARHZ       SKISINIVTFGYKYGLPLDADLIMDVRFLPNPFYVKELRPLSGSDKPVYDYVFNYEVTKK
Y2024_NATTJ      SNLFVSIISFGYKHGLPLDADLVFDVRFLPNPYYVDELRPLSGNDDSVEQYVLHFDATKQ
Y3015_GEOTN      G-FTVNVMSFGFKYGIPIDADLVFDVRFLPNPYYIEHMRPKTGLDDEVSSYVLKWGETQK
Y2526_ANOFW      T-FSVNVVSFGFKYGLPIDADLVFDVRFLPNPHYIEHMRPKTGLDEEVSSYVLKWTETQK
Y3115_BACP2      V-FTVNVMSFGFKYGLPIDADLVFDVRFLPNPYYIESMRPQTGNDEEVRSYVMKWSETQK
Y3698_BACCN      A-FRVNVMSFGFKYGIPIDADLVFDVRFLPNPYYIPHMKPLTGLDEEVSSYVLKFNETHK
Y3036_BACSK      A-FAVHFVSFGFKYGIPIDADLVFDVRFLPNPHYVEDLRPKTGLQTEVSSYVLKWKETKQ
Y3569_BACHD      S-FTVNMMSFGFKYGIPIDADLVFDVRFLPNPHYVDHLRPKTGLEGEVSSYVLKWTETQQ
Y2468_OCEIH      V-FSVHFVSFGFKYGLPIDADLVFDVRFLPNPHYVSNLQPLTGLNPDVSSYVFKWSDTQT
Y448_LYSSC       I-FTVNIMSFGFKHGMPIDADLVFDVRFLKNPYYVEELRPKTGLQTEVSSYVLALEDTQI
Y126_LISMH       V-FNVQLMSFGFKYGIPIDADLVFDVRFLPNPHYIDKMRPLTGLDEDVYEYVMKWPETQT
Y5262_BREBN      P-LTINVLSFGFKYGAPIDADLMFDVRFLPNPHYVEDLRPKTGCDPDVAEYVMQHKDTKE
Y2405_EXIS2      P-FTVNVMSFGFKHGLPLDADLVFDLRFLPNPFYIPELRPKTGLDLEVSSYVMQWPEAKL
Y1952_STAS1      T-FNINVTSFGFKHGIQMDADLVFDVRFLPNPHYVDELRPLTGEDEAVYKYVMKWKETNI
Y414_STACT       T-FSISVTSFGFKHGIQQDADLVFDVRFLPNPFYVEALRPLTGVDDEVYQYVMKWQETAI
Y516_MACCJ       I-FTINVMSFGFKHGLPIDADIVFDVRFLPNPYYIEEMRKLTGLDPLVYDYVMKWKETEM
Y526_LACSS       PSFHIEVMSFGFKYGLPIDADIVMDVRFLPNPYYVAEFKALNGLDKPVRDYVMEQPATEK
Y779_LACPL       ETFHIEMLSFGFKYGLPIDADIVMDVRFLPNPYYIPELKKLTGLDKPVADYVMQQPATEA
Y1073_LACCB      PAFHIEVMSFGFKYGLPIDADIVMDVRFLPNPFYIKDYRPKTGLDPEVYNYVMDNEDAES
Y1171_LACS1      KTFHIEVMSFGFKYGLPIDADIVMDVRFLPNPYYVSELRNKTGKDDAVYEYVMKSEKTEE
Y651_LACBA       QAFHIELMSFGFKYGLPIDADIVMDVRFLPNPYYLPELRNQTGMDQPVYDYVMNQPQTEE
Y450_PEDPA       PKFHIEVVSFGYKYGSPIDADIIMDVRFLPNPYYVTELKNKIGTDPAVYDYVMNQPATEE
Y766_ENTFA       HEFRVEMVSFGFKYGLPIDADIVMDVRFLPNPHYIDELRPLTGMDQPVYDYVMGFPETDE
Y831_STRT1       SSFRIEVLSFGFKYGLPLDADLVFDVRFLPNPYYDPTLRNLTGLDKEVYDFVMTHKESED
Y619_STRS2       PSFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYKLELRNLTGLDAPVFDYVMEHQESEE
YJIE_LACLA       STFRIEVMSFGFKYGLPLDADLVFDVRFLPNPHYITELRDKNGTDKEVYDYVMEHPQSEE
Y375_LACRJ       NDFYVEVMSFGFKYGLPLDADIVMDVRFLPNPFYIPELKHLTGNDPAVQNYVMQSPLAKE
Y356_LACF3       HSFYVNVMSFGFKYGLPLDADLVIDVRFLPNPYYIPDLKYQTGNDPAVQAYVMDNPLAQN
Y556_LACDB       PKFGIEVMSFGFKYGMPIDADIVMDVRFLPNPFYIPELRPFTGLDKRVFNYVMDKDETKV
Y866_LACJO       RTFSIEVMSFGFKYGIPIDADIVMDVRFLPNPFYIPQLKPFTGLDRRVFDYVMSKKETKE
Y1518_THEAB      KKFLVRILSFGFKYGLPLDVDFIFDVRFFPNPFYIKDLREKSGRDEKVKEFLYNTQGVKE
Y1373_THEM4      KKFRLRILSFGFKYGVPLDVDFIFDVRFFPNPFYVVGLRQKSGKDKEVKNFLYNTQGVKE
Y1159_FERNB      KTFVVHVISFGFKYGMPLDADFVFDARFFPNPFYINELRPKTGKDEEVKEFLRKIDGVSE
Y898_THENN       GGISVRILSFGFKHGIPMDADFIFDARFLPNPHYVPELSHKTGLDREVEEYFKKYSLVDE
Y523_PSELT       AQFVIRIRSFGFKYGLPADTDFIIDTRFLPNPYYDRKLAQLNGTDQEIVNFFSKYPVVED
Y154_PETMO       KKLKLNFISFGFKNGIPPISDYVFDVRYLPNPFYFPEMYELTGLDMKVMEFLEKFKETHE
Y125_ELUMP       SEMQISVLSFGFKHGIPLEADLVVDVRFLPNPYYQPKLKEKTGLDSPVAKYIMSFPEANE
Y433_ENDTX       QYLNTSILSFGYKYGLPNDADIVYDVRFITNPNYVHGLKFKTGRDEAVRKYIERQKEFSV
Y1089_FUSNN      ININIHIQSFGYKYGIPTDSDLMFDVRFIPNPYYIEKLKELNGFDEEVKEYVLSQKESKE
Y1129_DICTD      PNFLITITSFGFKYGVPIDAHLVFDVRFLPNPFYDPKLRPFSGKSEEVRGFVLSKKEARD
Y235_THEYD       ISPSITIISFGYKKGIPANADLIFDARFLPNPYFIPSLTDLNGKDKPVKDFVLKQNETIE
Y1502_DESVV      RSLRVNIISFGYKYGVPKEADLVFDLRFLPNPYFDTSLRPQSGLDAPVVEYVFGTDSART
Y424_DESVM       RSLRINIVTFGFKYGVPADADLVFDLRFLPNPYFVPDLRPLSGLDEPVAKYVLEAGHGET
Y1774_DESAG      RSLRVNLITFGFKYGVPSDADMVFDLRFLPNPYFDAKLKALSGKDPEIQQFVLGCEQGKT
Y972_DESDA       RAIRVNVISFGFKYGVPREADFVFDLRFLTNPYFVADLRPMCGKDKEVAQYVFEQPHARE
Y459_LAWIP       RSIKINIISFGFKYGVPNEADLLFDLRFLPNPYFVEELRPLSGMDKKVATYVLNSASGIK
Y1189_GLUDA      EGLTVALMSFAFPAGLPREADMVFDARFLRNPYYDPDLSVRNGLDQAVADYVASDPDYPR
Y815_GLUOX       EGLTVALMSFAYPSGLPREADMVFDARFLRNPHYDPTLQPMTGLDEAVVQYVKSDPAYPA
Y395_GRABC       QGMVVSLISFAYPKGLPREADLVLDARFLRNPHYDPTLKPRTGQDRDVAAYIEADPDYAT
Y446_ACICJ       PGMSITLVSFGYPSGLPQEADLVLDTRFLRNPHYIPDLRDRTGLDPQVRDYIRQDPDFPE
Y4396_MAGSA      GGLGVFVTSFAYRNGLPREADLVFDARFLANPHYVPELKPLTGRDPAVAQYVAADPAFGP
Y3448_RHORT      PELAIFVSSFGFRNGLPREADLVFDVRFLANPHYEPHLREMTGLDPAVAAYVAADPDFAP
Y2868_RHOCS      PSLHVFVTSFAYRHGVPREADLVFDVRFLDNPHWDPALRPLTGLDRPVAEHVGRDPDFPD
Y2562_RHOS5      TRLAVSVQSFSYKRGVPRGVDMIFDCRFLRNPYWVESLRALDGRDAAVEDYIRSDPRFAP
Y2850_PARDP      RRLTVSVQSFSYKRGVPRGVDMMFDCRFLANPHWRTELRPLDGRDSPVQQYVMADSRFDE
Y209_DINSH       LRLAITVQSFSYKRGVPQGTDMVFDVRFLRNPYWEDTLRRLDGRDARVQDYVSADPRFDS
Y713_RUEPO       SMLAISVESFSYKRGLPRGLDMVFDCRFLANPHWQPDLRAADGRDPAVAAYVHADPQYLP
Y2438_RUEST      RRLAVSLHSFSYKRGIPRNVDMVFDCRFLSNPYWEPALRVHDGRDQEVQDYVMSDARFQG
Y1380_ROSDO      RRLSVSVQSFSYKRGLPRSVDMVFDCRFLTNPYWVPELRSLNGTHDLVKKYVTADARFEQ
Y539_JANSC       PAMSIQIMSFSYRRALPISADLVFDCRFLRNPHWAPELRAKDGRQSDVQAYVAQDARFEA
Y2120_ERYLH      ASQSVTVSSFGFARGMPPLADLVFDMRFLDNPHWVANLREQTGLDPAVGEYITARGDFDE
Y2904_NOVAD      TPTTITISSFGFSRGMPPLADLVFDMRFLANPHWVDDLRPQTGRDKAVGEYIRKDPAFDE
Y2050_SPHAL      GEPVLNILSFGFARGLPRNADLVFDMRYLRNPHWDPALKPGTGLDPDVAAYVIADPAYEE
Y1325_ZYMMO      VAPNVSILSFGFSRGIPRNCDLLFDMRFLQNPYWEEALRPLTGLDPEIADYIEQDPSFLP
Y399_SPHWW       TGTTLTVMSFAFSRGVPRDADLMFDMRFLRNPHWVPELKPHSGLDPDVGAYIAGDPIYPE
Y3333_MAGMM      QGITLFVRSLGFKYGSNTDADMVLDARFLQNPYYDLALRELTGMDAPVRAFLDRDGEAEQ
Y725_COPPD       RGPEFYLISFSYQRGLPTNADMIYDARVFQNPYYVDELRTLTGLDDSVAEYVRADHNYGR
Y723_DEIGD       --FHLRLLSFGFKHAPPRDADLVIDVRSLPNPYYVPELRPRTGLEPAVAGYVFRDEASEQ
Y1434_DEIRA      --FTLRLLSFGFKHAPPRDADLVLDVRSLPNPYYDETLRSKSGRQPDVAAYVFRDAEAEQ
Y319_THET8       --FLLRLVSFGFKWGPPQEADLVLDVRPLPNPHYDPALRPRTGLDPEVRRYVF-SEAAEP
Y911_SYNJA       --LNLRLVSFGFKYGAPPDANLLFDVRFLPNPFFQPHLRHLTGQDPPLQEFLFADPVTQS
Y4163_GLOVI      --LPVTVMSFGFKRGVPADAQFVLDIRFLPNPYYESALKPLTGLDVGVAEYVFASEQSQA
                         ::.:          : * * : ** :        *    :   .        

RAPZ_ECOLI       FIYQTRSYLELWLPMLE-TNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRG-------
RAPZ_PROMH       FIYQTRSYLELWLPMLE-TNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRG-------
Y584_HAEDU       FIYQTRNYLETWLPMLE-KNNRSYLTIAFGCTGGKHRSVFITEQLAKYFQSRG-------
Y087_HAEPS       FISHTCNYLEVWLPLLE-QNNRSYLTIAIGCTGGKHRSVFVAEKLARYIESKG-------
Y1718_MANSM      FIYSTRNYLETWLPMLE-QNNRSYLTIAIGCTGGKHRSVYIAQQLGEYFQAKG-------
Y169_PASMU       FIYLTRNYIETWLPMLE-QNNRSYLTIAIGCTGGKHRSVYITEQLGEYFQAKG-------
Y1595_HISS2      FIYQTRNYIENWLPMLE-KNNRSYLTIAIGCTGGKHRSVYIAQQIGEYFRAKG-------
Y2532_VIBCH      LKQQIQKFFEYWLPMLE-KNNRSYLTIAIGCTGGKHRSVYLTQQLGEYFAQLG-------
Y2760_VIBA3      LKQQIQGFVEQWLPMLE-KNNRSYLTVAIGCTGGKHRSVYLTQKIGEYFEQLG-------
Y2673_VIBPA      LKYQIESFIETWLPLLE-KNNRSYLTVAIGCTGGKHRSVYLTQQIGEYFADKG-------
Y445_VIBVY       LKRQIQTFIEHWLPLLE-KNNRSYLTVAIGCTGGKHRSVYLTQQIGEYFAAMG-------
Y495_ALISL       LKEQIQHFLMTWLPALE-KNNRSYLTVAIGCTGGQHRSVYITQQLGEYFKQQG-------
Y3258_PHOPR      LIYQIRNFIETWLPLLE-KNNRSYLTVAIGCTGGQHRSVYVAQQLADHFLHDG-------
Y571_PSEA6       FIWQIQNLISTWLPHLE-RNNRSYVTIAIGCTGGQHRSVYVVEMLAKTFSTSH-------
Y4546_COLP3      FIWQINSFMMTWLPHLE-RNNRSYVTIAIGCTGGKHRSVYIAEMLAKNFRKER-------
Y2554_PSET1      FTWQIQTFVQTWLPHLE-RNNRSYLTIAIGCTGGQHRSVYLAQTIGESFAMSH-------
Y318_AERS4       FILQIENMLATWLPHLE-RNNRSYVTVGIGCTGGQHRSVFIAEQLAGAFRLLG-------
Y393_IDILO       FIYQLENFLDTWLPHFQ-RSNRSYLTIATGCTGGQHRSVYISQQLAERFEQKA-------
Y3091_SHEAM      YIWQIENLLETWLPHLE-RNNRSYLTIAIGCTGGQHRSVYIAEQLAKRFANSH-------
Y674_SHEPW       FIWQIENLLRTWLPDLE-RNNRSYLTIAIGCTGGQHRSVYVTERLAEHFKDGR-------
Y2894_PSYIN      TINQIENLFHSWLPYLE-ENNRNYVTIAIGCTGGKHRSVYVAEQLAAQFKQK--------
Y127_PSYCK       MTGDIATFLNRWLPDFL-HNNRHTVTVAIGCTGGKHRSVFITKHLQDRLQNSLPEG----
Y2129_PSYWF      MKQDIYRYLDRWLPEFL-HNNRHTVTVAVGCTGGKHRSVFLAESLYSMLSESLPRE----
Y3059_ACIAD      MFDDIFHFLDKWLPVFA-EGHRHYMTVSIGCTGGQHRSVYIV----DRLKKALEAK----
Y549_ALCBS       MLKDIGDFVVRWLPAFA-NSDRSYVTVAIGCTGGRHRSVFITEQLAKNLRAEG-------
Y2229_CHRSD      MADDIRHWLERWLPAYL-ASNRSYLTVAVGCTGGQHRSVYLVEDLAHHFAQQM-------
Y5324_HAHCH      MLQHIISFLETWIPHFQ-NSNRTYMTISIGCTGGQHRSVYICERLGEHFKKKY-------
Y2718_MARHV      MVDDLTGFLNTWLPSFA-DSNRSYMTISIGCTGGQHRSVYVCEQLGRYFRDNY-------
Y5038_PSEA7      MYQDIVGYLNKWLPRFA-ASNRSYVTVAIGCTGGHHRSVYLAERIGAALRESL-------
Y2809_CELJU      MYADIEHYLTRWLPRYQ-ANNRSYITIAIGCTGGQHRSVYLSERLKKHFDQYY-------
Y3181_SACD2      MFDDICAFVQKWAPSFQ-ANNRSYLTVAIGCTGGMHRSVYLAERLAAELKKGY-------
Y739_METCA       YLNHLTAFLERWIPCFL-AENRSYLNVSIGCTGGQHRSVYLVEALAGRLNSDR-------
Y722_THISH       MFDSLRDFLERWIPCFE-AEHRSYMTVSLGCTGGQHRSVYLAERLAAHFRQTRG------
Y2797_NITOC      MQQDLITFLQHWLQRFQ-NTNRSYLTVAIGCTGGQHRSVYLAEQLKAHFHSLH-------
Y2233_ALKEH      LTGQIEALIATWLPAFR-KAARSYVTVAIGCTGGQHRSVYLAEQLAGRFATGM-------
Y2130_HALHL      LFGQIDTLIRYWLPVHQ-QAGRSYLTVAVGCTGGQHRSVYLAERLAESLQEGC-------
Y950_STRM5       YLAQLTDFLDTWLPKLG-DGTRSYVTVAFGCTGGKHRSVFLAERMARHAREMGW------
Y1354_XANCB      YSAQIVDLLDTWLPRLR-NDTRSYVTIAFGCTGGKHRSVYLAERMARHAREQGW------
Y753_XYLFM       YLTQITEFLDTWLARLQ-ADTRSYVTVAFGCTGGKHRSVYLAEQMARHAREKGW------
Y2629_ACIF5      SFVSLRTFLQTWLAPFA-QEHRNYVTVSLGCTGGQHRSVYMVEALARLLAGEG-------
Y3603_ACIAC      MREHITHFLGHWLEPLA-QNHRSYVTVAIGCTGGQHRSVYLVEQLAAEFSDRW-------
Y1053_VEREI      MRAHIEQFLAHWLELLD-RNHRSYVTVAIGCTGGQHRSVYLVERLAQSFGNRW-------
Y831_ACIET       MLAHIGDFLDHWLDALA-HNHRSYVTVAIGCTGGQHRSVYLVEQLAARFEGRW-------
Y1300_POLSJ      MFRDIEKFLDHWLQALV-RDHRSYVTVAIGCTGGQHRSVYLVEKLAESFGRQW-------
Y1653_RHOFT      MLEHIQKFLNQWLGALA-RDHRSYVTVAIGCTGGQHRSVYLVEKLAELFGDQW-------
Y5422_DELAS      MRRDIQQFLESWLDMMA-SNHRSYVTVAIGCTGGQHRSVFLVEELARHFAPRW-------
Y3490_LEPCP      MLAQIEGFLLRWLPSYA-MDQRSYLTVALGCTGGQHRSVYGAEQLAQRFRERV-------
Y3336_METPP      MLGQIEAFLVRWLPAFE-QDQRAYLTVAIGCTGGQHRSVYFVEQLARRFRDRG-------
Y3158_BORA1      MIDDIDGFIRRWLPQYT-LDTRNYLTVAVGCTGGQHRSVYVVEELARRFSEHD-------
Y322_PARP8       MMGDIESFLQKWLPGFR-DDNRSYLTVAIGCTGGQHRSVFIAETLAARFASEG-------
Y403_RALSO       MAEDIRAYVEKWLPSFI-ADNRSYLTVAIGCTGGQHRSVYIAERLATYFRAHG-------
Y3120_JANMA      LLADIRGFVEKWLPAFK-KDNRSYLTVAIGCTGGQHRSVYMVEQLAAHFRAHE-------
Y1915_POLAQ      MECDIIQFIEKWLPHYI-ADGRSYLTVAIGCTGGQHRSVYLVNRISEHFRAQKDLIDLQ-
Y399_AZOSB       MAEDIRRFVADWLPAYM-RDNRSYLTVAIGCTGGQHRSVYMAEWLARRFAD-R-------
Y2061_AROAE      MCEDIRRFVATWLPSYA-RDNRSYLTVAIGCTGGQHRSVYIAEWLGRHFSD-T-------
Y081_NITMU       MFEDIRRFVDDWLPCFI-RDNRNYLTVAIGCTGGRHRSVYFVERLARYFTE-N-------
Y529_THIDA       LLADIRGFVENWLPCFI-RDHRAYLTVAIGCTGGRHRSVYFAETLAAAFQA-R-------
Y1559_NITEC      MLGDIGSFLDTWLPVYM-QDNRAYLTVAIGCTGGQHRSVYFAEKLALHFRD-A-------
Y070_DECAR       MRDDIARFVDTWLPCYI-RDNRNYLTVAIGCTGGQHRSVYIAEWLAGEFAN-R-------
Y3336_CHRVO      MIADIQAMIAKWLPCYG-KENRSYLTVAVGCTGGQHRSVYIIENLARAFS--D-------
Y145_METFK       MYDDIRGFIERWLPNFI-ADNRSYLTVAIGCTGGQHRSVYLAERLAAHFRRQE-------
Y2029_LARHH      MADELSGLALRWIPVFR-HDNRNYLTFAIGCTGGQHRSVYLAETLAARLRETG-------
Y698_NEIM0       MVDDIEKFLTHWLPRLE-DESRSYVTVAIGCTGGQHRSVYVVEKLARRLKGRY-------
Y399_DICNV       FAQETAHYLQHWLSYFTGQNNRAYLNIAIGCTGGQHRSVFIAESVGAILRQDF-------
Y2060_FRASN      FVDQYTALLRLVGEGYV-REGKRYLTLAVGCTGGKHRSVAVAEQLGARLA----------
Y5570_STRGG      FLNQYTELLQLIAAGYR-REGKRYVTIAVGCTGGKHRSVAMSEKLSARLA----------
Y2020_THEFY      MLDSYTEVLRLLVSGYQ-REGKHYMTLAVGCTGGKHRSVAMSEQLAARLR----------
Y1111_ACIC1      FLDTYSKVLGTVVDGYL-REGKRYLTLAVGCTGGKHRSVVIAEELAERLRRLA-------
Y2139_SACEN      FLVNYQQLLRLVGAGYH-REGKRYLTLALGCTGGKHRSVALVEELARRLAD---------
Y1815_MYCUA      FLQTYHELLSLVVEGYR-REGKRYMTVAIGCTGGKHRSVAIAEALVGLLRS---------
Y2783_MYCA9      FLDTYHRLLNLVIDGYR-REGKRYMTIAVGCTGGKHRSVAITEALAASLAP---------
Y3026_RHOE4      YLDTYRHLVDLTIAGYR-REGKRYMTIAVGCTGGKHRSVAMSEALARRLGS---------
Y3593_NOCFA      YLHTCHHLVDLTTSGYR-QEGKRYMTVAVGCTGGKHRSVAIAEALGELIGADT-------
Y3101_SALTO      FVATYADLLNATTAGFE-REGKRYVTAAVGCTGGKHRSVAIAEELAARLR----------
Y2084_PAEAT      FVDRYVRALEPVLDGYR-QENKHYATLAVGCTGGKHRSVAVAMELSKRLAQY--------
Y2275_RENSM      FVTRYVRALGPVLEGYR-RENKHYATIAVGCTGGKHRSVAVSVELAKRLAQL--------
Y1207_KOCRD      FVDRFVSMLEPVFAGYR-TESKHYATIAIGCTGGKHRSVAITEEVARRLSKS--------
Y2934_KINRD      FIDRYESSLSPVFDGYR-RENKRYATVAFGCTGGKHRSVAMAEELGRRLRR---------
Y1991_CLAMS      FVHAYARALAPVLAGYQ-RENKRHATIAIGCTGGKHRSVAVSEELSSLLRAL--------
Y1149_LEIXX      FIESYLEALRPIFAGYQ-RENKRHATIAVGCTGGKHRSVAIAEELAARLRSL--------
Y2527_NOCSJ      FLDAYVPVLEGVASGYL-REGKRFMTIAIGCTGGKHRSVAMTEEISRRLGE---------
Y813_CUTAK       FIDRVEQLLGGMAPGYL-REGKKQVTVAVGCTGGKHRSTAISEELSTRLAA---------
Y1368_BIFA0      FLDAYEKAIEIAIQGYA-QEDKHYVTIAIGCTGGQHRSVAMSEALASRLRS---------
Y1085_BIFLS      FLDAYEKAIEIALEGYA-QEDKHYVTIAVGCTGGQHRSVAMSEELARRLRA---------
Y1710_COREF      FLDNFIAMLDDMLPGYR-HEGKNFITVGIGCTGGHHRSVAVSEELARRLGER--------
Y1313_CORDI      FLDNFTRMLRDMRPGFK-HEGKNFITVSVGCTGGHHRSVAIAEELARRLREV--------
Y1197_CORA7      FIDHFITMFDSMLAGYR-HEGKNFITVGIGCTGGHHRSVAVTEEIARRLRER--------
Y1004_CORJK      FLDHIVGLIHSVLPGYR-KEGKFFVSVAIGCTGGHHRSVAIVEELTRRLADD--------
Y2009_RUBXD      FVERVCGLLSFLIPRYA-AEGKTYFTVGVGCTGGRHRSVAIAEELARRL-----------
Y5766_SORC5      FICRTEQLLSFCMPRYA-SEGKSYLTVGIGCTGGRHRSVVLTNALSDSLRRKTGLPITVV
Y3782_KORVE      FINRISELLVYLLPHYI-SEGKSYLTIAFGCTGGQHRSVMIAEDVKKRLA----------
Y7395_SOLUE      FINRISDLLVYLLPHYI-REGKSYLTISFGCTGGQHRSVMIADEIKRNLS----------
Y619_ACIC5       FLDKVTELLLFLLPHYV-HEGKSYLTVAFGCTGGQHRSVMIAEEIAKRLG----------
Y152_ANADF       FLERISDLLGFLLPRYR-AEGKSYLTIAIGCTGGKHRSVALAGALAERLE----------
Y6564_MYXXD      FLEKVVDLCRFLFPRYQ-KEGKAYLTVALGCTGGKHRSVAIAAELTQRLT----------
Y1884_GEOSL      FLERFMDLLEFLVPSYQ-REGKSYLTVSVGCTGGRHRSVAIVEELRAFFA----------
Y2968_GEOUR      FLNKFKEMLEFLLPGYR-REGKSYLTVSIGCTGGRHRSVVITEEMRDFFR----------
Y872_GEOBB       FLEHFRDMLELLLPSYR-REGKSYLSVSIGCTGGRHRSVAIAEELYNYFR----------
Y2163_GEOLS      FLDHFFNLLQFLIPAYC-REGKSYLTIAIGCTGGRHRSVAITEATAARLE----------
Y977_PELPD       FLDCFFPMLDMLVPAHR-QEGKYYLTISIGCTGGRHRSVAIAEATAMYLR----------
Y1935_PELCD      FLDRFNHLLDYLLPSYR-KEGKSYLTISIGCTGGRHRSVAIAEHLRYAIQ----------
Y1358_DESAL      FLKKFMDLLDFLAPRYQ-KEGKAYLTVAVGCTGGKHRSVSVAGIVYEHLKG---------
Y503_DESOH       FLEKFLNLIDFLLPLYK-NEPKAYLTVAVGCTGGCHRSVAVATAVFNHMKK---------
Y2790_DESAH      FLKKYLGLLDYLIPLYT-LEGKAYLTIAVGCTGGRHRSVAIAENIFEHLS----------
Y1217_SYNAS      FLQKLFDLMEFLIPLYE-KEGKPRITIAVGCTGGKHRSVVMANELWSYFS----------
Y2066_SYNFM      FVEEYGALLLKLIPLYI-REGKRYLTVAAGCTGGKHRSVVIAERIAGTLR----------
Y4092_ALKMQ      FSNKLHDIVSFLIPHYV-QEGKNQLVISIGCTGGRHRSVTIAHVLYHQLKDK--------
Y574_ALKOO       FSNKLNDMISFLIPQYI-EEGKNQLVIAIGCTGGMHRSVTIAHVLYNYLKER--------
Y3400_CLOD6      FYVKLLDMIHFLVPQYI-EEGKQHLVIGVGCTGGRHRSVTITNLIAEDLSNK--------
Y1284_CLONN      FIAKLDDMLKFLIPNYI-KEGKIQLVVAIGCTGGRHRSVTIANAIYDRLKEK--------
Y2495_CLOTE      FIGKLNDILEFLIPHYT-EEGKRQLIVAIGCTGGRHRSVSIANSIYKLLEEK--------
Y511_CLOAB       FVNKIEQLLKFLIPNYL-KEGKRQLIVSIGCTGGRHRSVTIANEIYERLKND--------
Y4857_CLOB8      FIEKLVDMLRYLIPNYI-KEGKSQLIISIGCTGGRHRSVAIANEVYERLNKE--------
Y335_CLOPS       FLSRLSDMAEFLIPNYI-KEGKRQLIISIGCTGGRHRSVAIANALYKDLLCK--------
Y2290_RUMCH      FISKLDGMLDFLIPNYI-KEGKSQLDIGIGCTGGRHRSVAIADEVYRRLEEK--------
Y113_HUNT2       FMTKLKDLVDFLIPNYI-KEGKSQLVIGVGCTGGRHRSVAISEALFSYLCGR--------
Y1834_CALS4      FLKKLGDMIKFLIPYYV-REGKSQLVIAIGCTGGKHRSVAIANALYDLLKKE--------
Y331_LACP7       FLTKLMDMLLFLIPNYI-AEGKNQLVIGIGCTGGRHRSVTLANEITKRLSAT--------
Y1160_CALS8      FLKKLFDLILFLIPNYA-EEGKAQLVIAIGCTGGKHRSVTIAEELFELIKNN--------
Y1084_FINM2      FLDKLVDMVEFLIPKYS-KEGKTNLVIGIGCTGGKHRSVAIAQALTARLEGN--------
Y1588_HALOH      FYKRFFDMMDFLLPEYS-REGKSHFTIAIGCTGGKHRSVTTAIKLKEFLLSK--------
Y262_SYNWW       FTRRFLNLLKYLIPYYI-KEGKTNLAIAIGCTGGQHRSVVLADYTGKQLEKM--------
Y646_HELMI       FMRKYYSLLRFLLPHYT-KEGKSHLVVGIGCTGGKHRSVTLANRLAAALVDE--------
Y258_MOOTA       FIEQFAALLRFLIPHYL-QEGKSHLVVAIGCTGGQHRSVTLANKLGELLQGE--------
Y300_DESAP       FLSHLVNLFDFLIPQYI-REGKTTLTLAIGCTGGKHRSVVLADWLGEQLRER--------
Y2729_PELTS      FMKKFTDLIKFLIPHYI-KEGKTTLMIAIGCTGGMHRSVALAGRLGEILREK--------
Y3054_DESRM      FMEKLIDFVQFLVPHYQ-REGKATLMIAIGCTGGMHRSVTLTNKLGEVLSEK--------
Y4845_DESHY      FVDKYLGLLEFILPYYV-KEGKRHLVIGVGCTGGQHRSVAIAERIGLFLQER--------
Y186_SYMTH       FYRRLTGLIGFLLPHYV-AEGKSLLTIAIGCTGGKHRSVCLANRLAHWIRER--------
Y272_CARHZ       FTEKFLDLIEFLMPFYQ-KEGKSNLVIAIGCTGGRHRSVAIANFLARTLEEK--------
Y2024_NATTJ      FLDKMEDMIQFLLPKYL-KEGRTQLIIAVGCTGGRHRSVVISNWLKDKLLKT--------
Y3015_GEOTN      FLEKLLDLLAFMLPYYQ-REGKSQLVIAIGCTGGQHRSVALAEYIARHFSA---------
Y2526_ANOFW      FIEKVTDLLSFMLPHYK-REGKSQVVIAIGCTGGQHRSVTLAEYIGRYFAD---------
Y3115_BACP2      FTEKLIDLLSFMLPSYK-REGKSQLVIAIGCTGGQHRSVTLANYLSEYFKN---------
Y3698_BACCN      FLEKLTDLITFMLPHYK-REGKSQLVIAIGCTGGQHRSVTLAEYLGKHLKP---------
Y3036_BACSK      FVEKLTDLFDFMLPHYK-REGKSQVVIGIGCTGGQHRSVTLAEYFCAHYEA---------
Y3569_BACHD      FIEKLEDLLSFMLPQYK-REGKSQVVIGIGCTGGKHRSVTLAEHFAKVFAN---------
Y2468_OCEIH      FIDKVTDLLTFMLPQYK-KEGKSQLVVAIGCTGGQHRSVALAEHFSKVLSN---------
Y448_LYSSC       LIQKLTDLFDFMIPLYR-QEGKSQLVIAFGCTGGQHRSVTLAEFFGAYLAS---------
Y126_LISMH       FLDKLVDLLMFTLPFYK-REGKTQLVIAIGCTGGQHRSVALTEFVGKAIQQ---------
Y5262_BREBN      FLEKLTDFLGYTLPHYQ-REGKSQLVIGIGCTGGKHRSVAIAEHLGEAFGK---------
Y2405_EXIS2      FYKKLVDMLEFLIPQYE-REGKSQLVVALGCTGGKHRSITFAEAISKEFKN---------
Y1952_STAS1      FYEKLIDLLKFMVPGYK-KEGKSQLVIAIGCTGGQHRSVALAKRIGAELNES-F------
Y414_STACT       FYDKLLDLLKFMIPGYK-KEGKTQLVIAIGCTGGQHRSVALAKRLAEDLNES-Y------
Y516_MACCJ       FYQKLIDLLKFVIPGYM-REGKSQVVIAIGCTGGQHRSVALSERISNELKDF-F------
Y526_LACSS       FYQQLTALLKSIMPGYL-KEGKTSVTIAIGCTGGQHRSVALAQRLADDLAVD--------
Y779_LACPL       FYQQFLSMLESIMPGYE-AEGKSSLTIAIGCTGGQHRSVALTQRIGEALAKH--------
Y1073_LACCB      FYNKFYDLLSEIMPKYK-AEGKTSVTIAIGCTGGQHRSVAFAERIGKAFSDA--------
Y1171_LACS1      FYQKFVSLLKYVIPGYI-AEGKSNVTIAIGCTGGQHRSVALAERIGNELSKE--------
Y651_LACBA       FYQRFLGLLTTIVPGYK-QEGKSSLTIAIGCTGGQHRSVALTQRLGQALGNT--------
Y450_PEDPA       FYTDYLKLLMDIMPGYQ-KEGKSNLTIAIGCTGGQHRSVAIAERLAKDLSKK--------
Y766_ENTFA       FYTKFIDLLRTVLPGYK-KEGKSSVTIAIGCTGGQHRSVALTERVGAELKEED-------
Y831_STRT1       FYKNLNHLIKPILPGYQ-KEGKSVLTIAVGCTGGQHRSVAFAHRLAQDLKND--------
Y619_STRS2       FYSHLLGLIEPILPGYQ-KEGKSVLTIAVGCTGGQHRSVAFAKRLADDLEKN--------
YJIE_LACLA       FYENLMKMLVPILPAYK-KEGKSVLTIAFGCTGGQHRSVAFAERVSAALKDK--------
Y375_LACRJ       FYQHLRSLLEIALPGYI-KEGKSSLTIAIGCTGGQHRSVTIANKLSADLKEKG-------
Y356_LACF3       FYQHLYSLIEVALPGYI-KEGKSSLTIAIGCTGGQHRSVTIANRLAADLKNNQ-------
Y556_LACDB       FYGKLLDLLLTAIPGYI-DEGKEKLTIAIGCTGGQHRSVSIAQQLARDLSEK--------
Y866_LACJO       FYAKFLDMLETAIPGYI-AEGKEKLTIAIGCTGGQHRSVSIARQLAVDLAKK--------
Y1518_THEAB      YIEMIKNVVDFALKRYE-NEGRMELSIGIGCTGGQHRSVFFAEELASIY-RQR-------
Y1373_THEM4      FLDLIKKVVDFAIQRYE-NEGRTELSVGIGCTGGQHRSVFFAEELFKFY-NEN-------
Y1159_FERNB      YLNKIYELINIAISRYE-TEGRKEITVAIGCTGGKHRSVYFAEELGQMFLNKD-------
Y898_THENN       FVYKIFEVVNVAVKEYQ-RSGRRIVTVGIGCTGGRHRSVYIAHKIAEMLKKEG-------
Y523_PSELT       FIQYTYKLLHIAATRYK-SEGRPFMTVSIGCTGGRHRSVYVAEKLSKILK-DR-------
Y154_PETMO       TVDKIANLAKFIQDKYS-ESGRIEAYFCIGCTGGQHRSVYIAQKVYEILKKEG-------
Y125_ELUMP       FLIKYLNMLKFLIPKYM-KEGKSYLTIAIGCTGGKHRSVFIANALTKALSQSG-------
Y433_ENDTX       FFNIFSKLIETTLPGYI-KESKSHLTIAIGCTGGQHRSVFTAEKLAGFLKSKK-------
Y1089_FUSNN      FYFKLLPLLEFLIPQYI-KEGKKHLTISIGCSGGQHRSVTFVNKLAEDLKNSKV------
Y1129_DICTD      FIEHIKKLLDFLIPLYE-EEGRTVLNIAIGCTGGRHRAVVIADEIFFYL-APK-------
Y235_THEYD       FLTYIKNFLSFAVSGYK-REGRAYVTIAIGCTGGRHRSVVLVEEIADYLRSLS-------
Y1502_DESVV      FRDRFIDFMTYLLPLYE-AEGRYRIAVAIGCTGGRHRSVATAEALLDVLRKS--------
Y424_DESVM       FLAKLLDFLHFLLPQYE-AEGRYRLTIAIGCTGGRHRSVSVAEALLRALKKS--------
Y1774_DESAG      FFKRFLDFLLFLLPQYE-AEGRYRITLAIGCTGGRHRSVSTAEALRDALKKS--------
Y972_DESDA       FCVKLIDLLLFILPLME-TEGRYRVTIAVGCTGGRHRSVAMAEEVTQALRQA--------
Y459_LAWIP       FKKHLIRFLSFLLPLYD-AEGRYRITIALGCTGGKHRSVAISELLLHELTKK--------
Y1189_GLUDA      FLDQIDGMLGLVLPRFV-REGKKYATIAIGCSGGRHRSVTLVEALARRLAAKNLAEPGGT
Y815_GLUOX       FFGHIQSLLELVLPRFV-AEGKKYATIAIGCSGGRHRSVTIVEELARIL-----------
Y395_GRABC       FHDRIDALLRLLLPRFV-QEGKKYATIAIGCTGGRHRSVHLVEKLGEEL-----------
Y446_ACICJ       FFERVSGLTDYLLPRFV-REGKKYVMIAFGCTGGKHRSVSLVEMLGSRL-----------
Y4396_MAGSA      FIESLTRLLEPLLPRFA-AEGKSYLTIAVGCTGGRHRSVAIAEHLAQWM-----------
Y3448_RHORT      LIDRVTALLALLVPRYE-KEGKSYLTIAIGCTGGKHRSVYTAERLAAWL-----------
Y2868_RHOCS      FFRHLTTLLAPLLPRYA-REGKHYLTIAIGCTGGRHRSVFTAHRLAGWL-----------
Y2562_RHOS5      FLEKLRELVLFLLPAQL-EEGKAHLSIGFGCTGGQHRSVAVAEILGKAL-----------
Y2850_PARDP      FFRRVRDLVLFALPAHL-EEGKAHLAIGFGCTGGRHRSVTMAEKMADAL-----------
Y209_DINSH       FFDNIASLVRLLLPAYR-EEGKSHLSIGFGCTGGQHRSVTVAEKLSAAL-----------
Y713_RUEPO       FFTRVTDLLQSLLPAFR-SEGKAHLSVGFGCTGGQHRSVALTEAVAKAL-----------
Y2438_RUEST      FFDRVLDLTLSLLPAYR-EEGKSHFSIAFGCTGGQHRSVTLAETLAKAL-----------
Y1380_ROSDO      FARKVDDLSLLLLPAYR-DEGKSYLSIAFGCTGGQHRSVVMAQCHALRL-----------
Y539_JANSC       FRTQINAMLDLLLPAFK-EEGKSHLTVAFGCTGGRHRSVTLAELTARRL-----------
Y2120_ERYLH      IFQRMRDLILALLPRYR-AQGKAYVHVAFGCTGGRHRSVFTAETMAQAL-----------
Y2904_NOVAD      AFERIRDLLLLLLPRYQ-EQGKAYVHIAFGCTGGRHRSVFMAEQIASAL-----------
Y2050_SPHAL      TVSQIERLILTLLPRYR-AEGKSYVTIAFGCTGGRHRSVHVAARVAQTL-----------
Y1325_ZYMMO      AVTKIKDLLLFLLPRYI-DTGKSYIVIAFACTGGRHRSVYVAEWIAARL-----------
Y399_SPHWW       ARARIEELILLLLPRYE-TEGKSYVTIAIGCTGGKHRSVHFAETLASRL-----------
Y3333_MAGMM      FLTHLQGLFGYLIPRYI-KERKCYFTVDIGCTGGQHRSVYLVDRLGEML-----------
Y725_COPPD       FLDLWVELAERSYNEHI-KMGKPYLVIGVGCTGGQHRSVLVVRDLSDQL-----------
Y723_DEIGD       FYREVRDFVRLAAGRAR-AAGRHGYTVAIGCTGGQHRSVAVAERLAADL-----------
Y1434_DEIRA      FYGELRHFVQTAAERAR-ASGRHSYTVGIGCTGGQHRSVAVAERLLRELQ----------
Y319_THET8       YYRALLAVAGLAAEGAR-AEGRAFYTVAVGCTGGRHRSVAVAERLAEEL-----------
Y911_SYNJA       TYRQIFSLVQAFWPHYR-AERRPHLTVAIGCTGGQHRSVALVERLAEDLRPWAVPTDNP-
Y4163_GLOVI      TYRSLLEFLRFLLHQYR-QDRRSQLLIAIGCTGGQHRSVAFVERLSGDL-----------
                                      :       .*:** **:                      

RAPZ_ECOLI       -----------------------------KNVQSRHRTLEKRKP----------------
RAPZ_PROMH       -----------------------------KNVQSRHRTLEKRK-----------------
Y584_HAEDU       -----------------------------KNVKIRHRSLEKYHKKT--------------
Y087_HAEPS       -----------------------------KKVRVRHCSLEKHYKTS--------------
Y1718_MANSM      -----------------------------KKVKIQHKSLEKHHKKNSA------------
Y169_PASMU       -----------------------------KNVQIQHKSLAKHKKANTQ------------
Y1595_HISS2      -----------------------------KKVQIQHKSLEKHTQNK--------------
Y2532_VIBCH      -----------------------------HQVQLRHTSLEKQQS----------------
Y2760_VIBA3      -----------------------------HQVQIRHASLEKHQQG---------------
Y2673_VIBPA      -----------------------------HQVQIRHTSLEKNAKE---------------
Y445_VIBVY       -----------------------------HTVKIRHTTLEKRNKE---------------
Y495_ALISL       -----------------------------QQVQIRHKTLERH------------------
Y3258_PHOPR      -----------------------------QQVQIRHRTLESK------------------
Y571_PSEA6       -----------------------------PDVQIRHRELNR-------------------
Y4546_COLP3      -----------------------------DDIQTHHRDIDIKST----------------
Y2554_PSET1      -----------------------------PNVKIRHREQEK-------------------
Y318_AERS4       -----------------------------KNVQIRHRTLDKSTPQH--------------
Y393_IDILO       -----------------------------VKVQVRHRELKTHG-----------------
Y3091_SHEAM      -----------------------------HKVEARHREL-NAKA----------------
Y674_SHEPW       -----------------------------HKVTTSHRELKNAKD----------------
Y2894_PSYIN      -----------------------------YQVQIEHKGLKDQL-----------------
Y127_PSYCK       -----------------------------LTVTAKHREKHRW------------------
Y2129_PSYWF      -----------------------------IKVMVKHREKAHWKA----------------
Y3059_ACIAD      -----------------------------WSIQVLHREMKHWS-----------------
Y549_ALCBS       -----------------------------IVLQVRHREL---------------------
Y2229_CHRSD      -----------------------------SGVRLRHRELGVQAALPEDGNAVS-------
Y5324_HAHCH      -----------------------------DNVQVRHKELAQ-------------------
Y2718_MARHV      -----------------------------RNVQVRHTELPHLQARGEI------------
Y5038_PSEA7      -----------------------------KNVQIRHRDLNS-------------------
Y2809_CELJU      -----------------------------QDVQVRHRDIHKHQKHHNHAPANS-------
Y3181_SACD2      -----------------------------ANVQTRHRQLEQKPGA---------------
Y739_METCA       -----------------------------YNLLVRHRELPEPAEESHGTK----------
Y722_THISH       -----------------------------LNVSTRHRELS--------------------
Y2797_NITOC      -----------------------------ARVLCRHRELS--------------------
Y2233_ALKEH      -----------------------------DAISVRHRELNR-------------------
Y2130_HALHL      -----------------------------SHVSLRHRELS--------------------
Y950_STRM5       -----------------------------EDVATYHREQD--------------------
Y1354_XANCB      -----------------------------PEVATFHREQD--------------------
Y753_XYLFM       -----------------------------SEVATFHRELE--------------------
Y2629_ACIF5      -----------------------------QRVLIQHRELGITETLT--------------
Y3603_ACIAC      ------------------------------TTLRRHRELDGR------------------
Y1053_VEREI      ------------------------------TALKRHRELDGRQ-----------------
Y831_ACIET       ------------------------------NTLRRHRELDGI------------------
Y1300_POLSJ      ------------------------------PTLKRHRELDAG------------------
Y1653_RHOFT      ------------------------------MTLKRHRELEASPLTLE-------------
Y5422_DELAS      ------------------------------PTLCRHRSLDSRPTLKPADLLAHDV-----
Y3490_LEPCP      ------------------------------PTLVRHREIEAREAVL--------------
Y3336_METPP      ------------------------------ATLVRHRELDAL------------------
Y3158_BORA1      ------------------------------PLLVRHRTQLPDESA---------------
Y322_PARP8       ------------------------------NVIVRHRDAPIDVDDSSKLVA---------
Y403_RALSO       ------------------------------NVLVRHRELAVDA-----------------
Y3120_JANMA      ------------------------------HVILRHRELD--------------------
Y1915_POLAQ      -----------------------------LNFLDRHRELDSIPVTKL-------------
Y399_AZOSB       -----------------------------VRVIVRHRSAARRVQDAPPAVSGK-------
Y2061_AROAE      -----------------------------LRVLVRHRSAARRIVDHGADMADK-------
Y081_NITMU       -----------------------------NQVLVRHRELNA-------------------
Y529_THIDA       -----------------------------EQVLVRHRELS--------------------
Y1559_NITEC      -----------------------------ARVLVRHRGLAEYNQYYARR-----------
Y070_DECAR       -----------------------------ARVLVRHRTLAGT------------------
Y3336_CHRVO      -----------------------------RQVLVRHRQLYREH-----------------
Y145_METFK       -----------------------------YRVLVRHRSLETN------------------
Y2029_LARHH      -----------------------------ETVLLRHRELDR-------------------
Y698_NEIM0       ------------------------------ELLIRHRQAQNLPSR---------------
Y399_DICNV       -----------------------------PDLHIEHRDIEKN------------------
Y2060_FRASN      --------------------------ADGVGVRVVHRDLGRE------------------
Y5570_STRGG      --------------------------AEGIETVLVHRDMGRE------------------
Y2020_THEFY      --------------------------DEGVEVNIIHRDLGRE------------------
Y1111_ACIC1      ------------------------TAESRIDVQVAHRDLGRE------------------
Y2139_SACEN      --------------------------DEGMMVKTVHRDLGRE------------------
Y1815_MYCUA      --------------------------NSRLSVRVLHRDLGRE------------------
Y2783_MYCA9      --------------------------DDDLSVRVLHRDLGRE------------------
Y3026_RHOE4      --------------------------EDDISVSIVHRDLGRE------------------
Y3593_NOCFA      ------------------------SAESADVVRVVHRDLGRE------------------
Y3101_SALTO      --------------------------QTGLAATAQHRDLGRE------------------
Y2084_PAEAT      ---------------------------PRVTVTTTHRDLGRE------------------
Y2275_RENSM      ---------------------------PRVTVSTKHRDLGRE------------------
Y1207_KOCRD      ---------------------------PRVTVNLQHRDMGRE------------------
Y2934_KINRD      ---------------------------DGVPVRVLHRDLGRE------------------
Y1991_CLAMS      ---------------------------PGVAVSTKHRDLGRE------------------
Y1149_LEIXX      ---------------------------PGLAVSIKHRDLGRE------------------
Y2527_NOCSJ      ---------------------------AGYETRSTHRDLGRE------------------
Y813_CUTAK       ---------------------------RGHRTAVLHRDLGKE------------------
Y1368_BIFA0      ---------------------------HGLSVSVSARELDRKTQ----------------
Y1085_BIFLS      ---------------------------HGLNVTVSAREQHKRHSS---------------
Y1710_COREF      ---------------------------PDLDVSVVHRDINRN------------------
Y1313_CORDI      ---------------------------PDLDVSVNHRDIARN------------------
Y1197_CORA7      ---------------------------GDLDVSTLHRDIARD------------------
Y1004_CORJK      ---------------------------GVL-VNLSHRDLER-------------------
Y2009_RUBXD      --------------------GAGRIGGE-VDLYVRHRDLESG------------------
Y5766_SORC5      HRDVARVSTSGVPS----GVGEGMAGAPGVDLRLAQPGATPSEPRPASDTSVTGGER---
Y3782_KORVE      --------------------------TAGYNVKVVHRDSPK-------------------
Y7395_SOLUE      --------------------------SAGYTAKVNHRDIVKAR-----------------
Y619_ACIC5       --------------------------KKSYRVKAEHRDMPR-------------------
Y152_ANADF       --------------------------GGGQPVRLWHRDVEKE------------------
Y6564_MYXXD      --------------------------DEDTRVQLWDRDIEKE------------------
Y1884_GEOSL      --------------------------GLGLVVKVSHRDKEKG------------------
Y2968_GEOUR      --------------------------TKQLNLNVSHRDMKKGLEK---------------
Y872_GEOBB       --------------------------QRNVNIKITHRDIDKGLG----------------
Y2163_GEOLS      --------------------------TLGLKVRISHRDIEKG------------------
Y977_PELPD       --------------------------ADWPTVRITHRDIEKGQQ----------------
Y1935_PELCD      --------------------------GEDMVVDGLHRDVAKE------------------
Y1358_DESAL      --------------------------LFS-NVSLSHRDIER-------------------
Y503_DESOH       --------------------------REERHVEISHRDLKEAGQTT--------------
Y2790_DESAH      --------------------------QRGFEPGIIHRDIDRDTKEL--------------
Y1217_SYNAS      --------------------------GRDYPVNVNHRDVGKS------------------
Y2066_SYNFM      --------------------------DHNYFVNVFHRDLHLE------------------
Y4092_ALKMQ      ----------------------------GHRVTLSHRDSGETRERKKES-----------
Y574_ALKOO       ----------------------------GYRVLMNHRDSNLSIGRKG-------------
Y3400_CLOD6      ----------------------------GYRVVKKHRDSMLR------------------
Y1284_CLONN      ----------------------------GHKVSKEHRDINEDIKKGGRKL----------
Y2495_CLOTE      ----------------------------GHKVNIDHRDIHEDNNKGGKKL----------
Y511_CLOAB       ----------------------------GETVNIDHRDIEEDINKGGKKL----------
Y4857_CLOB8      ----------------------------NYNSKIEHRDVAEDLHKGEKKL----------
Y335_CLOPS       ----------------------------NFHVTLEHRDINEDINRGDRKL----------
Y2290_RUMCH      ----------------------------MHSVVIEHRDIEKD-GKGVGK-----------
Y113_HUNT2       ----------------------------EHRVFIDHRDIDKD-GRSNRR-----------
Y1834_CALS4      ----------------------------DYSVVVNHRDIGEE------------------
Y331_LACP7       ----------------------------EYGVKAEHRDVEKG------------------
Y1160_CALS8      ----------------------------GYKASIFHRDIEKDIKG---------------
Y1084_FINM2      ----------------------------GEKVYVSHRDQKFW------------------
Y1588_HALOH      ----------------------------GYHVVVEHKDISK-------------------
Y262_SYNWW       ----------------------------GYNVIVRHRDIAKHKTEE--------------
Y646_HELMI       ----------------------------DYAITVKHRDIDKDRGGGESA-----------
Y258_MOOTA       ----------------------------NYSVTVKHRDVVRYLSTGNRR-----------
Y300_DESAP       ----------------------------KHRIVVRHRDLGRDVSGTNY------------
Y2729_PELTS      ----------------------------DFRVTVRHRDINRV------------------
Y3054_DESRM      ----------------------------GYRVNVRHRDIMRV------------------
Y4845_DESHY      ----------------------------SYMMSVKHRDAARNRKGDKSK-----------
Y186_SYMTH       ----------------------------GYSVSVEHRDMPRPADRSDEEEQP--------
Y272_CARHZ       ----------------------------NYEVYLRHRDLEKHREE---------------
Y2024_NATTJ      ----------------------------GYQIALQHRDLDK-------------------
Y3015_GEOTN      ----------------------------DYKTVVSHRDMERRKEAHR-------------
Y2526_ANOFW      ----------------------------EYTTHVSHRDIAKRKDTHR-------------
Y3115_BACP2      ----------------------------DYYTHVTHRDIEKRSRK---------------
Y3698_BACCN      ----------------------------DYSVHVSHRDVEKRKGH---------------
Y3036_BACSK      ----------------------------KYDAYTSHRDINKRKANSR-------------
Y3569_BACHD      ----------------------------EYMMHVSHRDVEKGKER---------------
Y2468_OCEIH      ----------------------------GYTTHVSHRDIDKRKVL---------------
Y448_LYSSC       ----------------------------KENTVITHRDINRRKE----------------
Y126_LISMH       ----------------------------KYETTISHRDMKRRKGR---------------
Y5262_BREBN      ----------------------------DFSVRVSHRDMEKNK-----------------
Y2405_EXIS2      ----------------------------QYHIVTNHRDYVHAKEEK--------------
Y1952_STAS1      ----------------------------DYNVYVHHRDAHVESGVKHKDEKN--------
Y414_STACT       ----------------------------DYNVYVHHRDAHIESGVEN--EKS--------
Y516_MACCJ       ----------------------------DFELHTRHRDALIEGTINE---KA--------
Y526_LACSS       -----------------------------YPVDVTHRDMKKRKESVNRS-----------
Y779_LACPL       -----------------------------YKVHISHRDIEKRKETVNRS-----------
Y1073_LACCB      -----------------------------YAVDITHRDIKKHKETVNRS-----------
Y1171_LACS1      -----------------------------YPVHMSHRDMNKRKETVNRS-----------
Y651_LACBA       -----------------------------YPVHVTHRDIEKRKESANRS-----------
Y450_PEDPA       -----------------------------YVTNISHRDAHKRKETVNRS-----------
Y766_ENTFA       -----------------------------YHVNITHRDRLKRKETVNRS-----------
Y831_STRT1       -----------------------------WTVNETHRDKDRRKETVNRS-----------
Y619_STRS2       -----------------------------WNVNRSHRDKDRRKETVNRS-----------
YJIE_LACLA       -----------------------------WHLNVSHRDKDRRKETVNRS-----------
Y375_LACRJ       -----------------------------YKVNTYHRDIEKAK-----------------
Y356_LACF3       -----------------------------YPVHVHHRDVDKAN-----------------
Y556_LACDB       -----------------------------YPVDITHREISRYLRK---------------
Y866_LACJO       -----------------------------YPVDISHREISRYIGQ---------------
Y1518_THEAB      -----------------------------YEVLLEHRDVK--------------------
Y1373_THEM4      -----------------------------CKVILEHRDVK--------------------
Y1159_FERNB      -----------------------------YKVTIEHRDVELG------------------
Y898_THENN       -----------------------------FSVVEKHRDLEKV------------------
Y523_PSELT       -----------------------------FYVYVEHRDVNK-------------------
Y154_PETMO       -----------------------------REVSIDHRDIER-------------------
Y125_ELUMP       -----------------------------FTVSEYHRDIKK-------------------
Y433_ENDTX       -----------------------------YKVKLNHRDILRHDN----------------
Y1089_FUSNN      --------------------------LEYINVYVSHREKELGHW----------------
Y1129_DICTD      -----------------------------YNTHLLHRDIEKDVHILK-------------
Y235_THEYD       -----------------------------LNPVVIHRDL---------------------
Y1502_DESVV      ----------------------------DYAVTIEHRHLELG------------------
Y424_DESVM       ----------------------------DYAVSIEHRHMELG------------------
Y1774_DESAG      ----------------------------DYAVSLEHRHIDLG------------------
Y972_DESDA       ----------------------------DYPVTLEHRHLELG------------------
Y459_LAWIP       ----------------------------NYTVSIEHRHMELG------------------
Y1189_GLUDA      CDSPGKPAHIEKGAAPTDVQSGGADAQGAWPIIVMHRELAR---------QGRSSWRWAS
Y815_GLUOX       ---------------PKTVPVG--------PMMVLHRELAR---------KGLASWRWAV
Y395_GRABC       ------------------RAQG-------WSVLRTHRELGISDDAPQAGAARVSTDDRNG
Y446_ACICJ       ------------------RNAD-------WNVLIEHRSLG----------SRSVGGAWKA
Y4396_MAGSA      ------------------QRRG-------GKVELRHRELDE---------RGS-------
Y3448_RHORT      ------------------NETG-------RRAHVRHRDLKE---------TPR-------
Y2868_RHOCS      ------------------RDQG-------YKVGEGHRDLDR---------RHPAPEPAPP
Y2562_RHOS5      ------------------AEAG-------WPVSKRHRELER---------RAAAVLPTHQ
Y2850_PARDP      ------------------AKAG-------WQVSIRHRELER---------REKAPAPGDE
Y209_DINSH       ------------------VAEG-------WQVSNRHLELSR---------RSIGAQS---
Y713_RUEPO       ------------------AEAG-------GQVSIRHREMER---------RKPDARPD--
Y2438_RUEST      ------------------AREG-------QQVSIRHRELPG---------QQLK------
Y1380_ROSDO      ------------------AEEG-------WQVSIRHRELDL---------RKNEET----
Y539_JANSC       ------------------AEEG-------WQVSKRHRDVDK---------DASENSDRDR
Y2120_ERYLH      ------------------REAG-------FSPTVVHRNLAS---------RAADQFEG--
Y2904_NOVAD      ------------------REAG-------FSPTLLHRNLSS---------RAADLLEG--
Y2050_SPHAL      ------------------RGSG-------YEPTLTHRNLDS---------APQDGLEGKP
Y1325_ZYMMO      ------------------RQAH-------FSLTITHRDLKL---------PLLESQSN--
Y399_SPHWW       ------------------RQEG-------FSPTVRHRDLTR---------QKSNAEES--
Y3333_MAGMM      ------------------GQMG-------YRVVVRHRDMHRKSAK---------------
Y725_COPPD       ------------------TKNG-------HKVITWHRELGSVN-----------------
Y723_DEIGD       --------------------------TDLGAQVTDHRDMQVGEGG---------------
Y1434_DEIRA      -------------------------ASSIETELMDHRDMREGGEPT--------------
Y319_THET8       --------------------------SGRFAVEVVHRDVEREG-----------------
Y911_SYNJA       -------------------------ALPALNIQVQHRHLLDSQRELEARFGPPPPAAGVE
Y4163_GLOVI      -------------------------AAEGFACRPSHRDLAVNRLQELSR-----------
                                                                             

RAPZ_ECOLI       -------------------
RAPZ_PROMH       -------------------
Y584_HAEDU       -------------------
Y087_HAEPS       -------------------
Y1718_MANSM      -------------------
Y169_PASMU       -------------------
Y1595_HISS2      -------------------
Y2532_VIBCH      -------------------
Y2760_VIBA3      -------------------
Y2673_VIBPA      -------------------
Y445_VIBVY       -------------------
Y495_ALISL       -------------------
Y3258_PHOPR      -------------------
Y571_PSEA6       -------------------
Y4546_COLP3      -------------------
Y2554_PSET1      -------------------
Y318_AERS4       -------------------
Y393_IDILO       -------------------
Y3091_SHEAM      -------------------
Y674_SHEPW       -------------------
Y2894_PSYIN      -------------------
Y127_PSYCK       -------------------
Y2129_PSYWF      -------------------
Y3059_ACIAD      -------------------
Y549_ALCBS       -------------------
Y2229_CHRSD      -------------------
Y5324_HAHCH      -------------------
Y2718_MARHV      -------------------
Y5038_PSEA7      -------------------
Y2809_CELJU      -------------------
Y3181_SACD2      -------------------
Y739_METCA       -------------------
Y722_THISH       -------------------
Y2797_NITOC      -------------------
Y2233_ALKEH      -------------------
Y2130_HALHL      -------------------
Y950_STRM5       -------------------
Y1354_XANCB      -------------------
Y753_XYLFM       -------------------
Y2629_ACIF5      -------------------
Y3603_ACIAC      -------------------
Y1053_VEREI      -------------------
Y831_ACIET       -------------------
Y1300_POLSJ      -------------------
Y1653_RHOFT      -------------------
Y5422_DELAS      -------------------
Y3490_LEPCP      -------------------
Y3336_METPP      -------------------
Y3158_BORA1      -------------------
Y322_PARP8       -------------------
Y403_RALSO       -------------------
Y3120_JANMA      -------------------
Y1915_POLAQ      -------------------
Y399_AZOSB       -------------------
Y2061_AROAE      -------------------
Y081_NITMU       -------------------
Y529_THIDA       -------------------
Y1559_NITEC      -------------------
Y070_DECAR       -------------------
Y3336_CHRVO      -------------------
Y145_METFK       -------------------
Y2029_LARHH      -------------------
Y698_NEIM0       -------------------
Y399_DICNV       -------------------
Y2060_FRASN      -------------------
Y5570_STRGG      -------------------
Y2020_THEFY      -------------------
Y1111_ACIC1      -------------------
Y2139_SACEN      -------------------
Y1815_MYCUA      -------------------
Y2783_MYCA9      -------------------
Y3026_RHOE4      -------------------
Y3593_NOCFA      -------------------
Y3101_SALTO      -------------------
Y2084_PAEAT      -------------------
Y2275_RENSM      -------------------
Y1207_KOCRD      -------------------
Y2934_KINRD      -------------------
Y1991_CLAMS      -------------------
Y1149_LEIXX      -------------------
Y2527_NOCSJ      -------------------
Y813_CUTAK       -------------------
Y1368_BIFA0      -------------------
Y1085_BIFLS      -------------------
Y1710_COREF      -------------------
Y1313_CORDI      -------------------
Y1197_CORA7      -------------------
Y1004_CORJK      -------------------
Y2009_RUBXD      -------------------
Y5766_SORC5      -------------------
Y3782_KORVE      -------------------
Y7395_SOLUE      -------------------
Y619_ACIC5       -------------------
Y152_ANADF       -------------------
Y6564_MYXXD      -------------------
Y1884_GEOSL      -------------------
Y2968_GEOUR      -------------------
Y872_GEOBB       -------------------
Y2163_GEOLS      -------------------
Y977_PELPD       -------------------
Y1935_PELCD      -------------------
Y1358_DESAL      -------------------
Y503_DESOH       -------------------
Y2790_DESAH      -------------------
Y1217_SYNAS      -------------------
Y2066_SYNFM      -------------------
Y4092_ALKMQ      -------------------
Y574_ALKOO       -------------------
Y3400_CLOD6      -------------------
Y1284_CLONN      -------------------
Y2495_CLOTE      -------------------
Y511_CLOAB       -------------------
Y4857_CLOB8      -------------------
Y335_CLOPS       -------------------
Y2290_RUMCH      -------------------
Y113_HUNT2       -------------------
Y1834_CALS4      -------------------
Y331_LACP7       -------------------
Y1160_CALS8      -------------------
Y1084_FINM2      -------------------
Y1588_HALOH      -------------------
Y262_SYNWW       -------------------
Y646_HELMI       -------------------
Y258_MOOTA       -------------------
Y300_DESAP       -------------------
Y2729_PELTS      -------------------
Y3054_DESRM      -------------------
Y4845_DESHY      -------------------
Y186_SYMTH       -------------------
Y272_CARHZ       -------------------
Y2024_NATTJ      -------------------
Y3015_GEOTN      -------------------
Y2526_ANOFW      -------------------
Y3115_BACP2      -------------------
Y3698_BACCN      -------------------
Y3036_BACSK      -------------------
Y3569_BACHD      -------------------
Y2468_OCEIH      -------------------
Y448_LYSSC       -------------------
Y126_LISMH       -------------------
Y5262_BREBN      -------------------
Y2405_EXIS2      -------------------
Y1952_STAS1      -------------------
Y414_STACT       -------------------
Y516_MACCJ       -------------------
Y526_LACSS       -------------------
Y779_LACPL       -------------------
Y1073_LACCB      -------------------
Y1171_LACS1      -------------------
Y651_LACBA       -------------------
Y450_PEDPA       -------------------
Y766_ENTFA       -------------------
Y831_STRT1       -------------------
Y619_STRS2       -------------------
YJIE_LACLA       -------------------
Y375_LACRJ       -------------------
Y356_LACF3       -------------------
Y556_LACDB       -------------------
Y866_LACJO       -------------------
Y1518_THEAB      -------------------
Y1373_THEM4      -------------------
Y1159_FERNB      -------------------
Y898_THENN       -------------------
Y523_PSELT       -------------------
Y154_PETMO       -------------------
Y125_ELUMP       -------------------
Y433_ENDTX       -------------------
Y1089_FUSNN      -------------------
Y1129_DICTD      -------------------
Y235_THEYD       -------------------
Y1502_DESVV      -------------------
Y424_DESVM       -------------------
Y1774_DESAG      -------------------
Y972_DESDA       -------------------
Y459_LAWIP       -------------------
Y1189_GLUDA      RPREHAADVVEGQYSS---
Y815_GLUOX       PPQDPSQDTTV--------
Y395_GRABC       RPEEHGSAQAPDELSRTTS
Y446_ACICJ       MPGAHQGAPMPGVQK----
Y4396_MAGSA      -------------------
Y3448_RHORT      -------------------
Y2868_RHOCS      WREVASRETPEEHR-----
Y2562_RHOS5      GEKA---------------
Y2850_PARDP      GHMRAARTAWAQG------
Y209_DINSH       -------------------
Y713_RUEPO       -------------------
Y2438_RUEST      -------------------
Y1380_ROSDO      -------------------
Y539_JANSC       GASARTAASTDDGEAEQP-
Y2120_ERYLH      -----PQGRN---------
Y2904_NOVAD      -----VKG-----------
Y2050_SPHAL      PSAARASGGAR--------
Y1325_ZYMMO      ----RIRAGKAYQGG----
Y399_SPHWW       ----TVPGVGS--------
Y3333_MAGMM      -------------------
Y725_COPPD       -------------------
Y723_DEIGD       -------------------
Y1434_DEIRA      -------------------
Y319_THET8       -------------------
Y911_SYNJA       QQQVRIPLAGVPAPPHD--
Y4163_GLOVI      -------------------