CLUSTAL format seed alignment for MF_00639

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURD_DEIRA            MVRGAVPRTTEFGELLYGKAVNLGGRVLIYGLGRSGRGVAHFLHGEGVSAFWHDLRPAPE
E8U8B1_DEIML          -----------------------MADYLIYGLGRSGRGVARFLAREGLAAEWVDARPAEE
MURD2_XANAC           ----------------MRISQLEGKAVALWGWGREGRAAYRALRARLPTQALTVFCNAEE
MURD2_XANCP           ----------------MRISQLEGKAVALWGWAREGRAAYRALRQQLPAQPLTVFCNAEE
MURD2_XYLFA           ----------------MRISALEGCRVALWGWGRESRAAYRTFRAAFPKQPLTLFCTIAE
MURD2_SALTO           ----------------MRLSDLRGRKVAVWGTGREGRAAVVAIAAHGPADLVAVDDGGST
D2S4M7_GEOOG          ----------------MRLAELAGRRVGVWGHGREGRAAVRAALTARAAGVVVVD-----
G4R6Q5_PELHB          --------------------MHIEGPVLLYGAGREARSTAAFLRRTYPDLELFVTTDDGV
A0A1K2HW41_9RHIZ      --------------------MRLDQPVLLYGAGREARSTLAFIRARAPELKVYVTVDSGE
B9D3A3_CAMRE          ------------------------MRKSLFGYGGTTRAIAKNFG--GE-DGWDIYDDKFS
A7GWQ6_CAMC5          ------------------------MKKSLFGYGGTTRALAKS-------GGWQIYDDKFS
MURD_CAMJE            ------------------------MKISLFGYGKTTRAIAENLV--DKFGPFDIYDDHFT
Q7M7X1_WOLSU          ------------------------MKLSLFGYGKTNRAIAERF------APCDIYDDSFE
MURD_HELPY            ------------------------MKISLLGHGKTTLALGRFFK--KNHNEVKFFDDKFL
MURD_HELPJ            ------------------------MKISLLGHGKTTLALGRFFK--KNHNEVKFFDDKFP
D3UG08_HELM1          -----------------------MKKIAIFGYGITTKPLVDLLN--SKGKTCAIFDDLNS
H5VFM6_HELBI          -------------------------MISLLGYGQTNKALATYLN--KKNIPYRAYDDKTL
MURD_CHLPN            ----------------------MCQRILILGTGITGKSVARFLY--QQGHYLIGADNSLE
MURD_CHLMU            ---------------------MGLKRVVVIGLGLSGKSIARFLA--RKGVYVLGVDSSIQ
MURD_NOSS1            -----------------------MSKAHVVGLGKSGVAAARLLK--REGWEVVLSDSNTS
MURD_SYNY3            -----------------------MPQACVIGLGRSGIAAARVLH--RDGWQVTVFDQADN
D3ENM3_ATETH          -----------------------MAIAYVIGLGKSGIAAARCLK--QEGWSVVISDSSTS
MURD_THEEB            -----------------------MPTVHVIGLGRSGIAAARLLK--RQGWQVEVSDRRQT
MURD_SYNJA            ------------------------MGHQVLGLGIAGWSAARLLR--AQGKEVWVWDEQDS
MURD_CLOBB            ----------MREDFKKFKDFIYKKRVGVVGIGVSNIPLINFLI--KLGAEVTAFDKKTE
MURD_CLOPE            ----------MKRDFNEFKEFIKGKNVAVVGIGVSNIPLIKFLV--KLGAKVTAFDMKSA
MURD_CLOAB            ----------MKRDFNEFVKFIKNKKTAVVGMGISNRPLIHFLS--KLGAEITAFDRKTK
MURD_CALS4            -------------------MELKEKRVFVAGLGVSGVALCRVLV--NLGANVIAYDRKNE
MURD_STRA3            ---------------MKTITTFENKKVLVLGLARSGEAAARLLA--KLGAIVTVNDGKPF
MURD_STRA5            ---------------MKTITTFENKKVLVLGLARSGEAAARLLA--KLGAIVTVNDGKPF
MURD_STRMU            ---------------MKHVKNFENKKVLVLGLARSGEAAARLLA--KLGAIVTVNDGKPF
MURD_STRPN            ---------------MKVIDQFKNKKVLVLGLAKSGESAARLLD--KLGAIVTVNDGKPF
MURD_STRR6            ---------------MKVIDQFKNKKVLVLGLAKSGESAARLLD--KLGAIVTVNDGKPF
MURD_STRP1            ---------------MKVISNFQNKKILILGLAKSGEAAAKLLT--KLGALVTVNDSKPF
MURD_STRP8            ---------------MKVISNFQNKKILILGLAKSGEAAAKLLT--KLGALVTVNDSKPF
MURD_LACLA            ---------------MKKITKFKDQKILVLGLARSGMAAALVLN--ELGAIVTVNDGKPF
MURD_ENTFA            ---------------MKKITTYQNKKVLVLGLAKSGVSAAKLLH--ELGALVTVNDAKQF
MURD_ENTHR            -----------MTGNEKNFNHSKTKKVLVLGLAKSGFSAAKLLH--ELGALVTVNDGKPF
MURD_LISIN            ---------------MKKIEMYHHKKVLVLGLARSGVSAATIMH--KLGAFVTVNDQKPF
MURD_LISMO            ---------------MKKIEMYHHKKVLVLGLARSGVSAATIMH--KLGAFVTVNDQKPF
MURD_BACHD            ---------------MKHTEQFHQKHILVLGLAKSGEAAARLLH--DLGAIVTVNDQKPL
MURD_OCEIH            ---------------MNVLTNFPYQHVLVLGLAKSGTAAANVLL--QNHIQVTINDGMAT
MURD_BACSU            ---------------MENDQFLQKQHFLILGLAKSGYAAASILH--EKGIYVAVNDQKPF
MURD_STAAM            ---------------MLNYTGLENKNVLVVGLAKSGYEAAKLLS--KLGANVTVNDGKDL
MURD_STAAW            ---------------MLNYTGLENKNVLVVGLAKSGYEAAKLLS--KLGANVTVNDGKDL
MURD_STAES            ---------------MLNYTELENKNVLVVGLAKSGYEAAKLLL--KLGANVKVNDGKDL
MURD_MYCLE            ----------------MLDTLVPGAPVLVAGGGVTGRAVLAALT--RFGMAATLCDD--D
MURD_MYCTU            ------MSGLPRSVPDVLDPLGPGAPVLVAGGRVTGQAVAAVLT--RFGATPTVCDD--D
MURD_COREF            -------MESTTEVELSRLPDSLRGRILVTGAGVSGTGIAGMLH--DLGLDVVVAED--N
MURD_STRCO            -----------------MPSEFSGKHVTVAGLGVSGVPAAKVLH--GLGAQVTVVNDGDD
MURD_BIFLO            -------------------MQVADKTVVIAGLGVSGTSLAEVLR--ERGTHVIGVDE---
MURD_TROW8            --------MSRVEGLTSWYSDWQGLSAAILGIGVSGFAAADSLR--ELGVDVTVYAPEKH
MURD_ECOLI            -----------------MADYQG-KNVVIIGLGLTGLSCVDFF--LARGVTPRVMDTRMT
MURD_ECO57            -----------------MADYQG-KNVVIIGLGLTGLSCVDFF--LARGVTPRVMDTRMT
MURD_ECOL6            -----------------MADYQG-KNVVIIGLGLTGLSCVDFF--LARGVTPRVMDTRMT
MURD_SALTI            -----------------MADYQD-KNVVIIGLGLTGLSCVDFF--LARGVTPRVMDTRVT
MURD_SALTY            -----------------MADYQD-KNVVIIGLGLTGLSCVDFF--LARGVTPRVMDTRVT
MURD_YERPE            -----------------MVDYQG-KKVVIIGLGLTGLSCVDFF--IARGVTPRVMDTRIN
MURD_PASMU            ----------------MQTSYKN-KKVTVIGLGKTGLSCVDFL--LAKQADVRVIDTRTQ
MURD_HAEIN            -----------------MNAYQN-KNITIIGLGKTGLSCVDYL--LSQQANIRVIDTRKN
MURD_VIBCH            -----------------MDRWQGIQHVVVVGLGITGLSVVNYLRKYHPSVTVQVIDTREA
MURD_VIBVU            -----------------MDRWQDIKQVVVVGLGITGLSVVRHLRKTQPQLQVKVIDTRPT
MURD_BUCAI            ----------------MSYNYFG-KKILILGMGLTGISCINFF--LKKGIKPKIIDESKH
MURD_BUCAP            ----------------MSYNYFG-KKILILGLGLTGISCINFF--LKKGIQPRVIDESNK
MURD_WIGBR            -----------------MKSYLG-KKIVIIGLGITGLSCVNFF--YKRGIKTYIMDDSYS
MURD_SHEON            --------------------MQSQYSHIVLGLGATGLSVVRYL--CGKGITPLVMDSRRQ
MURD_SHEVD            --------------------MELDNSHLVLGLGATGLSVVRYL--CRQGITPLVMDSRDQ
MURD_PSEAE            -----------------MSLIASDHFRIVVGLGKSGMSLVRYL--ARRGLPFAVVDTREN
MURD_NEIMA            -------------------MTFQNKKILVAGLGGTGISMIAYLR--KNGAEVAAYDAELK
MURD_NEIMB            -------------------MTFQNKKILVAGLGGTGISMIAYLR--KNGAEVAAYDAELK
MURD_RALSO            -----------------MFGDLASPFVLVLGLGESGLAMARWCA--RHGARARVADTREA
MURD_AGRFC            ---------------MIPVTSFRGKKVALFGLGGSGLVTARALV--AGGAAVVAFDDN--
MURD_RHIME            ---------------MIPVTSFKGRKVALFGLGGSGLATAQALV--SGGADVVAWDDN--
MURD_RHILO            ---------------MIPAASFAGKQVSLFGLGGSGIATARALI--EGGAQVLAWDDN--
MURD_BRUSU            ---------------MIPITALKDKTVALFGLGGSGIATAKAIV--AGGARIIAWDDN--
MURD_BRUME            ---------------MIPITALKDKTVALFGLGGSGIATAKAIV--AGGARIIAWDDN--
MURD_CAUVC            ---------------MIPVRGFEDKTVAVFGLGRTGLTAARALI--AGGAKVALWDEK--
MURD_ANAMM            -------------------------------MGETGISTVCSLV--QSGARVLAWDDDKC
MURD_RICPR            ------------------MNAYKKQKIGIFGLGKTGISVYEEL---KNKYDLIVYDDLEA
MURD_RICTY            ------------------MNAYTKQKIGIFGLGKTGISVYEEL---KNKYDLIVYDDLKA
MURD_CHLTE            ----------------MKPEELKGKVASVIGAGKSGVSAAGLLA--RAGARPFLSEFGAV
E0TG10_PARBH          ----------------------MSGPVLLIGLGVEGKAAARHFL--GQGREIVVVDQRAP
MURD_FUSNN            -----------------------MKKAMIYGLGISGTGAKELLE--KEGYKIIVVDDKKA
MURD_HYDS0            ------------------------MAYLVWGKGRSGLAAFNLLK--AKGFKAYIGDDK--
MURD_THEMA            ------------------------MKIGFLGFGKSNRSLLKYLL-NHQEAKFFVSEAKTL
MURD_LEPIN            ---------------MKFPESLKGLKILVLGGGISGNSALNFLI--SEKAQPILCDQNQP
D0RN10_9PROT          ---------------MQFPRDFFNKKILIFGYGKTGKSAAKLLD--KFKLNYSIYDDNIN
F0SPJ3_RUBBR          --------------MLSTEFLKPGQKITAHGLGRFGGQVAAIRFLAEQGLSVLVSDQADP
MURD_BORBU            ----------------MLLDEIKNLNFLIMGLGLNGGGVALSRFLLKRGAKLVITDLKSE
MURD_TREPA            --------------MEQARALLQGKTVTIMGLGVHGGGCAAACFCAEAGARLTVTDLRNA
                                                                                  

MURD_DEIRA            DEALMR---------QLGHRQADLGGTYD---------LVVAAPGVPIDHRDLRVLAGRG
E8U8B1_DEIML          DLRLTQ---------ELGFGRGDVSRTYR---------TVVAAPGVPIDHPDLVALRARG
MURD2_XANAC           AREIGA--LADAALQVETDASAQALGRFE---------IVVKSPGISPYRAEALAAAAQG
MURD2_XANCP           ARDVAA--LADPALQVQTEASAQALAAFE---------VVIKSPGISPYREEARAAAAQG
MURD2_XYLFA           ATEVQA--LADPVLSIETEVSVPRLAAFD---------VVIKSPGISPYSPLAVAATAAG
MURD2_SALTO           VSPPWDGFLATAAPLVTGDAGAQRLAAAD---------VVVRSPGVPNTHPWLAELWRRQ
D2S4M7_GEOOG          AVPPVD-----LPPGVQAGSDVAELAGCA---------VVFRSPGISPYREDARALAART
G4R6Q5_PELHB          AELEGA-----SFIPP---DKANEVSRFG---------TIVKSPGVSLYKPIFEVARAAG
A0A1K2HW41_9RHIZ      ADLPGT-----ETIAPVDLTDAIAARRFA---------TIVKSPGVSRYRPVFALAREAG
B9D3A3_CAMRE          EISGDEWGNTLLPPNLFVPEKSSLEIP---------------SPGFPPSHELVKNAQN--
A7GWQ6_CAMC5          EIARDEFGNELLPVGKFDASKSELEIP---------------SPGIPPHHELIKKARN--
MURD_CAMJE            ETKKDTLGNLLLNPNDFDDNLSDIEIP---------------SPGFPPKHKLIQKAKN--
Q7M7X1_WOLSU          ESGVDSLGNRLLPPRLFDPESSDVEVT---------------TPGIPPHHPLIQRARH--
MURD_HELPY            SSFKDSEGFLCYPSKDFNPNDSQLEIV---------------SPGISFTHPLVIKAKH--
MURD_HELPJ            AFFKDSEGFLCYPSKDFNPNDSQLEIV---------------SPGISFTHPLVMKAKH--
D3UG08_HELM1          SKHSDEKNNLFYPVSAFDAKEYELCIT---------------SPGIPPTHFLIQNATN--
H5VFM6_HELBI          TPCLDTHHKKLLPSKMFNPYESRLEIV---------------SPGIPFDHPLVVASKH--
MURD_CHLPN            SLISVDHLHDRLLMGASEFPENIDLVIR--------------SPGIKPYHPWVEQAVSLK
MURD_CHLMU            ALQHCPYIHEKLL-ETDEFPTQVDYVVR--------------SPGISKDHPWVKAARAAQ
MURD_NOSS1            DTLL-KQQQELAKEQITVELGYSLD------FAGALPDLIIVSPGVPWDIPDLVKARDLG
MURD_SYNY3            DQLR-HMGQPLVQEGISLKLGDRLDP-----VKEAWPERIVVSPGVPWDIPLLVAAREKG
D3ENM3_ATETH          SELQ-DLQKKLKLEDITVKLLHNPVF-----QPSFLPELIIVSPGVPWDAPFLVQARLHK
MURD_THEEB            PALQ-SQQQLLQAEGIPVQLNYDFDLQTLISVGLRVPDEIVISPGVPWHSPALVAARQAG
MURD_SYNJA            ELLR-QRQAELEREGIPVHLGQPFQL-------LPGVKQVVVSPGIAWDHPLLQEARRQG
MURD_CLOBB            EELG-EVSSDFKNKGVNLELGDNYLDKLT----GFD--VVFKTPSMRIDSECLVKVKKEG
MURD_CLOPE            EELG-EISKEFEILGVNLELGKGYLDRLT----GFE--VVFKTPSMRIDSEALLRCKKQG
MURD_CLOAB            EELGDEVINEFSSENVKFELGENYLSALK----GFD--VVFKTPSMRIDSEALVKAKQEG
MURD_CALS4            IALK-EALEELKDLPVEIKLGEFKEEFLK----GIE--LVVLSPGISLESEIVKKAKDMG
MURD_STRA3            DENP--TAQSLLEEGIKVVCGSHPLELLD----EDF-CYMIKNPGIPYNNPMVKKALEKQ
MURD_STRA5            DENP--TAQSLLEEGIKVVCGSHPLELLD----EDF-CYMIKNPGIPYNNPMVKKALEKQ
MURD_STRMU            DENP--SAQALLEEGIKVICGSHPLELLD----EAF-AYMVKNPGIPYTNPMVVRALEKN
MURD_STRPN            EDNP--AAQSLLEEGIKVITGGHPLELLD----EEF-ALMVKNPGIPYNNPMIEKALAKG
MURD_STRR6            EDNP--AAQSLLEEGIKVITGGHPLELLD----EEF-ALMVKNPGIPYNNPMIEKALAKR
MURD_STRP1            DQNP--AAQALLEEGIKVICGSHPVELLD----ENF-EYMVKNPGIPYDNPMVKRALAKE
MURD_STRP8            DQNP--AAQALLEEGIKVICGSHPVELLD----ENF-EYMVKNPGIPYDNPMVKRALAKE
MURD_LACLA            EENK--EAQLLLEEGIKVITGSHPIDLLD----EDF-ALMVKNPGIRYDNPMVERAEALN
MURD_ENTFA            DQNP--DAQDLLTLGIRVVTGGHPIELLD----EEF-ELIVKNPGIPYTNPLVAEALTRK
MURD_ENTHR            DEKP--EAQELLSLGVKVIAGSHPIELLD----EEF-SLMVKNPGIPYSHPFVQKAQELG
MURD_LISIN            SENP--EAQGLLEQGIKVICGSHPIELLD----EGF-ELVIKNPGIPYNNPMIEKALKLK
MURD_LISMO            SENP--EAQGLLEQGIKVICGSHPIELLD----EGF-ELVIKNPGIPYNNPMIEKALKLK
MURD_BACHD            ADNP--QAQKLQKEGIHVVCGEHPISLLD----GKE--LVVKNPGIRYDNPIVEEAIKRG
MURD_OCEIH            LEDA--TVQKLQTMGAELVLGSHPISVLD----GKD--LIVKNPGIRYDNVIVEEAQRRG
MURD_BACSU            EENE--PAQKLSEKGIEVVCGEHPVSLFD----QHQITILIKNPGIPYENIMVQEAEKRG
MURD_STAAM            SQDA--HAKDLESMGISVVSGSHPLTLLD----NNP--IIVKNPGIPYTVSIIDEAVKRG
MURD_STAAW            SQDA--HVKDLESMGISVVSGSHPLTLLD----NNP--IIVKNPGIPYTVSIIDEAVKRG
MURD_STAES            SQDA--HAKDLESMGIEVISGSHPFSLLD----DDP--IIVKNPGIPYTVSIIKEATNRG
MURD_MYCLE            PAALQQYADNGVATVSAATATQQMFERGR------KYVLVVTSPGFAPTTPVLVAASAAR
MURD_MYCTU            PVMLRPHAERGLPTVSSSDAVQQITG----------YALVVASPGFSPATPLLAAAAAAG
MURD_COREF            ETSRHRLIELLDVDVVGTEHARASLG---------DYSIVVTSPGWRPDSPVLVDAASRG
MURD_STRCO            ERARTQAAELEPLGVTVRLGDGDTLPE--------GTELIVTAPGWKPTKPLFTAAGQAG
MURD_BIFLO            ---RKPEADLHSFDDVDWDHV----------------DYVMSSPVFNPRTPFVLEAQRRG
MURD_TROW8            TRYNKLLDAIGARYVCAYLDELCEVDV----------DFIVVSPGISPDNPVIKRLRDRQ
MURD_ECOLI            PPGLDKLP---EAVERHTGSLNDEWLM--------AADLIVASPGIALAHPSLSAAADAG
MURD_ECO57            PPGLDKLP---EAVERHTGSLNDEWLM--------AADLIVASPGIALAHPSLSAAADAG
MURD_ECOL6            PPGLDKLP---EAVERHTGGLNDEWLM--------AADLIVASPGIALAHPSLSAAADAG
MURD_SALTI            PPGLDKLP---QEVERHVGGLNDEWLL--------AADLIVASPGIALAHPSLSAAASAG
MURD_SALTY            PPGLDKLP---QEVERHVGGLNDEWLL--------AADLIVASPGIALAHPSLSAAASAG
MURD_YERPE            PPGLDQLP---ESVEQHVGDLNQEWLL--------DADLIVVSPGMALAHPALSEAAEAG
MURD_PASMU            PAGAEQLA---KNVPLHTGSLNQQWLL--------ESDLIIISPGLAVKTPEIQTALAAG
MURD_HAEIN            PTGIDKLP---QNIPLHTGSLNQEWLL--------ESDMIVISPGLAVKTPEIQTALKAG
MURD_VIBCH            PPGQEQLS---SDVALHRSGWNLEWLL--------NADLVVTNPGIALATPEIQQVLAAG
MURD_VIBVU            PPGVEQLP---PDIALHVGSWNDAWLA--------EADLVVTNPGIALATPQIQTVLARG
MURD_BUCAI            PSNFIKIP---QNIEYSLGSLDHQWIL--------ESDLIVISPGISSFKPILIKARLLG
MURD_BUCAP            PIFLNKIP---KNIEYKLGNLKENWIL--------ESDLIIISPGISSFKPILMKARSLG
MURD_WIGBR            PEYLKYVP---YDIPCHLGSLNVKWLI--------NAKLIIISPGVSLYHPSLIIAKKLN
MURD_SHEON            PPGAETLASSFPEVKLIAGGFDCRYLV--------QATQIIISPGIAMNTPEVRAALDMG
MURD_SHEVD            PPGAEQLALEFPEVNLITGGFDCRYLV--------QASQIVISPGIAIDTPEIRAAIDMD
MURD_PSEAE            PPELATLRAQYPQVEVRCGELDAEFLC--------SARELYVSPGLSLRTPALVQAAAKG
MURD_NEIMA            PERVSQIGKMFDGLVFYTGRLKDALSN--------GFDILALSPGISERQPDIEAFKRNG
MURD_NEIMB            PERVSQIGKMFDGLVFYTGRLKDALDN--------GFDILALSPGISERQPDIEAFKQNG
MURD_RALSO            PANLPALRAHVPDAEFIGGPFAPSLLE--------GVALVAISPGLSPLDAAVAALLDGA
MURD_AGRFC            PDSVAKAQAEGIATADLHTIDWSSFSS------------FVLAPGVPLTHPKPHWSVDLA
MURD_RHIME            PDSVAKAAAAGIATADLRGADWHAFAA------------FVLSPGVPLTHPKPHWSVDLA
MURD_RHILO            PDSVAKAAATGIATADLRGADWAKFSA------------FVLSPGVPLTHPKPHWTVELA
MURD_BRUSU            PDSVARAQSAGIATGDLRQADWSQFAV------------FVLSPGVPLTHPQPHWSVDLA
MURD_BRUME            PDSVARAQSAGIATGDLRQADWSQFAV------------FVLSPGVPLTHPQPHWSVDLA
MURD_CAUVC            PASREAAAAEGFAVVDLQAADWSQFAA------------LMLSPGVPLSHPKPHWTVEKA
MURD_ANAMM            VLRKNRELCAGCEFVHPYEYRWDEISE------------LVLSPGVPHSRCNESWVVKLA
MURD_RICPR            NRDIFKELFGNNLITVLSDSRWQDLDK------------IVLSPGVPLTHE----VVRIA
MURD_RICTY            KRDIFEKLFGNKLITILSDSRWQDLDK------------IVLSPGVPLTHE----VVRIA
MURD_CHLTE            SPEAAATLRQLGVPFEEGGHSERVFEAAL----------CIVSPGIPQTVPVIREMHARG
E0TG10_PARBH          GTPPPAEIAHSPKAHWVGESEAAKWLEKA--------DLILRSPGVPPTHPLVERGLAAD
MURD_FUSNN            MTSE---------EALNHLEGLEFFIK---------------SPGIP-YNDFVKEVQKRG
MURD_HYDS0            ------------EDKNLWQDVWNEIDT------------VVLSPGIPPFHPLWKEAIKSS
MURD_THEMA            DGETKKFLEEHSVEYEEGGHTEKLLDCDV----------VYVSPGIKPDTSMIELLSSRG
MURD_LEPIN            ERTVVPFFPDNIPPQSLPEVSLVIK-----------------SPGILPTHPILSYAADKK
D0RN10_9PROT          KKEK----------LFDKEFYKNNYDF------------IILSPGINIYNHKKKNFFRRN
F0SPJ3_RUBBR          ATLADSIAAVEPYPQVHFRWGPHRLEDFT------SCDAVLISPGIRPNHPCVQAAVEEG
MURD_BORBU            TELALSIDALRDFEDQIRYVLGKHDVNDF-----KNADIVVKNPGVKPNNKYLKFAKR--
MURD_TREPA            DALTPSLKRLRAYPSIRFTLGEHRLEDFE------NAHVVIKNPIVKGAHNIYLSAAQRA
                                                                 *                

MURD_DEIRA            AE----IIGEVALAARLRPELP--------MVGITGTAGKGSTTVLIAQLLRACGL----
E8U8B1_DEIML          AE----VIGELELAFR-RRAVP--------IIGVTGTAGKGGTSVLIQQLLAHLGV----
MURD2_XANAC           TH----FIGGTALWFAEHAQADGSV---PGVVCITGTKGKSTTTALLAHVLRAAGH----
MURD2_XANCP           AR----FIGGTALWFAEHAQPDGYV---PGAICVTGTKGKSTTTALLAHLLRADGH----
MURD2_XYLFA           AH----FIGGTQLWFAAHADTDGVV---PGAVCVTGTKGKSTTTALLAHLLRAAGH----
MURD2_SALTO           VP----VTQGTALWMADHAAR---------TVGVTGSKGKSTTSSLISHLLAAVDQ----
D2S4M7_GEOOG          T-----LTSGTGVALAEFAARD------VPTLCVTGTKGKSTTSALAAAVLTAASR----
G4R6Q5_PELHB          VP----ITSNLNIWGAHFREGR-------TVVAISGTKGKSTTATLVHLMLEKSGV----
A0A1K2HW41_9RHIZ      IA----VTSNLNLWGETYRAGR-------TVIAITGTKGKSTTATLLHLMLVNLGL----
B9D3A3_CAMRE          ------LISEYDYFYQIY-GDKM-----PFTVWISGTNGKTTTTKMTQHLLARYGS----
A7GWQ6_CAMC5          ------LISEYDYF-----ADKM-----PFSVWISGTNGKTTTTKMTQHLLAKFGS----
MURD_CAMJE            ------LQSEYDFFY-----DIM-----PKSVWISGTNGKTTTTQMATHLLSHIGA----
Q7M7X1_WOLSU          ------LQSEYDFFA-----DSI-----PYSIWISGTNGKTTTTEMIQHLLAPKDS----
MURD_HELPY            ------LVSEYDYINSLFDLVFT-----PTIISISGTNGKTTTTEMLTMLLEDFKA----
MURD_HELPJ            ------LMSEYDYIDSLFDHSFT-----PTMISISGTNGKTTTTEMLTTLLEDFKA----
D3UG08_HELM1          ------LISEYDYFL----DFLQ-----GSGVWISGTNGKTTTTEMTSFLLREYHA----
H5VFM6_HELBI          ------LVSEYDYIYTLWQTNRSNLDF-PTTFFISGTNGKTTTARMLGLLLKSHNA----
MURD_CHLPN            IP----VVTDIQVALKTPEFQR------YPSFGITGSNGKTTTTLFLTHLLNTLGI----
MURD_CHLMU            IS----VVTDIQLAFQTKEFIE------QKSFGITGTVGKTTTILFLEYLLRKAGI----
MURD_NOSS1            IE----TIGEMELAWRHLKS--------LPWVGITGTNGKTTTTALIAAIFQAAGF----
MURD_SYNY3            VE----VTGELELAWQYLHA--------VPWVGITGTNGKTTTTSLVQAIFQKAGL----
D3ENM3_ATETH          VS----IIGELELSWRYLNL--------SPWLIITGTNGKTTTTKLVESIFQKSSL----
MURD_THEEB            IP----VRGEVAIAWQTLAH--------LPWVCITGTNGKTTTTALTAAIFQAAGY----
MURD_SYNJA            IE----VVGEAELAWPFLEH--------LPWVGITGTNGKSTTTALVAEMFKVAGL----
MURD_CLOBB            AY----VTSEMEEFVRYCK---------AKIYGITGSDGKTTTTTIISKMLQEEGY----
MURD_CLOPE            AY----ITSEMEEFVRYCK---------GRVYGVTGSDGKTTTTTIVSKLLSQEGY----
MURD_CLOAB            AY----ITSEMEEFIKYCP---------AKIFGVTGSDGKTTTTTLIYNMLKEEGY----
MURD_CALS4            LE----ILGEVELAYRLSK---------APIYAITGTNGKTTTTSLLGEMFRNAGR----
MURD_STRA3            IP----VLTEVELAYLVSE---------SQLIGITGSNGKTTTTTMIAEVLNAGGQ----
MURD_STRA5            IP----VLTEVELAYLVSE---------SQLIGITGSNGKTTTTTMIAEVLNAGGQ----
MURD_STRMU            IP----VITEVELAYLISE---------APIIGITGSNGKTTTTTMIADVLNHAGQ----
MURD_STRPN            IP----VLTEVELAYLISE---------APIIGITGSNGKTTTTTMIGEVLTAAGQ----
MURD_STRR6            IP----VLTEVELAYLISE---------APIIGITGSNGKTTTTTMIGEVLTAAGQ----
MURD_STRP1            IP----ILTEVELAYFVSE---------APIIGITGSNGKTTTTTMIADVLNAGGQ----
MURD_STRP8            IP----ILTEVELAYFVSE---------APIIGITGSNGKTTTTTMIADVLNAGGQ----
MURD_LACLA            IP----VITEVELAYLISE---------APIIGITGTNGKTTTTTLIADILNADGQ----
MURD_ENTFA            IP----IITEVELAGQIAE---------CPIVGITGTNGKTTTTTMIGLLLNADRTA--G
MURD_ENTHR            IP----VITEVELAYEVAE---------CPIIGITGTNGKTTTTTMTGLLLNAGDLP--G
MURD_LISIN            IP----VITEVELAYQISE---------APIVGITGTNGKTTTTTIIHHMLNAHKE---N
MURD_LISMO            IP----VITEVELAYQISE---------APIVGITGTNGKTTTTTIIHHMLNTHKE---N
MURD_BACHD            IS----VVTEVELASKVSE---------AEIVAITGSNGKTTTTSLVVEMLKGSAR----
MURD_OCEIH            IP----VISEVELVHYLTN---------QPVIGITGSNGKTTTTTLITEMLDRSNV----
MURD_BACSU            IP----VWTEIELAYYLTS---------AKFIGITGSNGKTTTTTLIYEMLKADSQ----
MURD_STAAM            LK----ILTEVELSYLISE---------APIIAVTGTNGKTTVTSLIGDMFKKSRL----
MURD_STAAW            LK----ILTEVELSYLISE---------APIIAVTGTNGKTTVTSLIGDMFKKSRL----
MURD_STAES            LK----ILTEVELSYLISE---------APIIAVTGTNGKTTVTSLIGDMFQKSVL----
MURD_MYCLE            VP----IWGDVELAWRLDAA--GYYGPPRRWLVVTGTNGKTTTTSMLHAMLAADNR----
MURD_MYCTU            VP----IWGDVELAWRLDAA--GCYGPPRSWLVVTGTNGKTTTTSMLHAMLIAGGR----
MURD_COREF            LE----VIGDVELAWRLDRA--GVFGVSRTWLAVTGTNGKTTTTAMLAAMMKQGGF----
MURD_STRCO            VP----VWGDVELAWRLRGL--NGR-KPAPWLAVTGTNGKTTTVQMLASILKAAGL----
MURD_BIFLO            IP----VMSEVEFAWQLRVNN-ERTGTPAPWIGITGTNGKTSTTEMTSEMLTACGL----
MURD_TROW8            IP----ILSEIELAWRVRDK-----VNTCPWILITGTNGKTTTALLTGSMLAKDGA----
MURD_ECOLI            IE----IVGDIELFCR------EAQAP---IVAITGSNGKSTVTTLVGEMAKAAGV----
MURD_ECO57            IE----IVGDIELFCR------EAQAP---IVAITGSNGKSTVTTLVGEMAKAAGV----
MURD_ECOL6            IE----IVGDIELFCR------EAQAP---IVAITGSNGKSTVTTLVGEMAKAAGV----
MURD_SALTI            VE----IVGDIELFCR------EAQAP---IVAITGSNGKSTVTTLVGEMAKAAGV----
MURD_SALTY            VE----IVGDIELFCR------EAQAP---IVAITGSNGKSTVTTLVGEMAKAAGV----
MURD_YERPE            VE----IIGDIELFCR------ENQAP---VVAITGSNGKSTVTTLVGEMAKAAGW----
MURD_PASMU            IE----VIGDIELFCR------EAKKP---IIAITGSNGKSTVTSLVAHMVNAAGL----
MURD_HAEIN            VE----VIGDIELFCR------AATKP---IVGITGSNGKSTVTTLVYEMAKAAGV----
MURD_VIBCH            IP----VVGDIELFAW------HVDTP---VIAITGSNGKSTVTDLSGVLANAAGV----
MURD_VIBVU            VA----VVGDIELFAW------AADKP---VIAITGSNGKSTVTDLTGVMANACGV----
MURD_BUCAI            IE----IISDIELFSR------EVTCP---IISITGTNGKSTVATMIEKIAKKSGY----
MURD_BUCAP            ID----IISDIELFSR------ETKCP---IISITGTNGKSTVATMVKKIAEKSGY----
MURD_WIGBR            IE----IIGDIELFAR------EASRP---IIAITGSNGKSTVTSMIGAIALNSGL----
MURD_SHEON            IE----VIGDVELFAR------EIADRKPCVIGITGSNGKTTVTTLVGEMLREAGI----
MURD_SHEVD            IE----VIGDVELFAR------AIKDRSPCVIGITGSNGKSTVTTLVGEMAKAAGL----
MURD_PSEAE            VR----ISGDIDLFAR------EAKAP---IVAITGSNAKSTVTTLVGEMAVAADK----
MURD_NEIMA            GR----VLGDIELLA------DIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGL----
MURD_NEIMB            GR----VLGDIELLA------DIVNRRDDKVIAITGSNGKTTVTSLVGYLCIKCGL----
MURD_RALSO            RERAVPVWGEIELFARALAGLKLAQGYAPRVLAITGTNGKTTTTALAGALVQRAGK----
MURD_AGRFC            KAAGVEVIGDIELFIRERRVHAPDC----PFIAITGTNGKSTTTALIAHILQSSGR----
MURD_RHIME            HQAGVEIIGDVELFVRERRKHAPDC----PFIAITGTNGKSTTTALIAHILRTSGR----
MURD_RHILO            KGAGVEVIGDIELFCRERILQAPTA----PFIAITGTNGKSTTTALTAHILKSAGR----
MURD_BRUSU            RAAGVEIIGDVELFVRERNHIAPDC----PFIAITGTNGKSTTTALIAHIIKATGR----
MURD_BRUME            RAAGVEIIGDVELFVRERNHIAPDC----PFIAITGTNGKSTTTALIAHIIKATGR----
MURD_CAUVC            RAAGVEVLGDVELFARTVNAAPAHKR--PKIIAITGTNGKSTTTALIGHLCASAGR----
MURD_ANAMM            KRAGCHITSDVEIFCRSRP---------ARLIGVTGTNGKSTTVELIGWILNRAGI----
MURD_RICPR            HHFNIPIISDIDLFFEKSKN--------LKFIAITGTNGKSTTTALISHILNSNGL----
MURD_RICTY            HHFNIPIISDIDLLFEKSKN--------LKFIAITGTNGKSTTAALISHILNSNGL----
MURD_CHLTE            IP----VVSEIELASWFCP---------ARIIGITGTDGKTTTATLLHRICAAEGERKGF
E0TG10_PARBH          RL----ITTPTGYWLASEAP--------EGTVTITGTKGKSTTTALLTDLLTALGE----
MURD_FUSNN            IK----ILDEIEIAYNYMIE----KGLKTKIIAITGTNGKSTTTAKISDMLNHAGY----
MURD_HYDS0            KE----VIGETELAYRFYKG--------KNIIAVTGTDGKSTTVHLIHHFTSFKEG----
MURD_THEMA            VK----LSTELQFFLDNVDP--------KKVVGITGTDGKSTATALMYHVLSGRGF----
MURD_LEPIN            IP----VVSEIDLGRYFFKG---------KIIGITGTDGKSTTTSLIAHLLKESFP----
D0RN10_9PROT          KK---RIITDLDIFFSFQKKY-------KYTIGITGTNGKSGFCNLLKDILDRNNI----
F0SPJ3_RUBBR          IP----VLTEMQLFLERNP---------APVLAVSGTVGKSTVTTMLAHVLKESGR----
MURD_BORBU            ------IETDISLFLMFNKN---------PIVAVTGTKGKSTLVSLLYQALKEKYP----
MURD_TREPA            GA---RIETDISLFLRLSPA---------PLLAVSGSKGKSSTASALCYSLRALGF----
                                                       ::*: .*                    

MURD_DEIRA            RAREGGNIDPPLLDVVDDAEVA---------VVELSSFQLERVPGL-------------R
E8U8B1_DEIML          RAHLGGNFDPPLLDVIDGAEVA---------VCEISSFQLERVQDF-------------R
MURD2_XANAC           RTALVGNIGQPLLEVLAPQPPP------AYWAVELSSYQTGDVGRSG-----------AR
MURD2_XANCP           RTALVGNIGQPLLEVLSPQPPP------AYWAIELSSYQTGEVGRSG-----------AR
MURD2_XYLFA           CTALAGNIGMPLLELLTPQPTP------EYWAIELSSYQTGDVARSG-----------AR
MURD2_SALTO           PNVFGGNIGVPTLDLPAADL----------YVLELSSYQCSDLTDS--------------
D2S4M7_GEOOG          PAVHAGNIGTPLLDVLLDDAVAE----GTPLVVEVSSYQAAAVEGW--------------
G4R6Q5_PELHB          DVVLAGNVGIPPLDAAGSAQTV---------VLELSSYQTADIDFA--------------
A0A1K2HW41_9RHIZ      DAGLAGNVGLAPLEIADRHRIV---------VFELSSYQTADMAFT--------------
B9D3A3_CAMRE          --VMGGNVGVPLADL------DPNAK---IWVLETSSFTLHYTN-------------AAT
A7GWQ6_CAMC5          --VMGGNVGIALGEL------DARAK---IWVLETSSFTLHYTR-------------RAK
MURD_CAMJE            --VMGGNVGTPLAEL------NPYAK---LWILETSSFTLHYTH-------------KAK
Q7M7X1_WOLSU          --ECGGNIGTPLAKL------NPKAP---IWVLETSSFTLHYTQ-------------KAK
MURD_HELPY            --VSGGNIGTPLIELF-----EKRSP---LWVLETSSFSLHYTN-------------KAY
MURD_HELPJ            --VSGGNIGTPLIELF-----EKRSP---LWVLETSSFSLHYTN-------------KAY
D3UG08_HELM1          --RAGGNIGYPLANLA-----LEKRKKPEIWILETSSFMLHYTK-------------FAY
H5VFM6_HELBI          --QVGGNIGVPLIDLYAQIK-TEQRKPPFVWVLETSSFSLHYTK-------------RFA
MURD_CHLPN            PAIAMGNIGLPILDHMG---------QPGVRVVEISSFQLATQEEH-----------IPA
MURD_CHLMU            PAFAMGNVGVPILDGMQ---------NSGVRLVEMSSFQLADQETS-----------YPV
MURD_NOSS1            DAPACGNIGYAACEVALAEI------PPDWIIGEMSSYQIESSV-----TLA--------
MURD_SYNY3            NAPACGNIGYAACELVLQNQ------NYDWIVAEISSYQIESSP-----TLA--------
D3ENM3_ATETH          SAVACGNVGNAASELALSKLKNPSIPNYDWIITEVSSYQCESSQ-----TIR--------
MURD_THEEB            NAPACGNIGNSICEVALTAR------ALDWVIAEISSYQLESSP-----PLQ--------
MURD_SYNJA            EGIPCGNIGLPLSQVALETWQGRR--QPAWIVAELSSYQLEASR-----HLMQSSP-GSP
MURD_CLOBB            KTWVGGNIGTPLFAQIEEIK------SEDRVVLELSSFQLMTM------NLPMD------
MURD_CLOPE            KTWTGGNIGTPLFSNIEEIK------EEDKVVLELSSFQLMTM------DVEID------
MURD_CLOAB            KTWVGGNIGTPLFSKIKEVS------TKDKVVLELSSFQLMTI------DVSPE------
MURD_CALS4            KVYVAGNIGYPLIYAALEAG------PNDHIVAEISSFQLETVK-----EFRPK------
MURD_STRA3            RGLLAGNIGFPASEVVQAAD------DKDILVMELSSFQLMGVK-----EFRPH------
MURD_STRA5            RGLLAGNIGFPASEVVQAAN------DKDTLVMELSSFQLMGVK-----EFRPH------
MURD_STRMU            SARLSGNIGFPASEVAQPVT------EKDILVMELSSFQLMGTE-----SFHPH------
MURD_STRPN            HGLLSGNIGYPASQVAQIAS------DKDTLVMELSSFQLMGVQ-----EFHPE------
MURD_STRR6            HGLLSGNIGYPASQVAQIAS------DKDTLVMELSSFQLMGVQ-----EFHPE------
MURD_STRP1            SALLSGNIGYPASKVVQKAI------AGDTLVMELSSFQLVGVN-----AFRPH------
MURD_STRP8            SALLSGNIGYPASKVVQKAI------AGDTLVMELSSFQLVGVN-----AFRPH------
MURD_LACLA            SAKLSGNIGFPASEVAEKAS------ASDTLVMELSSFQLMGID-----SFRPK------
MURD_ENTFA            EARLAGNIGFPASTVAQEAT------AKDNLVMELSSFQLMGIE-----TFHPQ------
MURD_ENTHR            TARLAGNIGYPASSVAQEAT------ADDKIVMELSSFQLMGIT-----DFRPH------
MURD_LISIN            SSLLAGNIGFPASAVAENAT------SDQYISMELSSFQLMGVQ-----TFKPH------
MURD_LISMO            SSLLAGNIGFPASAVAENAT------SDQYISMELSSFQLMGVE-----TFKPH------
MURD_BACHD            EPKVAGNIGVVASDVAREAT------ADDVIVMEVSSFQLMGTS-----HFRPK------
MURD_OCEIH            SVKVAGNIGVVATEVASSLQ------SDEKMVMELSSFQLQGID-----QLQFS------
MURD_BACSU            KALIAGNIGTVASEVAYHAD------GDEWIVTELSSFQLMGTH-----AFRPE------
MURD_STAAM            TGRLSGNIGYVASKVAQEVK------PTDYLVTELSSFQLLGIE-----KYKPH------
MURD_STAAW            TGRLSGNIGYVASKVAQEVK------PTDYLVTELSSFQLLGIE-----KYKPH------
MURD_STAES            TGRLSGNIGYVASKVAQEVK------SDEYLITELSSFQLLGIE-----EYKPH------
MURD_MYCLE            RSLLCGNIGRPVLDVLTEF---A--EPSDFLAVELSSFQLHWAP-------------SLR
MURD_MYCTU            RAVLCGNIGSAVLDVLDE--------PAELLAVELSSFQLHWAP-------------SLR
MURD_COREF            NAVAVGNIGVPVSAALTS----C--DRVDVMVAELSSFQLHWAP-------------TLV
MURD_STRCO            RTAAVGNIGVSLLDAVTG----E--QEYDVLAVELSSYQLHWAP-------------SLR
MURD_BIFLO            DAPTAGNIASGDMSMSLSRCATN--PQHDVLCVELSSFQLHFTD-------------SLA
MURD_TROW8            RVAVCGNIGTPVLDAVRNP------KGFDYFVVELSSFQLSLLPMHGNG--------AVK
MURD_ECOLI            NVGVGGNIGLPALM-----LLD---DECELYVLELSSFQLETTS-------------SLQ
MURD_ECO57            NVGVGGNIGLPALM-----LLD---DECELYVLELSSFQLETTS-------------SLQ
MURD_ECOL6            NVGVGGNIGLPALM-----LLD---DECELYVLELSSFQLETTS-------------SLQ
MURD_SALTI            NVGVGGNIGLPALM-----LLD---ADRELYVLELSSFQLETTS-------------SLQ
MURD_SALTY            NVGVGGNIGLPALM-----LLD---ADRELYVLELSSFQLETTS-------------SLQ
MURD_YERPE            SVGGGGNIGVPALT-----LLK---QDNQLTVLELSSFQLETTH-------------SLR
MURD_PASMU            KVGMGGNIGIPALS-----LLE---QAHDMYVLELSSFQLETTY-------------SLK
MURD_HAEIN            KVGMGGNIGIPALS-----LLN---EDCELYVLELSSFQLETTY-------------SLK
MURD_VIBCH            KAAVGGNIGVPALD-----LIS---PDVELYVLELSSFQLETTS-------------SLK
MURD_VIBVU            KCAIGGNIGVPALD-----LLE---QEVELYVLELSSFQLETTS-------------SLH
MURD_BUCAI            KAFLGGNIGVPVLE-----ILD---KEADLYIIELSSFQLENTF-------------NLK
MURD_BUCAP            KVLLGGNIGFPVLE-----MLN---KKASLYVLELSSFQLETTF-------------NLK
MURD_WIGBR            SVGIGGNLGTPALD-----LLNE--KSYQLYIIELSSFQLETTF-------------NLK
MURD_SHEON            AVAVGGNIGIPALD-----LLK---ENADIFVLELSSFQLETTH-------------SLN
MURD_SHEVD            NYAVGGNIGIPVLD-----LLQ---KPVDLYILELSSFQLETTH-------------SLN
MURD_PSEAE            RVAVGGNLGTPALD-----LLA---DDIELYVLELSSFQLETCD-------------RLN
MURD_NEIMA            DTVIAGNIGAPVLE--AELQREG--KKADVWVLELSSFQLENTE-------------SLR
MURD_NEIMB            DTVIAGNIGTPVLE--AEWQREG--KKADVWVLELSSFQLENTE-------------SLR
MURD_RALSO            TVGVAGNISPSALDKLTECVDAG--TLPDVWVLELSSFQLETTH-------------TLD
MURD_AGRFC            DTQLGGNIGTAVLSLDPP-------KAQRFYVVECSSYQIDLAP-------------TIN
MURD_RHIME            DTQLGGNIGTAVLTLDPP-------KAGRFYVVECSSYQIDLAP-------------TLD
MURD_RHILO            DTQMGGNIGRAVMTLDPP-------KPDRHFVVECSSYQIDLAP-------------SIN
MURD_BRUSU            DMQLGGNIGTAILTLEPP-------CADRFYVVECSSYQIDLAP-------------SLN
MURD_BRUME            DMQLGGNIGTAILTLELP-------CADRFYVVECSSYQIDLAP-------------SLN
MURD_CAUVC            DTRVGGNIGLGVLGLEDM-------HGGAVYVLELSSYQLDLTS-------------SLK
MURD_ANAMM            DSETGGNIGKGVLSLP---------QGKAAYILELSSYQLELMR-------------GVN
MURD_RICPR            DYPVAGNIGVPALQAKAS-------NEG--YVLELSSFQLDLVK-------------SFT
MURD_RICTY            DYTVAGNIGVPALQAKAS-------KDG--YVLELSSFQLDLVK-------------IFT
MURD_CHLTE            RAFSVGNIGIPFSSEVPGMT------AADIAVLELSSYQLEACF-------------DFR
E0TG10_PARBH          KAGAFGNIGTPVLSETAIAL--------DYPVVEVSSYMLHDVP--------------AG
MURD_FUSNN            KATYAGNIGRSLSEVLLKEK------DLDFISLELSSFQLENIE-------------NFK
MURD_HYDS0            -----GNFGTPFSEIVLDND-------KENVALEASSFQGKTLD-------------TFR
MURD_THEMA            KTFLGGNFGTPAVEALEG--------EYDYYVLEMSSFQLFWSE-------------RPY
MURD_LEPIN            DLKEGGNLGIPFTSFCKESI--------SLAVLELSSYQLEDSS-------------PLH
D0RN10_9PROT          KSKILGNFGIPVLDKRVS--------SDEICIIELSSYQIDYSR-------------NLK
F0SPJ3_RUBBR          SVHVGGNLGLSLLPELDCIQ------PDDVVVLELSSFQLHWLQEM-----------QPR
MURD_BORBU            GVKLGGNIGVSPLSFFDQLD------GKSPLILELSSWQLQSLE-------------NFN
MURD_TREPA            PAFLGGNSTVSPLEFVRHTT------PATPVVLELSSWQLADLRAVDAQDHTVHHAGLLR
                           **                          * **:                      

MURD_DEIRA            LPVAVITNLGVDHLDRH-GSVETYHAAKLNITAGQQSGDVLVRPADLPVPTRAQT-----
E8U8B1_DEIML          PVVGVITNLGVDHLDRH-GSVEAYHAAKLNLARRMTPQDTLVLPAGVNAPSAATT-----
MURD2_XANAC           PQLALVLNLFPEHLDWH-GDEARYVRDKLSLVTEGRPRIALLNAADPLLAGLQLP-----
MURD2_XANCP           PELALVLNLFPEHLDWH-GSEAAYVRDKLALVTDGRPRIALLNAADPHLAQLQLP-----
MURD2_XYLFA           PVLALVLNVFPEHLDWH-GSEQRYINDKLSLVTVTRPRIALLNAADPRLASLALP-----
MURD2_SALTO           PRVAVVTALFPEHLDAH-GGEREYYRDKLNLLAHGPETVVVNGADPRLAAELGDRPV---
D2S4M7_GEOOG          SGWGAVTSLAPEHLDWH-GDVETYYRDKLHVFAGCGPESVVVSAQARSIAEQHLDPA---
G4R6Q5_PELHB          PDIAAISNLYPEHVDWH-GGLDAYYRDKLNLIAKGPK-MVAIGPQAATVERVIST-----
A0A1K2HW41_9RHIZ      PDLAGLTNLSPEHTDWH-RTVERYYADKLNLIDRDTAFPVALGRAARMTPRVLEA-----
B9D3A3_CAMRE          PGIYALLPITPDHLSWH-GDFAEYERAKLKPLAMMGENTVAILPKIYAEAA---------
A7GWQ6_CAMC5          PDIYVLLPITPDHLTWH-GDMKAYEQAKLKPLGMMSENGVAILPEIYAKMP---------
MURD_CAMJE            PEIYALLPISPDHLSWH-GSFDNYVQDKLSVLKRMNECDVVILPKIYANTP---------
Q7M7X1_WOLSU          PNLYLLLPISEDHISWH-GSYEAYIKAKLKPLGALKEKEVAIIPKRFLGTP---------
MURD_HELPY            PLIYLLINIEADHLTWH-CNFENYLNAKLKVLTLMPKTSLAILPLKFKEHPIIQ--N---
MURD_HELPJ            PLIYLLINVEADHLTWH-CNFENYLNAKLKVLTLMPKTSLAILPLKFKEHPIVQ--N---
D3UG08_HELM1          PHIYALLPLHEDHISWH-GGFAHYVDDKLSPLMRMGDGDFALIPKELQHHPLCQ--N---
H5VFM6_HELBI          PHFYILLPLAPDHLSWH-GSYEHYVHAKLKPLELMSPKATALLHASLQDHALIKGLK---
MURD_CHLPN            LSGSVFLNFSRNHLDYH-RNLDAYFDAKLRIQKCLRQDKTFWVWEECSLGNSYQIYS---
MURD_CHLMU            LSGGMILNISDNHLDYH-GSFLEYCQSKQNLSLCMRNPEDLWVGDQRFCGRSYWEEV---
MURD_NOSS1            PHISIWTTFTPDHLARH-KTLENYYDIKAKL---LRQSHLQVFNGDDAYLSKIGASH---
MURD_SYNY3            PQIGLWTTFTPDHLSRH-KTLENYFNIKASL---LSRSAIQVLNGDDPHLHSHGPNL---
D3ENM3_ATETH          PTIGIWTSFTPDHLSRH-KTLHNYYSIKASL---LKNCKYQILNNDDNYLHTISSHS---
MURD_THEEB            PEFALWTTLTPDHLERH-GTLDAYVATKAHL---MNGAKHVILNGDDPYLRQHMVNR---
MURD_SYNJA            PRIGVWTTFTPDHLERH-GTLERYAGFKARL---LQRAQWRVVNGEDPYLFRRRQD----
MURD_CLOBB            --IAVCTNLAPNHLDMH-KDMQEYIDAKKNIFLYQDATNTLIVNRENEITYGFKAEA---
MURD_CLOPE            --VAIVTNITPNHLDMH-KDMQEYIDAKKNVFKYQRENDLLVINDENEITKNLDKEA---
MURD_CLOAB            --VAVVTNLSPNHLDIH-KNMEEYINAKKNIFTHQSKGNVLIINRDNEITNNMESEA---
MURD_CALS4            --ISCIINITPDHLDRH-KTFENYANIKGRIFENQREEEYVVLNYDDPVTWGLKERA---
MURD_STRA3            --IAVITNLMPTHLDYH-GSFEDYVAAKWNIQNQMSSSDFLVLNFNQGISKELAKTT---
MURD_STRA5            --IAVITNLMPTHLDYH-GSFEDYVAAKWNIQNQMSSSDFLVLNFNQGISKELAKTT---
MURD_STRMU            --MAVITNLMPTHIDYH-GSFENYIEAKWNIQKNMTKEDFLVLNFNQDLAKDLANQT---
MURD_STRPN            --IAVITNLMPTHIDYH-GSFSEYVAAKWNIQNKMTAADFLVLNFNQDLAKDLTSKT---
MURD_STRR6            --IAVITNLMPTHIDYH-GSFSEYVAAKWNIQNKMTAADFLVLNFNQDLAKDLTSKT---
MURD_STRP1            --IAVITNLMPTHLDYH-GSFEDYVAAKWMIQAQMTESDYLILNANQEISATLAKTT---
MURD_STRP8            --IAVITNLMPTHLDYH-GSFEDYVAAKWMIQAQMTESDYLILNANQEISATLAKTT---
MURD_LACLA            --IALITNLFSAHLDYH-GSQKAYEAAKWRIQENMTSDDFLILNFNQEKCRNLADKT---
MURD_ENTFA            --IAVITNIFEAHLDYH-GSRKEYVAAKWAIQKNMTAEDTLILNWNQVELQTLAKTT---
MURD_ENTHR            --VAVVTNIYEAHIDYH-KTRKEYVKAKWHLQQNMTEKDYLILNWNQEELRELSKKT---
MURD_LISIN            --ISVITNIYEAHLDYH-TDRSEYVQAKWHIQQNQTADDFLVINWDQEELKNLTKQT---
MURD_LISMO            --ISVITNIYEAHLDYH-TDRSEYVQAKWHIQKNQIADDFLVINWDQEELKNLTKQT---
MURD_BACHD            --VAILLNIFDAHLDYH-GSKENYVAAKKKIVENMKEEDYFVYNADDPLVSKVAAET---
MURD_OCEIH            --TAVLLNLFEAHLDYH-GSFENYVEAKCNIFKSQNKHDYLIYNADDDNVSAAIKTA---
MURD_BACSU            --ISLILNVFDAHLDYH-HTRENYEKAKQKVYLHQTASDKAIVNQDDETVVRLAEAG---
MURD_STAAM            --IAIITNIYSAHLDYH-ENLENYQNAKKQIYKNQTEEDYLICNYHQRQVIE-SEEL---
MURD_STAAW            --IAIITNIYSAHLDYH-ENLENYQNAKKQIYKNQTEEDYLICNYHQRQVIE-SEEL---
MURD_STAES            --IAIITNIYSAHLDYH-ETLENYQNAKKQIYKNQTKDDYLICNYHQRHLIE-SENL---
MURD_MYCLE            PEAGVVLNIAEDHLDWH-STMADYTMAKARVLTGR--VAVVGLDDSRAAALLSTTVAPV-
MURD_MYCTU            PEAGAVLNIAEDHLDWH-ATMAEYTAAKARVLTGG--VAVAGLDDSRAAALLDGSPAQV-
MURD_COREF            PDAGLVLNLAEDHIDWH-GSFRDYALAKTRVLTAP--VAVIGADDSYLVELTTELGLSG-
MURD_STRCO            AHSAAVLNLAPDHLDWH-GSMEAYAADKGRIYEGNHVACVYNVADKATEDLVRAADVEEG
MURD_BIFLO            LDCAAITNIADDHLDWH-GGRENYAADKSKVFHNAKRAIVYNAQDAKVSELAAEAQTAEG
MURD_TROW8            GFSSACVNLDEDHLEWH-GAKELYYRAKSRVYHGTTGFCVYNLDDEETKKMVEQACVARN
MURD_ECOLI            AVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAK-VCVVNADDALTMPIR-G--A---
MURD_ECO57            AVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAK-VCVVNADDALTMPIR-G--A---
MURD_ECOL6            AVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAK-VCVVNADDALTMPIR-G--A---
MURD_SALTI            AAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAK-VCVVNADDALTMPVR-G--A---
MURD_SALTY            AAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAK-VCVVNADDALTMPVR-G--A---
MURD_YERPE            ASAATILNVTEDHTDRYPLGLQQYRAAKLRVYENAK-VCVVNADDALTMPVR-G--A---
MURD_PASMU            ATSATVLNISEDHMNRY-VDLEDYRQAKLKIYHHAQ-TAVINAEDALTAMDG--------
MURD_HAEIN            AAAATVLNVTEDHMDRY-MDLEDYRQAKLRIYHNAK-VGVLNNEDRLTFGENEN--Q---
MURD_VIBCH            LKAAAFLNLSEDHMDRY-QGMEDYRQAKLRIFDHAE-TAVVNADDTQTFPDHAA------
MURD_VIBVU            LVAAAFLNLSEDHMDRY-QGMDDYRQAKLRIFQHAK-HGVVNRDDRQTYPETSHGQQ---
MURD_BUCAI            SKIAVILNISEDHINRYPNGFQQYKNTKLSVYNQAE-ICIINSNDKIEKSLIHS--K---
MURD_BUCAP            SKIAVVLNITEDHLDRYPEGFEQYKKTKLSIYNKAK-ICLIKLK-KGEKKPFNT--K---
MURD_WIGBR            TIASSILNVTHDHMDRYPLGINQYRLIKLKIYKNAK-VKIINLDDYMTWPVHKN--K---
MURD_SHEON            CVASTCLNVTEDHMDRY-SDMDAYRKAKLRLYHQSR-SIIFNRDDALTIP---TEPM---
MURD_SHEVD            CISATCLNISEDHMDRY-SDLEAYRQAKLALYDQSK-RALFNREDSLTQP---NDPM---
MURD_PSEAE            AEVATVLNVSEDHMDRY-DGMADYHLAKHRIFRGAR-QVVVNRADALTRPLI-ADTV---
MURD_NEIMA            PTAATVLNISEDHLDRY-DDLLDYAHTKAKIFRGDG-VQVLNAD--DAFCRAMKRAG---
MURD_NEIMB            PTAATVLNISEDHLDRY-DDLLDYAHTKAKIFRGDG-VQVLNAD--DAFCRAMKRAG---
MURD_RALSO            ADAATILNITQDHLDWH-GSMAAYAAAKGRIFGAGT-VRVLNRQDADVMAFAGKRGGDVT
MURD_AGRFC            PTAGILLNLTPDHLDRH-GTMQHYADVKERLVAGSG---TAIVGVDDSHSTLIADRIERA
MURD_RHIME            PTAGILLNLTPDHLDRH-GTMQHYADIKERLVAGSG---TAVVGVDDSLSSLIADRVERA
MURD_RHILO            PTAGILLNLTPDHLDRH-GTMQHYASIKERLVAGSE---TAIIGIDDSWCAQIAERLERA
MURD_BRUSU            PTAGILLNLTPDHLDRH-GSMENYAAIKERLVAASG---TAIIGIDDAYCQAIADRLHGA
MURD_BRUME            PTAGILLNLTPDHLDRH-GSMENYAAIKERLVAASG---TAIIGIDDAYCQAIADRLHGA
MURD_CAUVC            PDAVVLLNISPDHLDRH-GGMDGYIAAKRRIFLNQGKGDTAIIGVDDAWCQQICTEITAA
MURD_ANAMM            LDVGVILNITPNHLDVY-SNMADYIAAKGRILEFSN------LLVANCGDSNTAHLCENV
MURD_RICPR            VKVAVLLNITPDHLDRY-QDMNDYIAAKAKIFDRMDKDSYAVINIDNDYCRKIFVLLQKD
MURD_RICTY            VKVAVLLNITPDHLDRY-QDMNGYIAAKAKIFDRMDKDSYAVINIDNDYCRKIFLLLQRE
MURD_CHLTE            PNIAVLTNVTPDHMDRYGGSIEAYATAKYRIHARQGAGDTLIYNHDDPILRAHFDRS---
E0TG10_PARBH          PYTHMVTSLFRDHTPWH-GSEAAYRAAKLRPFGLRPPIPGLAPKAVIEEAALPLSVG---
MURD_FUSNN            PCISMIINIGPDHIERY-KSFDEYYNTKFNITKNQTEDLYFIENIDDEEIEKRAKQI---
MURD_HYDS0            PNVGVFLNFSKDHLDWH-PSLEDYLLSKQKIFKNQTQEDILILNAQKPVCDTPSLAK---
MURD_THEMA            LSNFLVLNISEDHLDWH-SSFKEYVDSKLKPAFLQTEGDLFVYNKHIERLRNLEGVR---
MURD_LEPIN            LDVSVFLNLASDHLERH-KTMENYFQAKLKIADLSNSNHTLIVSEKIKERILNSISY---
D0RN10_9PROT          LDKACILNISPDHLERH-NSLSNYKKIKLKIFNFLKENGRGYYHQKSFPKLKNKNKI---
F0SPJ3_RUBBR          FEGVIVTNLFPHHLEWH-GSSGEYETAKQVMLAGQQAQDWAVLPAELQLRPGWQGKA---
MURD_BORBU            PIISIITNVYNDHQNYY-LNFDDYIIDKSKIFVNQTSGIVIIQDQAYCKYFSKFKSK---
MURD_TREPA            PEIAIMTPIMADHQNWY-ADMESYVADKQVLYAHQGTHDTLLCNADDGWGPRFACEAQKN
                              .   *   :      *   *                                

MURD_DEIRA            ---------------VTFTPERLCLRD------------GQEVLPVAD------------
E8U8B1_DEIML          ---------------VRFDGAHLVNLD------------GEAVLSVAD------------
MURD2_XANAC           ----------------DSQVRWFNQPAGWHLRGEVVYRGEQAIFDTAD------------
MURD2_XANCP           ----------------ESEVRWFNHPDGWHLRGDVVYRGQQPIFDTAN------------
MURD2_XYLFA           ----------------QSDLRWFNRRDGWHVRGQVVYRGDRAVLDTAL------------
MURD2_SALTO           ---------------VRAGTPDTTHVAGGPDGTPWFHLGDQPLFPRAV------------
D2S4M7_GEOOG          ---------------VLVDPAELVPEA---------RLAGFPL-----------------
G4R6Q5_PELHB          ---------------IPATTRRIPPLD--------IELADEILMAAMN------------
A0A1K2HW41_9RHIZ      ---------------VRDTSRLIPPLA--------PFLDDRVAAAAAR------------
B9D3A3_CAMRE          -----------------TKAKVISYENEADLARFCGVNLNDIAFKTPF------------
A7GWQ6_CAMC5          -----------------TLAKVISYKDESDLAKFCGVSTSEIKFKTPF------------
MURD_CAMJE            -----------------TKAHKISYEDEKDLAVKFGIDTEKISFKSPF------------
Q7M7X1_WOLSU          -----------------TRGTLIGYEDTAELIDYFGMEREKIGFLEPF------------
MURD_HELPY            -----------------SQAQKIFFDKSEEVLERLKIPSNALFFKGAF------------
MURD_HELPJ            -----------------SQAQKIFFDKSEEVLECLKIPSNALFFKGAF------------
D3UG08_HELM1          -----------------SRARIYFYEDSKSLLQAFGIKNEGSKFKGPF------------
H5VFM6_HELBI          -----------------TPPQLLFYENSADLAQLMGLDLSCVRFEEPF------------
MURD_CHLPN            -----------------EEIEEILDKGDALKPIYLHD-----------------------
MURD_CHLMU            -----------------QKYMRLLDKESALKPLYLHD-----------------------
MURD_NOSS1            ----------------WPDAYWTSVQGKESLLG----EKGFYIEDGWVVEQLPNSPPQRI
MURD_SYNY3            ----------------YPQAHWTSTQGANHLAGLCDPKQGVYLQDNWV-----NAFGELI
D3ENM3_ATETH          ----------------WPNAYWTTIKGKEDLPC--DPIKGVYVQDGWI-----VAFGELM
MURD_THEEB            ----------------WPQAWWISTQGAIALPK--GIAQGIYIAEDQV-----WFQDQPL
MURD_SYNJA            ----------------WENTYWVSLQDPQ---------ADVFLRGSTL-----YIQGEAV
MURD_CLOBB            ----------------KGVVREFSSKRELKEGAYYK--DGILYLSGKE-----------V
MURD_CLOPE            ----------------KGKVVRFSSKKTEGEDAYYK--DGKLYVHGKE-----------V
MURD_CLOAB            ----------------LGDLLKFSRNEKVKNGAYYNKQDGNIYLFENK-----------I
MURD_CALS4            ----------------KAKVFPFSRKKVLENGAYVK--EGFLYLQNKK-----------V
MURD_STRA3            ----------------KATIVPFSTTEKV-DGAYVQ--DKQLFYKGEN-----------I
MURD_STRA5            ----------------KATIVPFSTTEKV-DGAYVQ--DKQLFYKGEN-----------I
MURD_STRMU            ----------------QAKIIPFSTKEKV-DGAYLD--GQMLCFKGQA-----------I
MURD_STRPN            ----------------EATVVPFSTLEKV-DGAYLE--DGQLYFRGEV-----------V
MURD_STRR6            ----------------EATVVPFSTLEKV-DGAYLE--DGQLYFRGEV-----------V
MURD_STRP1            ----------------KATVIPFSTQKVV-DGAYLK--DGILYFKEQA-----------I
MURD_STRP8            ----------------KATVIPFSTQKVV-DGAYLN--DGILYFKEQA-----------I
MURD_LACLA            ----------------KATVLAFSTKEKV-NGAYSK--DGKIYFNDEY-----------I
MURD_ENTFA            ----------------AANVLPFSTKEAV-EGAYLL--DGKLYFNEEY-----------I
MURD_ENTHR            ----------------KATVLPFATEQKLPKGACSL--DGSIYYNQEK-----------I
MURD_LISIN            ----------------KAQVIPFSTTQRLEQGSYVQ--NGNIMFDDEV-----------I
MURD_LISMO            ----------------KAQVIPFSTTQRLGQGSYVQ--NGNIMFNDEV-----------I
MURD_BACHD            ----------------KATPIPFSRSTVVKSGAYVD--GETYMFRGEK-----------I
MURD_OCEIH            ----------------EATKVPFSSSRPLADGAWMD--DDFLYYKDEK-----------I
MURD_BACSU            ----------------KAEIVPFSVSKTLEQGAYVK--DSMIMFNGEA-----------I
MURD_STAAM            ----------------KAKTLYFSTQQEV-DGIYIK--DGFIVYKGVR-----------I
MURD_STAAW            ----------------KAKTLYFSTQQEV-DGIYIK--DGFIIYKGVR-----------I
MURD_STAES            ----------------EAKTFYFSTQQEV-DGIYIK--DGFIVFNGIR-----------I
MURD_MYCLE            -----------------RVGFRFGEPAVGELGVRDGYLVDRA-FAED----------LAL
MURD_MYCTU            -----------------RVGFRLGEPAARELGVRDAHLVDRA-FSDD----------LTL
MURD_COREF            -----------------LIGFTLGEPGPRQLGVLNGHLVDNA-FAAQ----------LPL
MURD_STRCO            C---------------RAIGFTLGTPGPSQLGVVEGLLVDRA-FVEDRQ-----KNAQEL
MURD_BIFLO            C---------------RKVGFTLEAPQAGQIGIEDGWIVDRSGVAGGAV-----GESVRL
MURD_TROW8            V---------------RAIGFGLCVPDVGQVGIVDGILCDRAFLSARK------DSALEI
MURD_ECOLI            ----------------DERCVSFG-VNMGDYHLNHQQGETWLRVKG-----------EKV
MURD_ECO57            ----------------DERCVSFG-VNMGDYHLNHQQGETWLRVKG-----------EKV
MURD_ECOL6            ----------------DERCVSFG-VNMGDYHLNHQQGETWLRVKG-----------EKV
MURD_SALTI            ----------------DERCVSFG-VNMGDYHLNRQQGETWLRVKG-----------EKV
MURD_SALTY            ----------------DERCVSFG-VNMGDYHLNRQQGETWLRVKG-----------EKV
MURD_YERPE            ----------------DSRCISFG-VDVGDYHLNKQQGEIWLRVRG-----------EKV
MURD_PASMU            ----------------LKNGVSFG-EDNADYWLKTEKGRSYLMAKD-----------ERV
MURD_HAEIN            ----------------AKHTVSFA-ENSADYWLKTENGKQYLMVKD-----------EVI
MURD_VIBCH            ----------------HLQVVTFGVEQAAQFSLAQHQGREYLFARD-----------EAV
MURD_VIBVU            ----------------SLALVTFGSDDK-EFGVISHQGESWLSYNQ-----------QPI
MURD_BUCAI            ----------------NKKWISFGTNRS-DYRICSKSNDPILFFKN-----------KKI
MURD_BUCAP            ----------------SKKYISFGTCNNNDYYINYEKEKAILFHKN-----------KKI
MURD_WIGBR            ----------------S-VCIGFSSHKG-KYCIKKHKKNNWMVVNN-----------KFL
MURD_SHEON            ----------------NQNSFGLAPPEGDEWGIC--DSK--IYHGH-----------SEI
MURD_SHEVD            ----------------NQNSFGLTSPVNDEWGVK--DGK--IVHGT-----------TEI
MURD_PSEAE            ----------------PCWSFGLNKPDFKAFGLIEEDGQKWLAFQF-----------DKL
MURD_NEIMA            -----------------REVKWFSLEYEADFWLERETGRLKQGN-------------EDL
MURD_NEIMB            -----------------REVKWFSLEHEADFWLERETGRLKQGN-------------EDL
MURD_RALSO            FGTDEPATPEALGLLRDGGIPWIVLAEADDDDLPKPARRKKGDTTPAAPVP---VRLKRL
MURD_AGRFC            G---------------VKVER-ISKRNVVSEGLYAEGSQILRAHGGTS----------SL
MURD_RHIME            G---------------TKVVR-ISRRHPLAEGIYAEGSALMRAQDGAS----------SL
MURD_RHILO            G---------------QQVIR-ISKRLPLTDGYFADGTNLMEAVHGRY----------SK
MURD_BRUSU            G---------------IRVVR-ISKEKHLDRGYFADGAKLLWAQDGEI----------DE
MURD_BRUME            G---------------IRVVR-ISKEKHLDRGYFADGAKLLWAQDGEI----------DE
MURD_CAUVC            N---------------RRTIWPISAGKAMGRGVYALQGVLYDATGERV----------VE
MURD_ANAMM            G---------------NMVEF--SCGKKLARGVSVLDGRIYFQGR---------------
MURD_RICPR            Q---------------SIKLIPFSVTKILKNGISIVDDKIHDNDL---------------
MURD_RICTY            Q---------------LIKLIPFSVTKILNNGISIVDDKIHDNNL---------------
MURD_CHLTE            ----------------EPWPFRLVRLGLRAETLDVAPGDFVSVEDGEIVVRASGSTERLM
E0TG10_PARBH          ------------------AFEHYAALEGEGLSVRGEALLIPQQINSAFT-----------
MURD_FUSNN            ------------------KAKRISVSKFKKADIFVENDKIYHDKDDII------------
MURD_HYDS0            -------------------KIFFGENGDLKVVGSDVYYKDELLIENIS------------
MURD_THEMA            -----------------SRKIPFWTDENFATEKELIVRGKKYTLPGNY------------
MURD_LEPIN            ------------------QCKLLSFGKTSDSNAFLDENSLKIKTSKFV------------
D0RN10_9PROT          ------------------------------------------------------------
F0SPJ3_RUBBR          -----------------ETGSPVNVVALSEVSVPSDWPL---------------------
MURD_BORBU            -----------------VRVILFSEFNPCDFDQDIFYCNEGKVYFNDSL-----------
MURD_TREPA            G--------------VRVFWYTAQSPETACRACTPRLMERALWRATDGTYWARFAEGDRA
                                                                                  

MURD_DEIRA            -------LPPGVH-------PANAAAALLAAEALLRHLGRA-------------------
E8U8B1_DEIML          -------VPEGHH-------PANVAAALLAAEAFLRSCGRA-------------------
MURD2_XANAC           -------VPLPGE-------HNRRNLCAVLAAVEALGLD---------------------
MURD2_XANCP           -------VPLPGE-------HNRRNLCAVLAAVEALGLD---------------------
MURD2_XYLFA           -------IPLPGA-------HNGSNVCAVLATLEALGLN---------------------
MURD2_SALTO           -------LPLVGR-------HNEGNLCVALAVLDVLGVDVL-------------------
D2S4M7_GEOOG          -------ERLSGV-------HNVANLHVALAACVRMGVDLD-------------------
G4R6Q5_PELHB          -------SRLKGA-------HNHDNARLAAAIALAAGAT---------------------
A0A1K2HW41_9RHIZ      -------SRLKGA-------HNLDNARLAAELALKAGGT---------------------
B9D3A3_CAMRE          ----------------------LTDALLALAIQKILLD----------------------
A7GWQ6_CAMC5          ----------------------LIDALLALSMQKILLD----------------------
MURD_CAMJE            ----------------------LLDAIMALAIEKILLD----------------------
Q7M7X1_WOLSU          ----------------------LMDAVMALAVYKILFD----------------------
MURD_HELPY            ----------------------LLDAALALLVYEQFLKIKN-------------------
MURD_HELPJ            ----------------------LLDAALALLVYEQFLKIKN-------------------
D3UG08_HELM1          ----------------------LLDAVMALCIARLLGK----------------------
H5VFM6_HELBI          ----------------------LLDALLALSGAKLYSG----------------------
MURD_CHLPN            ---------------------RDNYCAAYALANEVGWVSP--------------------
MURD_CHLMU            ---------------------KYNYCCAYLLAQAEFPIAK--------------------
MURD_NOSS1            VEASAL--RMVGA-------HNLQNLLMAVAAARLADISP--------------------
MURD_SYNY3            APINLF--KMPGQ-------HNQQNLLMAIAAARLAGIDK--------------------
D3ENM3_ATETH          FPINLF--KVAGL-------HNQQNLLMAVAAAKIAGIDK--------------------
MURD_THEEB            LPTHIL--QMPGR-------HNQQNFLLAVATAHLAGIPA--------------------
MURD_SYNJA            AELEDFAERCPGS-------HNLQNLLLAAAAAHLAGIPN--------------------
MURD_CLOBB            CKKDNI--VIKGM-------HNVENYLAAF-IATKNDVSI--------------------
MURD_CLOPE            CKKDNI--IIKGM-------HNVENYLAAF-LAVYDEVSI--------------------
MURD_CLOAB            CNKDDI--KIKGM-------DNVKNFMAAF-CAVSKDVSK--------------------
MURD_CALS4            IKVEDI--YIPGE-------HNLENALAASSVAYLSGIEV--------------------
MURD_STRA3            MLVDDI--GVPGS-------HNVENALATIAVAKLAGISN--------------------
MURD_STRA5            MSVDDI--GVPGS-------HNVENALATIAVAKLAGISN--------------------
MURD_STRMU            MSASEL--GVPGS-------HNVENALATIAVAKLSGVSN--------------------
MURD_STRPN            MAANEI--GVPGS-------HNVENALATIAVAKLRDVDN--------------------
MURD_STRR6            MAANEI--GVPGS-------HNVENALATIAVAKLRDVDN--------------------
MURD_STRP1            IAATDL--GVPGS-------HNIENALATIAVAKLSGIAD--------------------
MURD_STRP8            IAATDL--GVPGS-------HNIENALATIAVAKLSGIAD--------------------
MURD_LACLA            MEVSEL--SLPGE-------HNLENALAAIVASKLQGTKN--------------------
MURD_ENTFA            MPADEL--GIPGS-------HNIENALAAICVAKLKNVSN--------------------
MURD_ENTHR            MDITEL--GVPGS-------HNVENALAAISVAKLYGISN--------------------
MURD_LISIN            GSRDSI--LLPGE-------HNLENILASVAVAKTLGVTN--------------------
MURD_LISMO            GERDNI--LLPGE-------HNLENVLASVAVAKTLGVTN--------------------
MURD_BACHD            VEKGDV--VLPGD-------HNVDNVLAAMSAALLMGATK--------------------
MURD_OCEIH            IAIRDI--VLVGK-------HNMENILAAIATAKLNGATN--------------------
MURD_BACSU            LPLEEV--VLPGA-------HNLENILAAIAVVKTAGASN--------------------
MURD_STAAM            INTEDL--VLPGE-------HNLENILAAVLACILAGVPI--------------------
MURD_STAAW            INTEDL--VLPGE-------HNLENILAAVLACILAGVPI--------------------
MURD_STAES            INTKDL--VLPGE-------HNLENILAAVLASIIAGVPV--------------------
MURD_MYCLE            MPVTSIP--VSG-------PVGVLDALAAAALARSVGVGA--------------------
MURD_MYCTU            LPVASIP--VPG-------PVGVLDALAAAALARSVGVPA--------------------
MURD_COREF            APADGIN--PSG-------PAGVLDALAAAAVARSQGVSA--------------------
MURD_STRCO            AEVSDVN--PPA-------PHNIANALAAAGLARAFGVSA--------------------
MURD_BIFLO            AAITDFT--HLAEPDGSLYPHLVADVLTALALVLGLGADR--------------------
MURD_TROW8            TSVEKLE--KNK----LSMRHIISDVLCAVALARSVETNP--------------------
MURD_ECOLI            LNVKEMK--LSG-------QHNYTNALAALALADAAGLPR--------------------
MURD_ECO57            LNVKEMK--LSG-------QHNYTNALAALALADAAGLPR--------------------
MURD_ECOL6            LNVKEMK--LSG-------QHNYTNALAALALADAAGLPR--------------------
MURD_SALTI            LNVKEMK--LSG-------QHNYTNALAALALADAVGLPR--------------------
MURD_SALTY            LNVKEMK--LSG-------QHNYTNALAALALADAVGLPR--------------------
MURD_YERPE            LNTREMK--LSG-------RHNYTNALAALALADAVGIPR--------------------
MURD_PASMU            LACDEMK--LVG-------RHNYMNALAAIALAQAAGIPL--------------------
MURD_HAEIN            LPCEEAT--LVG-------RHNYMNILAATALAQAIGINL--------------------
MURD_VIBCH            MACAELS--LVG-------RHNVANVLTVLALLDSAGVNF--------------------
MURD_VIBVU            LASRELK--LVG-------QHNVANVLVVLALLTCAGIDY--------------------
MURD_BUCAI            LNTSEIL--LYG-------YHNYNNILVSLAISDAMQFPR--------------------
MURD_BUCAP            VDTSNIL--LNG-------HHNYENILTSLAISDQMKFDQ--------------------
MURD_WIGBR            LKCSEMK--ISG-------FHNYLNALVSLIFSDILKIPR--------------------
MURD_SHEON            MPITEVS--LIG-------SHNHANLLAAMALVYAVGVDK--------------------
MURD_SHEVD            ASLQDVA--IVG-------SHNHANLIAAMALAYHAGIDK--------------------
MURD_PSEAE            LPVGELK--IRG-------AHNYSNALAALALGHAVGLPF--------------------
MURD_NEIMA            IATQDIP--LQG-------LHNATNVMAAVALCEAVGLPR--------------------
MURD_NEIMB            IVTQDIP--LQG-------LHNAANVMAAVALCEAIGLSR--------------------
MURD_RALSO            MPADALR--IRG-------LHNATNAMAALALCRAIGLPA--------------------
MURD_AGRFC            LVDLDGIQTLRGS-------HNAQNAAAAIAACLAVGVSE--------------------
MURD_RHIME            FTDLAGIQTLRGG-------HNAQNAAAAIAACLAVGISG--------------------
MURD_RHILO            VAFLEGIGSLRGQ-------HNAQNALAAVAACLKVGLDL--------------------
MURD_BRUSU            IASLEGIGSLRGA-------HNAQNALAAIVACLSAGLSL--------------------
MURD_BRUME            IASLEGIGSLRGA-------HNAQNALAAIVACLSAGLSL--------------------
MURD_CAUVC            VADILRARSLPGR-------HNWQNAAAAYAAARAIGISM--------------------
MURD_ANAMM            -VAEIGGLKIDSA-------SNAENIAASYAVAKSLGVSD--------------------
MURD_RICPR            TYKLPLNKNLQGL-------HNCENIAASYAVAKIIGLES--------------------
MURD_RICTY            TYKLPLNKNLQGL-------HNCENIAASYAVSKIIGVES--------------------
MURD_CHLTE            RVDEIMKPGFRGE-------HNLYNALSSVAAALAAGVAP--------------------
E0TG10_PARBH          -------------------SHPLRLALRAAAAWARRRWPDR-------------------
MURD_FUSNN            ---DVDKLSLKGI-------HNLENTLFMVATAEILKLDR--------------------
MURD_HYDS0            ------HPSLKGL-------HNLYNIAVASFVAFSMGISL--------------------
MURD_THEMA            -------------------PYQMRENILAVSVLYMEMFNE--------------------
MURD_LEPIN            --YDISKFYLPGT-------HNRENLAASILAAEEIGGKP--------------------
D0RN10_9PROT          ---------------------KSFSNLNKIFLRNILGKNV--------------------
F0SPJ3_RUBBR          --------------------HWQENTASVLAAAVRLGVSP--------------------
MURD_BORBU            -------------------IGSFSNSRAVFIIPKVITFFVS-------------------
MURD_TREPA            CMLIPPQLHVPGRVL---QTQVASAALAALLFAQRHSLPPSSCPPCFCAHSHSPAYANHA
                                                                                  

MURD_DEIRA            -----------VD----PAVLADALRAAQPVKGRFETVGQLGE----VGFIEDSIATRTI
E8U8B1_DEIML          -----------VP----VPAWAEAVRAAKPVPGRFETVARAGG----VAFVEDSIATRTI
MURD2_XANAC           -----------------AAALAPAAASFRPLPNRLQLLGSVDG----ISYVNDSISTTPH
MURD2_XANCP           -----------------AAALAPAALTFRPLPNRLQWLGSVDG----IAYVNDSISTTPH
MURD2_XYLFA           -----------------AVALAPAACNFHPLPNRLQFLGERDG----ILWVNDSISTTPH
MURD2_SALTO           -----------AR----RDTLAVAVAGFQGLAHRLTEIVDPSG----LTFVDDTLATSPY
D2S4M7_GEOOG          -----------RS----AEAVRRAVAGFRALPHRLSPVATRDG----VTFVDDALSTTPV
G4R6Q5_PELHB          -----------------REGIFAGIEAFIPLPHRLEEV-MVGD----ILFVDDSISTTPE
A0A1K2HW41_9RHIZ      -----------------IEGVLAGIAAFTPLPHRLEEH-EVGG----LAFVDDSISTTPE
B9D3A3_CAMRE          ------------------RCDARLLNGFVIEGNKLEEFRDARG----RIWVNDTKATNID
A7GWQ6_CAMC5          ------------------RCDVSALNEFVIEANKLEEFTDHYG----RVWVNDTKATNID
MURD_CAMJE            ------------------TLSYKLLNSFVMEKNKLEELKDSQN----RLWVNDTKATNES
Q7M7X1_WOLSU          ------------------EIPYERLNEFKIGAHKIEEFTDGLG----RLWVDDSKATNVD
MURD_HELPY            -----------LKWQDYRENALKRLNAFKIGSHKMEEFRDKQG----RLWVDDSKATNID
MURD_HELPJ            -----------LKWQDYRENALKRLNAFKIGSHKMEEFRDKQG----RLWVDDSKATNID
D3UG08_HELM1          ------------------EKDMSDLWGYEIGPHRMQEFWDREG----NLWVDDSKGTNVD
H5VFM6_HELBI          ------------------VANYELINSYAIQPHRIEVFTDHQG----HTWVNDSKATNVD
MURD_CHLPN            ------------------EGFLKAIRTFEKPAHRLEYLGKKDG----VHYINDSKATTVT
MURD_CHLMU            ------------------SLFIEAVATFKKPSHRMEYLGEKCG----VHYINDSKATTVR
MURD_NOSS1            ------------------NAIDKAVREFPGVAHRLEHICTWE----GIDFINDSKATNYD
MURD_SYNY3            ------------------KAITETLLTFTGVPHRLEPICTIN----GVQFINDSKATNYD
D3ENM3_ATETH          ------------------KDISLAVENFDGVPHRLEYVVSID----DIQFINDSKATNYD
MURD_THEEB            ------------------ETIAKGVAGFAGVPHRLERIRQWR----EVEWINDSKATNYD
MURD_SYNJA            ------------------TAIQGAIRSFAGMPHRLERVAQIQVGSTPIRFVNDSKATNYE
MURD_CLOBB            ------------------ENMKKVAESFNGVEHRCELVREIN----GVKYYNDSIASSPT
MURD_CLOPE            ------------------ESMKKVAETFGGVHHRCEFIREVD----GVKYYNDSIASTPT
MURD_CLOAB            ------------------ESMIKVAMNFAGVEHRREFVRELD----GVKYYNDSIASSPT
MURD_CALS4            ------------------DAIETTLRTFKGVEHRIEFVAEIE----GIKFYNDSKGTNPD
MURD_STRA3            ------------------QVIRETLSNFGGVKHRLQSLGKVH----GISFYNDSKSTNIL
MURD_STRA5            ------------------QVIRETLSNFGGVKHRLQSLGKVH----GISFYNDSKSTNIL
MURD_STRMU            ------------------EAIRETLIHFGGVKHRLQSLGNIA----GVKFYNDSKSTNIL
MURD_STRPN            ------------------QTIKETLSAFGGVKHRLQFVDDIK----GVKFYNDSKSTNIL
MURD_STRR6            ------------------QTIKETLSAFGGVKHRLQFVDDIK----GVKFYNDSKSTNIL
MURD_STRP1            ------------------DIIAQCLSHFGGVKHRLQRVGQIK----DITFYNDSKSTNIL
MURD_STRP8            ------------------DIIAQCLSHFGGVKHRLQRVGQIK----DITFYNDSKSTNIL
MURD_LACLA            ------------------EAIVEVLTSFAGVKHRLQYLGEID----GRKVYNDSKATNIL
MURD_ENTFA            ------------------AQIRQTLTNFSGVPHRTQFVGEVQ----QRRFYNDSKATNIL
MURD_ENTHR            ------------------EAIKNALHHFHGVPHRTQYVGEFQ----GRKFYNDSKATNIL
MURD_LISIN            ------------------EEIMYVLETFKGVEHRTQFVVEWQ----GRKFYNDSKATNIL
MURD_LISMO            ------------------EEIMHVLETFKGVEHRTQFVVEWQ----GRKFYNDSKATNIL
MURD_BACHD            ------------------EQIHHVLSTFSGVEHRLQFVGTAF----ERKWYNDSKATNIL
MURD_OCEIH            ------------------EGIVQVLTTFSGVKHRLEFVGVIN----GRYIYNDSKATNIL
MURD_BACSU            ------------------EAVKKVLTSFTGVKHRLQYVTTVN----GRKFYNDSKATNIL
MURD_STAAM            ------------------KAIIDSLTTFSGIEHRLQYVGTNR----TNKYYNDSKATNTL
MURD_STAAW            ------------------KAIIDSLTTFSGIEHRLQYVGTNR----TNKYYNDSKATNTL
MURD_STAES            ------------------KAIVDSLVTFSGIDHRLQYIGTNR----TNKYYNDSKATNTL
MURD_MYCLE            ------------------TAIADAVALFRLGRHRAEVVAVADG----IRYVDDSKATNPH
MURD_MYCTU            ------------------GAIADAVTSFRVGRHRAEVVAVADG----ITYVDDSKATNPH
MURD_COREF            ------------------EDIAGALATFEVSGHRGQVVAEDHG----VQFIDNSKATNPH
MURD_STRCO            ------------------AAVRDGLRAFTPDAHRIAHVADVDG----VAYVDDSKATNTH
MURD_BIFLO            ------------------DTALKALTSFKPGGHRIETVAEAAVEGGSVRFVDDSKATNGH
MURD_TROW8            ------------------LSISRALDEFCLSPHRTEVVAKEMG----VMWVNDSKATNPH
MURD_ECOLI            ------------------ASSLKALTTFTGLPHRFEVVLEHNG----VRWINDSKATNVG
MURD_ECO57            ------------------ASSLKALTTFTGLPHRFEVVLEHNG----VRWINDSKATNVG
MURD_ECOL6            ------------------ASSLKALTTFTGLPHRFEVVLEHNG----VRWVNDSKATNVG
MURD_SALTI            ------------------ASSLKALTTFTGLAHRFQLALEHNG----VRWINDSKATNVG
MURD_SALTY            ------------------ASSLKALTTFTGLAHRFQLALEHNG----VRWINDSKATNVG
MURD_YERPE            ------------------ASSLKALTTFSGLPHRFQLVLERHG----VRWINDSKATNVG
MURD_PASMU            ------------------ESIRRALREFNGLDHRFQLAHFAHG----VRWVNDSKATNVG
MURD_HAEIN            ------------------DSIRTALRHFKGLDHRFQLVHQANG----IRWINDSKATNVG
MURD_VIBCH            ------------------RLALDALKSYTGLTHRCQVVADNHG----IKWVNDSKATNVA
MURD_VIBVU            ------------------RKGLSALKSYTGLTHRCQVVADNRG----IKWVNDSKATNLA
MURD_BUCAI            ------------------NDAINVLKSFSNLPHRFQIIKNEKG----VRWINDSKSTNVN
MURD_BUCAP            ------------------KVSINVLKKFLGLPHRFQTVHINNN----ISWINDSKSTNVD
MURD_WIGBR            ------------------EISLNTLKNFSGLPHRFQIIHKKNN----ISWINDSKSTNVS
MURD_SHEON            ------------------QVMANVARTFTGLSHRCEVVGVKGG----VTYVNDSKATNVG
MURD_SHEVD            ------------------EPMIQVAKNFTGLAHRCELVANIAA----VAYVNDSKATNVG
MURD_PSEAE            ------------------DAMLGALKAFSGLAHRCQWVRERQG----VSYYDDSKATNVG
MURD_NEIMA            ------------------EALLEHVKTFQGLPHRVEKIGEKNG----VVFIDDSKGTNVG
MURD_NEIMB            ------------------EALLEHVKTFQGLPHRVEKIGEKNG----VVFIDDSKGTNVG
MURD_RALSO            ------------------SALLHGLRDYAGEPHRVELIAAFDD----IEFFDDSKGTNVG
MURD_AGRFC            ------------------EEIRAGLKSFPGLKHRMQPVGRRGN----VTFVNDSKATNAD
MURD_RHIME            ------------------KDIVDGLRSFPGLKHRMQPVAKKGE----VVFVNDSKATNAE
MURD_RHILO            ------------------GEIQSGLESFPGLAHRMEQVGRKDH----VLFVNDSKATNAD
MURD_BRUSU            ------------------EEIHAGLKSFPGLAHRMEQVGRRGK----VLFVNDSKATNAE
MURD_BRUME            ------------------EEIHAGLKSFPGLAHRMEQVGRRGK----VLFVNDSKATNAE
MURD_CAUVC            ------------------QDAVDGLMTFPGLAHRMETVGKIGK----VRFVNDSKATNAD
MURD_ANAMM            ------------------EVIMASIREFPGLRHRNQVVAEVAN----VTFVNDSKATTAA
MURD_RICPR            ------------------KKILESISSFQSLHHRMQYIGSINN----ISFYNDSKATNAI
MURD_RICTY            ------------------KKILESISSFQSLHHRMQYIGSINN----ISFYNDSKATNAI
MURD_CHLTE            ------------------ETMRGVLAGFGGVEHRQELAGNACG----LNWINDSKATSVN
E0TG10_PARBH          -----------P----LTDALIDTVRRYRGLPARQEIVASHDG----RIWVNDALATIPE
MURD_FUSNN            ------------------EKLKEFLMIATPLEHRTELFFNYGK----LKFINDSKATNVD
MURD_HYDS0            ------------------EEIKKNLETFEALPFRYQYLGNFEG----IDICNDSKSTTVN
MURD_THEMA            -----------------LESFLELLRDFKPLPHRMEYLGQIDG----RHFYNDSKATSTH
MURD_LEPIN            ------------------ESIQTRIPLFRGLPHRFQIAGEKLG----ISFINDSKSTNLH
D0RN10_9PROT          -----------------KIHKNYHNQIKNKLSHRVEFFYKKNN----FKFINDSKSTNFD
F0SPJ3_RUBBR          ------------------AQAAECLKSYQGLPHRLQQVRIWQG----RRIIDDSKATSPW
MURD_BORBU            -----------YYLNIDLNRTGQILSNFKGIEHRLEFVKSVQN----VMFYNDTASTIPE
MURD_TREPA            SPPDYACPSAHSPFQEHTRRLAQALESYTGIEHRLEFFYEKGG----LRFYNDSASTVPE
                                                       :                 ::: .:   

MURD_DEIRA            AVESALRQA-----RPPIAWLVGGRDKGAELAPLRAAAEGRV--TRVIAFGEDGEALARD
E8U8B1_DEIML          AVQAALTRA-----RGPVAWLVGGIDKGADLAALEGVVREKV--ARVVAFGQDGPAFAGY
MURD2_XANAC           ASLAALACF----ARRRVALLVGGHDRGLDWHDFAQQMAQQA-PLEIVTMGANGPRIHAL
MURD2_XANCP           ASLAALACF----AQQRVALLVGGHDRGLDWQEFAAHMAQQA-PLEIVTMGANGPRIHAL
MURD2_XYLFA           ATLAALDCFL---GRCRVAVLVGGYDRGVDWECFAARITRKV-PLDIVTMGANGPHIQAL
MURD2_SALTO           AAMHAIDAY----DGRALTVIVGGADRGLDYTPLRDHLAER--EITVIGVPDSGARIVAA
D2S4M7_GEOOG          SVRAAIDAF----AGQQVTLIAGGQDRGLDYTDLAAAVVARGGTVQVLTIPDTGARFAAD
G4R6Q5_PELHB          ATKVALAAY----KGKKIALIAGGHERQQDYTDLANLMGLTS-VVMLCSLPVTGTRLAQA
A0A1K2HW41_9RHIZ      ATKAALGAY----SGRRIALVAGGHERQQDYTELAGMLEAAG-VTLLVTLPVTGDRLASA
B9D3A3_CAMRE          ASIQAVKRYEGKF----LHLILGGDDKGVDMRPLFEALH--GTKVQIYAIGSNTDKLMKL
A7GWQ6_CAMC5          AAVQAIHRYEGKF----LHLILGGDDKGVQMSELFEALS--GVKVQIYAIGSNTAKLMAL
MURD_CAMJE            AVMAALSRYKDKK----IHLIIGGDDKGVDLSNLFDFMK--GFDIELYAIGISTEKMLDY
Q7M7X1_WOLSU          AANEAVKRYEGRF----VHLILGGDDKGADLTPLFELLE--GRSLQIYAIGSNALKIERL
MURD_HELPY            ATLQALKTFKNQK----IHLILGGDIKGVNLTPLFEEFK--NYKISLYAIGSSAFIIQAL
MURD_HELPJ            ATLQALKTFKNQK----IHLILGGDIKGVNLTPLFEEFK--NYKISLYAIGSSASIIQAL
D3UG08_HELM1          ATLAALLCYKDQK----IHLILGGEDKGANQESIFAFIKEHGLEIVLYLIGANVKKLQGL
H5VFM6_HELBI          ATLKALDRFKDRP----IHLILGGDTKGVDLTPLFETLA--TLQVSIYAIGVSAPTIMQM
MURD_CHLPN            AVEKALMAVGKD-----VIVILGGKDKGGDFPALASVLSQ--TTKHVIAMGECRQTIADA
MURD_CHLMU            ATEKALLSIGSR-----AIVILGGRNKGYSFVSLLPSLRR--FAKSVVAMGECAQEIAQD
MURD_NOSS1            AAEVGLASVKSP-----VVLIAGGEAKPGDDTAWLAKIQA--QTSAVLLIGSAAPAFAQR
MURD_SYNY3            AAEVGLSSMKGP-----TILIAGGEAKEGDDQAWLAQIRQ--KAVAVLLIGDAAPNFATR
D3ENM3_ATETH          AAAMGLISVESP-----AILIAGGQSKEGNDSEWIKLIKS--QVSKVLLIGESASFIAER
MURD_THEEB            AAEIGLRSVTGP-----VILIAGGQAKKGDDRPWLNLIQE--KAAWVLLIGEAAPQFAQR
MURD_SYNJA            AGWVALNALSPP-----IILIAGGRAKQGDPSAWLRLIQA--KVARVLLIGEAAPALAQA
MURD_CLOBB            RTLAGLKAFDKR-----VILIAGGYDKHLLFEPLANEGYP--YIKELILLGQTKEKIKDV
MURD_CLOPE            RTLAGLKAFEKP-----VILLAGGYDKHVPFEPLAYEGYE--KIKAIVLFGVTKEKIKAA
MURD_CLOAB            RTISGLNAYERP-----VILIAGGYDKHIPFEPLAEKGYD--KIKVLILMGATKNKIKET
MURD_CALS4            ASIKAIQALKTP-----IVLIAGGYDKGSEFDEFVKTFDK--KVRKLILIGQTAQKIKKT
MURD_STRA3            ATQKALSGFDNTK----VILIAGGLDRGNEFDELI-PDIT--GLKHMVVLGESASRVKRA
MURD_STRA5            ATQKALSGFDNTK----VILIAGGLDRGNEFDELI-PDIT--GLKHMVVLGESASRVKRA
MURD_STRMU            ATQKALSGFDNSK----VILIAGGLDRGNEFDELV-PDIK--GLKKMIILGESAPRLKHA
MURD_STRPN            ATQKALSGFDNSK----VVLIAGGLDRGNEFDELV-PDIT--GLKKMVILGQSAERVKRA
MURD_STRR6            ATQKALSGFDNSK----VVLIAGGLDRGNEFDELV-PDIT--GLKKMVILGQSAERVKRA
MURD_STRP1            ATQKALSGFDNSR----LILIAGGLDRGNEFDDLV-PDLL--GLKQMIILGESAERMKRA
MURD_STRP8            ATQKALSGFDNSR----LILIAGGLDRGNEFDDLV-PDLL--GLKQMIILGESAERMKRA
MURD_LACLA            ATQKALSGFDNSK----LWLLAGGLDRGNGFEELE-KDLQ--DLKGMVVFGQTANKLRLT
MURD_ENTFA            ATEMALSGFDNQK----LLLLAGGLDRGNSFDELV-PALL--GLKAIVLFGETKEKLAEA
MURD_ENTHR            ATKMALSGFQLDQ----LVLIAGGLDRGNSFDELI-PALK--GIKALITFGETQNRLEDA
MURD_LISIN            ATQSALKGFKNP-----VVLLAGGLDRGNSFDELL-PFFK--NVKSLIVFGETADKIGRV
MURD_LISMO            ATQSALKGFKNP-----VVLLAGGLDRGNSFDELL-PFFK--NVKTLIVFGETADKIGRV
MURD_BACHD            STTAAIQSFTDP-----IVLLAGGLDRGNSFDDLI-PALQ--KVKAVVLFGETKHKLAQA
MURD_OCEIH            ATKKALAAFNKN-----VVLLAGGLDRGNTFEELI-PYLH--HVKAMVVFGETAGKLKDA
MURD_BACSU            ATSKALSAFDKP-----VILLAGGLDRGNGFDDLK-PYMK--HVKAVLTFGQTAPKLEKL
MURD_STAAM            ATQFALNSFNQP-----IIWLCGGLDRGNEFDELI-PYME--NVRAMVVFGQTKAKFAKL
MURD_STAAW            ATQFALNSFNQP-----IIWLCGGLDRGNEFDELI-PYME--NVRAMVVFGQTKAKFAKL
MURD_STAES            ATQFALNSFDQP-----IIWLCGGLDRGNEFDELI-PYME--NVRVMVVFGETQDKFAKL
MURD_MYCLE            AALVSVLAYP------RVVWVAGGLLKGASVDAEVARMAP--QLVGAVLIGRDRAMVAEA
MURD_MYCTU            AARASVLAYP------RVVWIAGGLLKGASLHAEVAAMAS--RLVGAVLIGRDRAAVAEA
MURD_COREF            AADTALAGRE------SVIWIVGGQLKGADISELVATHAH--RIKAALVLGADRAEIVTA
MURD_STRCO            ATEASLAAYE------SIVWIAGGLAKGATFDELVAGAAK--RLRGAVLIGADRALIREA
MURD_BIFLO            AARASLSSFPA----KSVIWIAGGLAKGSRFEDLVKDQAH--TIKAAVIIGKDQQPMIEA
MURD_TROW8            AVIASLSNFS------RVILIFGGLMKGVDVSGIFDRFYE--TIKAVVVIGKNQ-----S
MURD_ECOLI            STEAALNGL---HVDGTLHLLLGGDGKSADFSPLARYLNG--DNVRLYCFGRDGAQLAAL
MURD_ECO57            STEAALNGL---HVDGTLHLLLGGDGKSADFSPLARYLNG--DNVRLYCFGRDGVQLAAL
MURD_ECOL6            STEAALNGL---HVDGTLHLLLGGDGKSADFSPLARYLNG--DNVRLYCFGRDGAQLAAL
MURD_SALTI            STEAALNGL---HVDGTLHLLLGGDGKSADFSPLARYLTG--DRIRLYCFGRDGAQLAAL
MURD_SALTY            STEAALNGL---HVDGTLHLLLGGDGKSADFSPLTRYLTG--DRIRLYCFGRDGAQLAAL
MURD_YERPE            STEAALDGL---QVDGTLHLLLGGDGKSADFSGLTHFLQG--DRIKVYCFGRDGGQLAAL
MURD_PASMU            STVAALTGL---QLNGTLHLLLGGDGKGADFSELASLINQ--PNIICYCFGQDGEQLAAL
MURD_HAEIN            STVAALAGL---YIEGKLHLLLGGDGKGADFSELAELINQ--PHIICYCFGRDGALLAKF
MURD_VIBCH            STLAALSGL---KIEGQLYLLVGGVGKGADFTPLAPVLAT--LPVQLCCFGVDGHQFMPL
MURD_VIBVU            STQAALSGL---NCAGKLYLLVGGDGKGADFSPLKPILAQ--LNLQLCCFGADGDQFMPL
MURD_BUCAI            STQVALNSI---KTTGTIRLLLGGDSKSANFNILKNIFRT--LKIKIYCFGRDGIKLSKI
MURD_BUCAP            STKAALKNL---KIKGTIWLLLGGDGKSSNFNILKKYFEK--IKIKIYCFGKDGLNLSKL
MURD_WIGBR            STIAALSSI---KIKGNIHLLLGGDSKKANLLPLMKIIRN--KKIKLYCFGKDAYLLSKI
MURD_SHEON            ATVAALDGLS-DHL-GDIILIAGGDGKGADFSPLEEPLTK--VTH-LITLGRDGNKIAAL
MURD_SHEVD            ATVAALEGLG-EHL-GDIILIVGGDGKGADFTPLETVFNK--VAH-LITLGKDGDKIAAL
MURD_PSEAE            AALAAIEGLG-ADIDGKLVLLAGGDGKGADFHDLREPVAR--FCRAVVLLGRDAGLIAQA
MURD_NEIMA            ATAAAIAGL-----QNPLFVILGGMGKGQDFTPLRDALAG--KAKGVFLIGVDAPQIRRD
MURD_NEIMB            ATAAAIAGL-----QNPLFVILGGMGKGQDFTPLRDALVG--KAKGVFLIGVDAPQIRRD
MURD_RALSO            ATVAALSGL-----SKRVVLIAGGDGKGQDFSPLAAPVAQ--YARAVVLIGRDAPRIRAA
MURD_AGRFC            AAAPALSSFDR------IYWIAGGLPKAGGITSLSPLFP---RIAKAYLIGEAAAEFAAT
MURD_RHIME            AAAPALSSYDR------IYWIAGGLPKEGGITSLAPFFP---KIVKAYLIGEAAPSFAAT
MURD_RHILO            AAAPALSSFPR------IYWIAGGLPKEGGIEPLRGFFP---RIAKAYLIGEAAPAFSAT
MURD_BRUSU            ATAPALSSFPQN-----IYWIVGGVPKAGGINSLTAFFP---RVAKAYLIGEAAAQFAAT
MURD_BRUME            ATAPALSSFPQN-----IYWIVGGVPKAGGINSLTAFFP---RVAKAYLIGEAAAQFAAT
MURD_CAUVC            AARQAMSSYPK------FYWIAGGVAKAGGIDDLKDLFP---RIAKAYLIGEAAEPFSWT
MURD_ANAMM            SVAKALVSREN------VYWIAGGKSKDGGIEPILSLYAN--RIRKAFLVGEAADMFAVS
MURD_RICPR            SALQSIKALDN------IYWLAGGIPKEGGIEGIKPYFN---KIKKAYFYGQAKAMFANT
MURD_RICTY            SALQSIKALDN------IYWLAGGIPKEGGIEGIKPYFN---KIKKAYFYGQAKTMFANT
MURD_CHLTE            ALRQALQSVPAG-----MVLIAGGRDKGNDYSAIADLVRE--KVACIVAIGESRRKIADA
E0TG10_PARBH          ATVHAIDRFAVLG---RVVLLVGGQDRGQDFAPLATSLAD-YDCVTTGIFGGIADRLAPR
MURD_FUSNN            STKFAIQANKN------SILICGGYDKGVDLAPLAEMIKE--NIKEVYLIGVIADKIENE
MURD_HYDS0            ALMSALESTKAP-----ILLIAGGIDKGGDFSSIEAYKDK---IKAVFLYGKDKNLIKDQ
MURD_THEMA            AVLGALSNFDK------VVLIMCGIGKKENYSLFVEKASP--KLKHLIMFGEISKELAPF
MURD_LEPIN            SMLAGMATWKNID---QTCLILGGRPKQEDLKPLYNFLIR--GIGCVVLFGEARATWESG
D0RN10_9PROT          ATKFAIQQYKN------IILIIGGLLKKGDSYNLKNLSNN---LVEIYIFGNKSNIIQKS
F0SPJ3_RUBBR          ATLAGMRAMRES-----FWLILGGAASSDDPAELLAALPDVPLLRGIALMGPGGKLWGEA
MURD_BORBU            STVLSVKSLKTKD--NRINLIVGGTDKELDFLSFSKIADI--VRTWILIRGSATVKIIKI
MURD_TREPA            ATIAALEAFDES-----VVLIVGGTDKNADYQPLAQAAAK--AHALYLLAGSATARLQPL
                          .:              :  *                                    

MURD_DEIRA            L-------------------------------GLPFEVIKAETGDESMDRAVRAGWEALG
E8U8B1_DEIML          FDAAC---------------------------GVPVTLVPGADAARVMADAVRAAYASLP
MURD2_XANAC           LA------------------------------PLAEAGHFG--LHAANDLEHAMGLARNA
MURD2_XANCP           LA------------------------------PLAQSAGFG--LHAADDLAHAMQLARSA
MURD2_XYLFA           LA------------------------------PLA-AGRFG--LHAAVDLPQAVALARTA
MURD2_SALTO           LD------------------------------GLPKVR-----CDVTGDLVEAVRLARRV
D2S4M7_GEOOG          LR------------------------------AAAAAAGVAAPVTETGSLADAVAEALRT
G4R6Q5_PELHB          VR------------------------------DNTP-IPIAE-----CSTLDEAMQALAS
A0A1K2HW41_9RHIZ      AY------------------------------AAAPGVEVLE-----AASLEAAMEALAH
B9D3A3_CAMRE          AGEFK------------------------------------IPAVKCEFLNVAVGEIDKN
A7GWQ6_CAMC5          ADKFG------------------------------------VRATACEFLEVAVKKIDEN
MURD_CAMJE            AKKAN------------------------------------LKAYKCEVLSKAVNEISNH
Q7M7X1_WOLSU          AKERG------------------------------------IACKVCERLEKAVEAIRQN
MURD_HELPY            ALEFN------------------------------------VSCQVCLELEKAVQEIKSV
MURD_HELPJ            ALEFN------------------------------------VSCQVCLKLEKAVQEIKSV
D3UG08_HELM1          ARDFG------------------------------------VEFFVCETLAVAVAKVKRS
H5VFM6_HELBI          AKKYA------------------------------------IRACLCQELKVAVQSIKDN
MURD_CHLPN            LSEKIPL-------------------------------------TLSKDLQEAVSIAQ--
MURD_CHLMU            L-DGFPV-------------------------------------TVVRNLHEALLCAE--
MURD_NOSS1            LKEV-----------------------------------GYTHYEIVETMEKAVRRSL--
MURD_SYNY3            LKAV-----------------------------------GYENYEIVETMANAVQRGL--
D3ENM3_ATETH          LESF-----------------------------------SYYNYEIVEEMDVAVRKKF--
MURD_THEEB            LEAI-----------------------------------GFTNYEIMETLDRAVAAAA--
MURD_SYNJA            LQEI-----------------------------------RYTDLEILPTLDVAVERAFVA
MURD_CLOBB            FKELEASK------------------------------GIKINISEVSTLEEAVKKAQ--
MURD_CLOPE            FKRLEEEK------------------------------GIHVPVYSGESLEEVVNIAK--
MURD_CLOAB            FDKVICEK------------------------------NIKLPIILSDNLEEAVCEAK--
MURD_CALS4            ALKYSYPE---------------------------------EDIFLVDSLEEAVRKAY--
MURD_STRA3            AQKA-----------------------------------GVTYSD-ALDVRDAVHKAY--
MURD_STRA5            AQKA-----------------------------------GVTYSD-ALDVRDAVHKAY--
MURD_STRMU            AVQA-----------------------------------GVTYLN-AKDVAQATRIAF--
MURD_STRPN            ADKA-----------------------------------GVAYVE-ATDIADATRKAY--
MURD_STRR6            ADKA-----------------------------------GVAYVE-ATDIADATRKAY--
MURD_STRP1            ANKA-----------------------------------EVSYLE-ARNVAEATELAF--
MURD_STRP8            ANKA-----------------------------------EVSYLE-ARNVAEATELAF--
MURD_LACLA            AEKL-----------------------------------NIPVFD-SENVAKALEEIL--
MURD_ENTFA            AKKA-----------------------------------NIETILFAENVQTAVTIAF--
MURD_ENTHR            GKKA-----------------------------------GIPVIKTAENAEAAVPIAL--
MURD_LISIN            GKIA-----------------------------------GIEVHY-VDDVEAAVPVAY--
MURD_LISMO            GKIA-----------------------------------GIEVHY-VDNVEAAVPVAY--
MURD_BACHD            AMEA-----------------------------------GVETIVEAERVEDAVRKAL--
MURD_OCEIH            GVAA-----------------------------------NIPVIEKALDVQHAVEVAF--
MURD_BACSU            GNEL-----------------------------------GIQHVKRVDNVEQAVSAAF--
MURD_STAAM            GNSQ-----------------------------------GKSVIE-ANNVEDAVDKVQ--
MURD_STAAW            GNSQ-----------------------------------GKSVIE-ANNVEDAVDKVQ--
MURD_STAES            GNSQ-----------------------------------GKYVIK-ATDVEDAVDKIQ--
MURD_MYCLE            LSRHAPNVPVVQVVAGEDAGMHAVAVVSGTDVISISD---VGGTIGTRVMVAAVAAAR--
MURD_MYCTU            LSRHAPDVPVVQVVAGEDTGMPATVEVPVACVLDVAKDDKAGETVGAAVMTAAVAAAR--
MURD_COREF            VEQHAPDA-MIRVTDSTDP---------------------------VAAMRELVDHAF--
MURD_STRCO            LARHAPEVPVVDLDRTDTG-----------------------------AMLQAVQEAR--
MURD_BIFLO            FASQAPDIPVTIIDPEDND----------------------------TVMDRAVEACG--
MURD_TROW8            FVGNIKCKKIVCIPDSNDP------------------------------MSEAVAAAD--
MURD_ECOLI            RPEVA---------------------------------------EQTETMEQAMRLLA--
MURD_ECO57            RPEVA---------------------------------------EQTETMEQAMRLLA--
MURD_ECOL6            RPEVA---------------------------------------EQTETMEQAMRLLA--
MURD_SALTI            RPEIA---------------------------------------QQTETMEEAMRLLA--
MURD_SALTY            RPEIA---------------------------------------QQTETMEEAMRLLA--
MURD_YERPE            RPDVS---------------------------------------QLTETMAQAMALVA--
MURD_PASMU            SPR-S---------------------------------------QRFSTMEEAINALR--
MURD_HAEIN            SSQ-S---------------------------------------YLFDTMEQAIEFLR--
MURD_VIBCH            HPS-A---------------------------------------RFYDSMESIIRSIR--
MURD_VIBVU            HAS-A---------------------------------------TRFERMEDVIEHIS--
MURD_BUCAI            CEKKS---------------------------------------IYVENLKKAVILIS--
MURD_BUCAP            CKKKS---------------------------------------IYTKTLKQAIILIS--
MURD_WIGBR            S-TDS---------------------------------------FINDTLYHSMIKIK--
MURD_SHEON            KEGAI----------------------------------------KVDSMAAAVAKAA--
MURD_SHEVD            KEHSH----------------------------------------KADSMADAVKQAA--
MURD_PSEAE            LGNAVP-L------------------------------------VRVATLDEAVRQAA--
MURD_NEIMA            LDGCDLNM------------------------------------TDCATLEEAVQKAY--
MURD_NEIMB            LDGCGLNM------------------------------------TDCATLGEAVQTAY--
MURD_RALSO            LADSGVEL------------------------------------VEAATLEAAVQEAA--
MURD_AGRFC            LGEAV-------------------------------------PYEISGTLDKAVQHAAAD
MURD_RHIME            LGEAV-------------------------------------PYEISGTLEKAVAHAAAD
MURD_RHILO            LGEAV-------------------------------------PYEISGTLAAAVAHAAHD
MURD_BRUSU            LGGAV-------------------------------------PFEISDTLAAAVAHAAGD
MURD_BRUME            LGGAV-------------------------------------PFEISDTLAAAVAHAAGD
MURD_CAUVC            LAGKA-------------------------------------ECVLSGTLEKAVQQAYAD
MURD_ANAMM            LQRAR-------------------------------------VEHVMCYDVYNAVQIAFA
MURD_RICPR            AKNII-------------------------------------DFVICDNLEYAFNIAYKD
MURD_RICTY            AKNII-------------------------------------DCVICDNLEYAFNIAYKD
MURD_CHLTE            FRGVT-------------------------------------PVVEAASLAEAVELAR--
E0TG10_PARBH          LRAAG------------------------------------VAFTPLGTFESALAWVT--
MURD_FUSNN            LKKVGYED---------------------------------NKIHKLVNIENSLQDMRKR
MURD_HYDS0            IEHFL-------------------------------------KVYVLEDLESALLKVK--
MURD_THEMA            VGKIP--------------------------------------HSIVENMEEAFEKAM--
MURD_LEPIN            IKNII-----------------------------------GEKLYCVENLNDTFEIFKKG
D0RN10_9PROT          LTKQK------------------------------------IRFICFYNLRTVLKNIYKK
F0SPJ3_RUBBR          VRRAVEAG---------------------------------VQVEQFESQHEACRWAA--
MURD_BORBU            LEKSS------------------------------------IQYFLFDSLRDAVNYAF--
MURD_TREPA            LHAAQ-----------------------------------VPFYGPFTSLEVLLQDLRAR
                                                                                  

MURD_DEIRA            -------------------GAGGTGTVLLAPVGTSFDQ-------FRDYQQRGASFRRAV
E8U8B1_DEIML          -------------------GEG---TVLLAPIGTSFDL-------WRDYKARGAAFADAA
MURD2_XANAC           -------------------LGEQGGVVLLSPGAPSFGA-------YSDYVARGRHFAQLA
MURD2_XANCP           -------------------LGAQGGVLLLSPGAPSFGV-------YSDYVARGRHFAQLA
MURD2_XYLFA           -------------------LGAQGGVLLLSPGAPSFGA-------YQDYVARGRHFAILA
MURD2_SALTO           -------------------TPA-GGVVLLSPAAPSYGQ-------FRNFEHRSEVFAQAV
D2S4M7_GEOOG          -------------------ARP-GGLVLLSPGAPSYNR-------FRNYEELARTYEQIL
G4R6Q5_PELHB          -------------------AGHIFDTVILSPGAPSYNQ-------FKNFEERGDRFKALA
A0A1K2HW41_9RHIZ      -------------------RRDRFDTVILSPGAPSYGQMLRPGIVFKNFEERGTAFIALA
B9D3A3_CAMRE          FK-------FDGAVKAGANDENLDEIALLSPAAASLDQ-------FGSYVERGDEFKKAI
A7GWQ6_CAMC5          FKKSELNLDISGTANTAINLNDADEIALLSPAAASLDQ-------FKSYAQRGDKFKEFV
MURD_CAMJE            LR--------------------VNEVALLSPACASLDQ-------FNSYAERGKVFKECV
Q7M7X1_WOLSU          LK--------------------ANEVALLSPAAASLDQ-------FSSYKERGDSFKRYA
MURD_HELPY            LS--------------------QNEIALLSPSAASLDQ-------FSSYKERGEKFKAFV
MURD_HELPJ            LL--------------------QNEVALLSPSAASLDQ-------FSSYKERGEKFKAFV
D3UG08_HELM1          LQ--------------------KNEVALLSPAAASLDQ-------FRSYKERGELFQRLA
H5VFM6_HELBI          LQ--------------------PNQIALLSPSAASLDQ-------FASYKHRGNAFKEYV
MURD_CHLPN            ------------------TIAQEGDTVLLSPGCASFDQ-------FQSFKERGAYFKLLI
MURD_CHLMU            ------------------EQAIPGDVVLLSPACASFDQ-------FRSYEERGAIFKQLV
MURD_NOSS1            ----------------ELAKHHQAPVVLLSPACASFDQ-------YPNFEARGDHFRELC
MURD_SYNY3            ----------------ELASKNNASAVLLSPACASFDQ-------YNSFEERGEDFRACC
D3ENM3_ATETH          ----------------QLR-----------------------------------------
MURD_THEEB            ----------------ELVTQYPIKTVLFSPGCASFDQ-------YQNFEERGDHFRQLC
MURD_SYNJA            ACSLAQ----------ALDNPAQPITVLLSPACASFDQ-------YSSFEHRGHHFRACC
MURD_CLOBB            ------------------NLARQGDIITLSPACASFDM-------FPNFMIRGNKFKEIV
MURD_CLOPE            ------------------SIAESGDIITLSPACASFDM-------FKNFEVRGDKFKEIV
MURD_CLOAB            ------------------KVATNGDIVTLSPACASFDS-------FPNFEVRGNKFKEIV
MURD_CALS4            ------------------EVAEKGDSVLLSPACASWDM-------FKNFEERGKAFKKAV
MURD_STRA3            ------------------EVAQQGDVILLSPANASWDM-------YKNFEVRGDEFIDTF
MURD_STRA5            ------------------EVAQQGDVILLSPANASWDM-------YKNFEVRGDEFIDTF
MURD_STRMU            ------------------QEASPGDVVLLSPANASWDM-------YKNFEVRGDEFITTF
MURD_STRPN            ------------------ELATQGDVVLLSPANASWDM-------YANFEVRGDLFIDTV
MURD_STRR6            ------------------ELATQGDVVLLSPANASWDM-------YANFEVRGDLFIDTV
MURD_STRP1            ------------------KLAQTGDTILLSPANASWDM-------YPNFEVRGDEFLATF
MURD_STRP8            ------------------KLAQTGDTILLSPANASWDM-------YPNFEVRGDEFLATF
MURD_LACLA            ------------------PQTQAGDTILLSPACASWDQ-------YKTFEERGDLFIQAF
MURD_ENTFA            ------------------DYSEKDDTILLSPACASWDQ-------YPNFEVRGEAFMQAV
MURD_ENTHR            ------------------ELSEEGDSILLSPANASWDQ-------YPNFEIRGERFMEAV
MURD_LISIN            ------------------RESAPGDIILLSPACASWDQ-------YRTFEVRGNAYMDAI
MURD_LISMO            ------------------RESAPGDIILLSPACASWDQ-------YRTFEVRGNAYMDAI
MURD_BACHD            ------------------DVSANGDVILLSPACASWDQ-------YRTFEERGEAFVTSI
MURD_OCEIH            ------------------ALTDEQDTILLSPACASWDQ-------YKTFEERGDMFIQAL
MURD_BACSU            ------------------ALSNEGDVILLSPACASWDQ-------FKTFEERGDMFIDAV
MURD_STAAM            ------------------DIIEPNDVVLLSPACASWDQ-------YSTFEERGEKFIERF
MURD_STAAW            ------------------DIIEPNDVVLLSPACASWDQ-------YSTFEERGEKFIERF
MURD_STAES            ------------------DIVEPNDVVLLSPACASWDQ-------YHTFEERGEKFIDRF
MURD_MYCLE            ------------------DLAQPGDTVLLAPAGASFDQ-------FSGYADRGDTFAT--
MURD_MYCTU            ------------------RMAQPGDTVLLAPAGASFDQ-------FTGYADRGEAFAT--
MURD_COREF            ------------------RFAEPGDCVLLAPAAASLDM-------YKGMGQRGDIFAE--
MURD_STRCO            ------------------RLARPGDTVLLAPACASMDM-------FTNYNQRGDAFAQ--
MURD_BIFLO            ------------------TYAAAGDIVLMAPACASMDQ-------FKSYADRGNRFAA--
MURD_TROW8            ------------------LLATPGDTVLLSPGGSSFDQ-------FESYEHRGNCFIN--
MURD_ECOLI            ------------------PRVQPGDMVLLSPACASLDQ-------FKNFEQRGNEFAR--
MURD_ECO57            ------------------PRVQPGDMVLLSPACASLDQ-------FKNFEQRGNEFAR--
MURD_ECOL6            ------------------TRVQPGDMVLLSPACASLDQ-------FKNFEQRGNEFAR--
MURD_SALTI            ------------------PHVQPGDMVLLSPACASLDQ-------FKNFEQRGDVFTR--
MURD_SALTY            ------------------PRVQPGDMVLLSPACASLDQ-------FKNFEQRGDVFTR--
MURD_YERPE            ------------------KVVLPGDRVLLSPACASLDQ-------FRSFEHRGNEFAR--
MURD_PASMU            ------------------PTLSAGDMVLLSPACASLDQ-------FSSFEQRGDEFTR--
MURD_HAEIN            ------------------PTLQSGDMVLLSPACASLDQ-------FASFEKRGEEFTH--
MURD_VIBCH            ------------------PQLKSGDMVLLSPACASFDQ-------FKNFMARGDIFAQ--
MURD_VIBVU            ------------------PQLQSGDMVMLSPACASFDQ-------FSNFMARGDRFAE--
MURD_BUCAI            ------------------KQVKSGDTVLLSPGCSSLGQ-------FSNFEERGNLFIK--
MURD_BUCAP            ------------------KKIQPGDVVLLSPGCSSKDQ-------FSNFEERGNLFIK--
MURD_WIGBR            ------------------ENLNHGDIVLLSPACSSLDQ-------FKNFKERGEKFTK--
MURD_SHEON            ------------------QLATSGDIVLLSPACASLDM-------YSNFMARGDDFRS--
MURD_SHEVD            ------------------ELATAGDIVLLSPACASLDM-------YKNFMARGDDFRQLA
MURD_PSEAE            ------------------ELAREGDAVLLSPACASLDM-------FKNFEERGRLFAK--
MURD_NEIMA            ------------------AQAEAGDIVLLSPACASFDM-------FKGYAHRSEVFIG--
MURD_NEIMB            ------------------AQAEAGDIVLLSPACASFDM-------FKGYAHRSEVFIE--
MURD_RALSO            ------------------ARAQAGDAVLLSPACASFDM-------FRNYEHRAQVFHE--
MURD_AGRFC            AEK----------------DATAGNVVMLSPACASFDQ-------YKNFEIRGDSFVAQV
MURD_RHIME            AAR----------------DSQGPAAVMLSPACASFDQ-------YKNFEVRGDAFVGHV
MURD_RHILO            AAK----------------DDSGEVVVLLSPACASFDQ-------FKNFEVRGEAFRQAA
MURD_BRUSU            AGN----------------DAAPEPVVLLSPACASFDQ-------FQNFEKRGDAFRDAV
MURD_BRUME            AGN----------------DAAPEPVVLLSPACASFDQ-------FQNFEKRGDAFRDAV
MURD_CAUVC            AAA----------------SGE-EAIVLLSPACASFDQ-------FSDFEARGEAFRAAV
MURD_ANAMM            EAI----------------ASGTKATVLLSPACSSLDQ-------WKNFEERGDAFCAAV
MURD_RICPR            AVS----------------DTTEVKNILLAPSCSSYDQ-------FKNFEERGELFIKLS
MURD_RICTY            AVS----------------DNTEIKNILLAPSCSSYDQ-------FKNFEERGELFIKLS
MURD_CHLTE            ------------------QNARPGASVLFSPACSSFDM-------FRDFEDRGRQFKQLV
E0TG10_PARBH          ------------------SSAPKGATILFSPSAASEPP-------YADYVARGAAFRAAA
MURD_FUSNN            ------------------FTKDSDEVILLSPATSSYDQ-------FNSFEHRGKVFKELV
MURD_HYDS0            ------------------EQARKGDTILFSPACASFDM-------FESYKHRGEVFNELV
MURD_THEMA            ------------------EVSEKGDVILLSPGGASFDM-------YENYAKRGEHFREIF
MURD_LEPIN            N--IFPVPGLNKDIIIRLSDSISISSFVFSPACASFDQ-------YKNFEERGNHFLSLV
D0RN10_9PROT          HYLE-------------NRNSKKNFTVLFSPGAASFDQ-------FKNFEDRGNKFKKYT
F0SPJ3_RUBBR          ------------------KASQAGETILLSPGCPSFNE-------FLHYEQRGAAFAAWF
MURD_BORBU            ------------------KISSPGDIVLFSPASASFEL-------FNNEFDRGLQFKNLV
MURD_TREPA            --------------------QKSPGVIVFSPGAASFEL-------FAHEFERGTTFKSQV
                                                                                  

MURD_DEIRA            QALLGTQSGSGESA---
E8U8B1_DEIML          RALVAEVQP--------
MURD2_XANAC           GFDPAAISAIDGLGVH-
MURD2_XANCP           GFDPAAISAIPGLGVQ-
MURD2_XYLFA           GFDPEVISSISGLGIA-
MURD2_SALTO           RDTAG------------
D2S4M7_GEOOG          LDAGAQRV---------
G4R6Q5_PELHB          RQHFG------------
A0A1K2HW41_9RHIZ      RSLFGHG----------
B9D3A3_CAMRE          LNL--------------
A7GWQ6_CAMC5          GNL--------------
MURD_CAMJE            NKI--------------
Q7M7X1_WOLSU          LL---------------
MURD_HELPY            LKD--------------
MURD_HELPJ            LKD--------------
D3UG08_HELM1          REG--------------
H5VFM6_HELBI          LGS--------------
MURD_CHLPN            REMQAVR----------
MURD_CHLMU            GMEEVLL----------
MURD_NOSS1            LELVGEKETNSNHH---
MURD_SYNY3            LGLV-------------
D3ENM3_ATETH          -----------------
MURD_THEEB            LEL--------------
MURD_SYNJA            QALVGSLEC--------
MURD_CLOBB            NEL--------------
MURD_CLOPE            NNI--------------
MURD_CLOAB            NNLK-------------
MURD_CALS4            MDLRR------------
MURD_STRA3            ESLRGE-----------
MURD_STRA5            ESLRGE-----------
MURD_STRMU            KSLKGE-----------
MURD_STRPN            AELKE------------
MURD_STRR6            AELKE------------
MURD_STRP1            DCLRGDA----------
MURD_STRP8            DCLRGDA----------
MURD_LACLA            ENLKK------------
MURD_ENTFA            QQLKESEM---------
MURD_ENTHR            NKLTIQK----------
MURD_LISIN            SELIEEVEK--------
MURD_LISMO            GELIEEVEK--------
MURD_BACHD            EGLQE------------
MURD_OCEIH            HRLK-------------
MURD_BACSU            HMLK-------------
MURD_STAAM            RAHLPSY----------
MURD_STAAW            RAHLPSY----------
MURD_STAES            RAHLPSY----------
MURD_MYCLE            ---AVRAAIR-------
MURD_MYCTU            ---AVRAVIR-------
MURD_COREF            ---AVLSTIEGQKEK--
MURD_STRCO            ---AVRELGA-------
MURD_BIFLO            ---AAKTWSEVHGLH--
MURD_TROW8            ---AVKDLVKRK-----
MURD_ECOLI            ---LAKELG--------
MURD_ECO57            ---LAKELG--------
MURD_ECOL6            ---LAKELG--------
MURD_SALTI            ---LAKELG--------
MURD_SALTY            ---LAKELG--------
MURD_YERPE            ---LAEELG--------
MURD_PASMU            ---LAKLS---------
MURD_HAEIN            ---LAQCLT--------
MURD_VIBCH            ---LARQYA--------
MURD_VIBVU            ---LARQYA--------
MURD_BUCAI            ---LIKEIT--------
MURD_BUCAP            ---LSKEIN--------
MURD_WIGBR            ---LAQKIG--------
MURD_SHEON            ---QVEQLDGE------
MURD_SHEVD            QALSVETLDSEASADV-
MURD_PSEAE            ---AVEELA--------
MURD_NEIMA            ---AFKAL---------
MURD_NEIMB            ---AFKAL---------
MURD_RALSO            ---AVAALAADRGVML-
MURD_AGRFC            AALEGMTMLVHSGKGG-
MURD_RHIME            AALEGVSMLI-------
MURD_RHILO            SAIDGVKPIGGAR----
MURD_BRUSU            LALPGVMPMRGES----
MURD_BRUME            LALPGVMPMRGES----
MURD_CAUVC            NGLTAGGGKAAVA----
MURD_ANAMM            AELVAPHKLCSTTTQ--
MURD_RICPR            KRHWQ------------
MURD_RICTY            KNVIGSNYLLSNLRIFD
MURD_CHLTE            RELT-------------
E0TG10_PARBH          LDA--------------
MURD_FUSNN            LKIFG------------
MURD_HYDS0            KKHFNS-----------
MURD_THEMA            KRHGGDEV---------
MURD_LEPIN            NDFLDQIDS--------
D0RN10_9PROT          YEFFKN-----------
F0SPJ3_RUBBR          AADSAE-----------
MURD_BORBU            NNLG-------------
MURD_TREPA            RIIFE------------