CLUSTAL format seed alignment for MF_00640

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DHSL_CAUVC      MKSLFQRRASKVRETEAMNAPVPNNQKAELLQKVVEHVDITSYDARPIIDSMRKMSFSSR
DHSL_COXBU      --------------MKNKNLSMPS-LKEKLLQETVEHIDITRFDARPIIDAMDHMSFTSR
DHSL_CHLTE      -------------------MEERSMQKAGFLKEPIKHIGITKHNVVPMVEEMADMAFQAR
DHSL_NOSS1      --------------------------MAKHLGKKIAPIPMSTDISVVDLIDNYFTAYNSA
DHSL_THEEB      -------------MAVPAVEFPWEEQPMSAFATPITPAPIPDNISLTELIDKYFTAYNSA
                                              :   :    :.       :      :: : 

DHSL_CAUVC      DTARAADIFNMALADKGCSTWLILAGSTSAGGC-MHVYRDMVKNGMIDAVVATGASIVDM
DHSL_COXBU      DLARATQIFNRMLQDEQCSIILSLAGSTSAGGC-MKLYADLVKYNMVDAIVATGASIVDM
DHSL_CHLTE      NLARAAFIVDLMQKDKECAVILTLAGSLISAGL-KQVIIDMLEHNMVDVIVSTGANIVDQ
DHSL_NOSS1      RLREASQLLACDILKDGVTVGVSLSGAMTPAGFGVSALAPLIRNGFIDWMISTGANLYH-
DHSL_THEEB      RLREICQLLSQRVFKPEVTVGLSLSGAMTPTGLGISALAPLVRAGFVDYIISTGANLYH-
                   .   :.     .   :  : *:*:  . *        ::. .::* :::***.: . 

DHSL_CAUVC      DFFEALGFKHYQAAGPVDDNVLRDNYIDRIYDTYIDEEELQACDHTILEICNKLE-PRGY
DHSL_COXBU      DFFEALGFRHYQGSPAVEDRQLRDLYIDRIYDTYIDEEDLQRCDHTIYEIANSLE-PRPY
DHSL_CHLTE      DFFEALGFKHWKGSQFVDDSELRELAIDRIYDTYIDEDELRVCDDTIAIIANSMQ-PGAY
DHSL_NOSS1      DMHYGLGFELFAGNPFLDDVKLREEGTIRIYDIIFGYDVLLETDAFIRKILQAEPFQKRM
DHSL_THEEB      DIHYALGMDLYAAHPFVDDVQLRKESKIRIYDIIFDYDVLLETDAFLRQVLRSETFQRRM
                *:. .**:  : .   ::*  **.    ****  :. : *   *  :  : .        

DHSL_CAUVC      SSREFIWEMGKWLAEGNAKKEG---SLIQTAYEEGVPIFCPAFVDSSAGFGLVKHQKEKI
DHSL_COXBU      SSREFIHHMGAYLAQGKAKKEE---SLVQLAYEHDVPIFCPAFTDSSAGFGLVLHQVK--
DHSL_CHLTE      SSREFIVEMGKYIEEKGLDKN----SIVYKAYEKGVPIFCPAFSDCSAGFGLVHHQWH--
DHSL_NOSS1      GTAEFHYLLGKYVREVEKQLGVKHSCLLATAYEYGVPIYTSSPGDSSIGMNVAALALE--
DHSL_THEEB      GTAEFHYHLGHYVRELEVQRGQPHSCLLATAYECGVPIYTSSPGDSSIGMNVAAIALE--
                .: **   :* :: :   .      .::  *** .***: .:  *.* *:.:.    .  

DHSL_CAUVC      AEKKPYLMIDAVADFRELTDVKIAAGT-------TGLFMVGGGVPKNFA-QDTVVCAEIL
DHSL_COXBU      -NPDRHLTIDSIRDFRELTDIKIKAGT-------TGLLMIGGGVPKNFV-QDTVVCAEVI
DHSL_CHLTE      -NPDQHVSIDSVKDFRELTKIKIENDK-------TGIFMIGGGVPKNFT-QDIVVAAEVL
DHSL_NOSS1      ---GSQLILDPAIDVNETAAIAYNARE---GEGKSAAVILGGGSPKNFLLQTQPQIHEVL
DHSL_THEEB      ---GSKLIIDPAIDVNETAAIAYFAREAAGGKGKSAALIIGGGSPKNFLLQTQPQIHEVL
                      : :*.  *..* : :             :. .::*** ****  *      *::

DHSL_CAUVC      GVE-ADMHKYAIQITVADVRDGACSSSTLKEAASWGKVST---TYEQMVFAEATTVVPLI
DHSL_COXBU      GKT-VDMHKYAIQITVADVRDGACSSSTLKEACSWGKVDT---AYEQMVYAEATSGLPLL
DHSL_CHLTE      GYENVSMHTYAVQITVADERDGALSGSTLKEASSWGKVDT---VYEQMVFAEATVAMPLI
DHSL_NOSS1      GLE-ERGHDFFVQFTDARPDTGGLSGATPAEAVSWGKIDPDELPSTIVCYTDSTIALPLV
DHSL_THEEB      GLE-ERGHDYFIQITDARPDTGGLSGAVPSEAVSWGKVDPQGLRDTVVCYTDSTIALPIL
                *      * : :*:* *    *. *.:.  ** ****:..       : ::::*  :*::

DHSL_CAUVC      ASDAYWRKAWE--GREKPRWNKLFGK----------------------------------
DHSL_COXBU      ASDAYHRGYWK--DRSPRQYANLFKSESK-------------------------------
DHSL_CHLTE      AGYAYHKRNWE--GRPARNFNAMLDAKPVNA-----------------------------
DHSL_NOSS1      TAYVLNQCPPRPLKRLYDRREELYDKLRTDYLAAK-DKPVEKVATNGEVATYPCGTPIRQ
DHSL_THEEB      TAYCLNRCQPRPLKRLYDRRGEMVERLQQLYLQAQLQHKVKELPTEAPVATYPCGTPIRR
                :.    :   .   *   .   :                                     

DHSL_CAUVC      -
DHSL_COXBU      -
DHSL_CHLTE      -
DHSL_NOSS1      -
DHSL_THEEB      P