CLUSTAL format seed alignment for MF_00641

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MASZ_RHILV       -------------------------MSRVDKNGLAIETVLHDFLVEEVLPGLAVDADKFF
MASZ_RHIME       -------------------------MDRVEKYGLQIDAGLHRFLVEEAMPGTGVDADRFF
MASZ_AGRFC       ----------------MPSEYKEAHVSRTDKFGLSIDDRLYAFLTDEVLPGTGLDSETFF
MASZ_RHILO       ------------------------MTDRIEIAGLRIAGELHDFVAGEALPGTGIAADAFW
MASZ_BRUME       -------------------MGSAEKRNYVEIEGLAVAPELVEFLAKEAAPGTGVEPEKFW
MASZ_BRUSU       -------------------MGSAEKRNYVEIEGLAVAPELVEFLAKEAAPGTGVEPEKFW
MASZ_BRADU       -------------------------MKRVDAHGLKIAPVLFDFIAKEAAPKTGIAPDAFW
MASZ_MYCLE       ------------------------MTDRVSAGNLRVARVLYDFVNNEALPGTDINPNSFW
MASZ_MYCTU       ------------------------MTDRVSVGNLRIARVLYDFVNNEALPGTDIDPDSFW
MASZ_PSEAE       ------------------------MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFW
MASZ_PSEPK       ------------------------MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFW
MASZ_PSEFL       ------------------------MTEHVQVGGLQVAKVLFDFVNNEAIPGTGITADQFW
MASZ1_PSESM      ------------------------MTEYVQVGDLQVARVLFDFVQNEATPGTGVDAGAFW
MASZ_RHOFA       ------------------------MTDRVQAGGLQVAKVLFDFVEKEALPGTDLDSEAFW
MASZ_COREF       MPAHTRSLASKELCMNHQQIDAADKTERVTVGGMQVAKVLRDFLTESVLPRVGVDAERFW
MASZ_CORGL       ------MTEQELLSAQTADNAGTDSTERVDAGGMQVAKVLYDFVTEAVLPRVGVDAEKFW
MASZ_BACHD       ------------------------METYEHVGNLQVATKLITFIEQRALPGTGIKKDDFW
MASZ_ECOLI       ------------------------MSQTITQSRLRIDANFKRFVDEEVLPGTGLDAAAFW
MASZ_SHIFL       ------------------------MSQTITQGRLRIDANFKRFVDGEVLPGVELDAAAFW
MASZ_ECOL6       ------------------------MSQTITQGRLRIDANFKRFVDEEVLPGVELDAAAFW
MASZ2_PSESM      ------------------------MTDFVKCQRLKVAVKLQRFVDEEVLPGTGLEPEAFW
                                                  : :   :  *:   . *   :    *:

MASZ_RHILV       ADFSAIVHDLAPKNCALLAKRDELQVKIDDWYRRH-GAPADMDEYQSFLREIGYLLPEGS
MASZ_RHIME       SAFSDLVHDLGPKNRALLVKRDELQARLDGWYREH-GAPVDMEAYEAFLREIGYLLPEGP
MASZ_AGRFC       EGFSAIVHELSPKNRELLAKRDALQEKIDGWYREN-GAPSDFDAYEAFLKEIGYLLPEGP
MASZ_RHILO       SGFSAIVHDLAPKNRALLKKRDAMQERLDGWYRDN-GAPVDMEVYKSFLKEIGYLVPEGP
MASZ_BRUME       KGFAAIIRDLAPKNRALLAKRDELQARIDAWYKENRDKGYSQADYQQFLKDIGYLLPEGG
MASZ_BRUSU       KGFAAIIRDLAPKNRALLAKRDELQARIDAWYKENRDKGYSQADYQQFLKDIGYLLPEGG
MASZ_BRADU       AGVAAIIKDLGPKNRALLALRDALQAKIDDWHRANKGKAFDLNAYTAFLKEIGYLVPEPA
MASZ_MYCLE       SGVAKVVADLTPQNQSLLNSRDELQAQIDKWHRHRVIEPFDVDAYRQFLIDIGYLLPEPD
MASZ_MYCTU       AGVDKVVADLTPQNQALLNARDELQAQIDKWHRRRVIEPIDMDAYRQFLTEIGYLLPEPD
MASZ_PSEAE       TGAEAVINDLAPKNKALLAKRDELQAKIDGWHQARAGQAHDAVAYKAFLEEIGYLLPEAE
MASZ_PSEPK       AGAEKIINDLAPKNKALLAKRDELQAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQAD
MASZ_PSEFL       AGADKVIHDLAPKNKALLAKRDDFQARIDTWHQTHAGQAHDPVAYKAFLQDIGYLLPEAA
MASZ1_PSESM      AGADQLIHDLAPKNKALLAQRDELQAQIDAWHQSRAGQAHDASAYKAFLQEIGYLLPEAA
MASZ_RHOFA       AGAASVIADLAPKNKALLAVRDEIQGKVDAWHGEHAGAEYDRAAYKAFLKEIGYLLDEPA
MASZ_COREF       NGFGDIVRDMTPRNRELLARRDELQAQLDEYYRENPGK-PDPEKYEAFLREIGYLVDEPA
MASZ_CORGL       SGFAAIARDLTPRNRELLARRDELQMLIDDYHRNNSGT-IDQEAYEDFLKEIGYLVEEPE
MASZ_BACHD       SGVQQIITELMPENKMLLAKREEIQATIDAWHQKNKGP-IDFSAYHSFLEEIGYLEPIPE
MASZ_ECOLI       RNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPE
MASZ_SHIFL       HNVDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPE
MASZ_ECOL6       HNVDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPD
MASZ2_PSESM      KGFDALVHDLAPVNRELLAERERLQGQLDKWHKAHPGPITDMPAYRAFLHSIGYLQPVPE
                      :  :: * *  **  *: :*  :* ::  .     .   *  ** .:***     

MASZ_RHILV       DFQVSTQNVDPEIASIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAIPESDGAEK
MASZ_RHIME       DFYVSTANVDSEIATIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAIAETDGAER
MASZ_AGRFC       GFKVETNNVDPEIAVVAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAISDADGAEK
MASZ_RHILO       AFSVSTDNVDPEIAVVAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAIPETGGAEK
MASZ_BRUME       AFSVSTTNVDPEITHIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAISEADGAEK
MASZ_BRUSU       AFSVSTTNVDPEITHIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAISEADGAEK
MASZ_BRADU       TQKVETANVDEEIGKICGPQLVVPLTNARYALNAANARWGSLYDAFYGTDAIPHDP-SES
MASZ_MYCLE       DFTISTSGVDDEITMTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDTIPETEGAEK
MASZ_MYCTU       DFTITTSGVDAEITTTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDVIPETDGAEK
MASZ_PSEAE       DFQAGTQNVDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDVISEEGGAEK
MASZ_PSEPK       DFQATTQNVDEEIAHMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISDEGGAEK
MASZ_PSEFL       DFQASTQNVDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDAISEADGAEK
MASZ1_PSESM      DFQITTQNVDEEIATMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDAISEEGGAEK
MASZ_RHOFA       DFQIHTSGVDTEITTTAGPQLVVPVLNARFAINASNARWGSLYDALYGTDAIPETDGAEK
MASZ_COREF       PAEIRTQNIDSEIATTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPDEDGAER
MASZ_CORGL       AAEIRTQNVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEK
MASZ_BACHD       HVTITTENVDDEIAAQAGPQLVVPVNNARYAINAANARWGSLYDALYGSNVISEEDGCEK
MASZ_ECOLI       RVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQE--GAM
MASZ_SHIFL       RVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQE--GAM
MASZ_ECOL6       HVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQE--GAM
MASZ2_PSESM      HVAATTANVDLEISEQAGPQLVVPASNARYALNAANARWGSLYDALYGTDVISTSNGAEI
                      * .:* **   .*******  ***:*:**:**********:**:: *.       

MASZ_RHILV       GKSYNPKRGEKVIAWVRDFLDTSAPLQDCRWKDVGSFAVKDGALVVRSIDGEQAMLTDGK
MASZ_RHIME       GKGYNPKRGAKVIAWAREFLDASAPLAAGRWSDAKSFSVEGATLTVTLADGTKSAPRNSV
MASZ_AGRFC       GRGYNPKRGDKVIAWARNFLDESAPLETGSWSDVTGFNIADGLLQLAIGAAT-TGLKDAV
MASZ_RHILO       GKGFNPARGAKVIAWAKDFLDQSVPLTSGKWAGVNGLSVAHGALKLGAGAGG-TTLADPR
MASZ_BRUME       GKGYNPKRGEKVIAWAKNFLDESAPLSTGKWADVAGLAVNDGKLEIRLTDGSATTLKDES
MASZ_BRUSU       GKGYNPKRGEKVIAWAKNFLDESAPLSTGKWADVAGLAVNDGKLEIRLTDGSATTLKDES
MASZ_BRADU       GKGYNKARGDKVIAKAKAFLDAAVPLATGSHTDVTAYSIVAGQLAVKLKSGNATALKNAA
MASZ_MYCLE       GSEYNKIRGDKVIAYARKFMDQAVPLASDSWTNATGVSIFDGQLQIAIGTNS-TGLASPE
MASZ_MYCTU       GPTYNKVRGDKVIAYARKFLDDSVPLSSGSFGDATGFTVQDGQLVVALPDKS-TGLANPG
MASZ_PSEAE       GKGYNKVRGDKVIAFARAFLDEAAPLESGSHVDATSYSVKNGALVVALKNGSETGLKNAG
MASZ_PSEPK       GQGYNKVRGDKVIAFARAFLDEAAPLAAGSHVDSTGYRIEGGKLVVALKGGSNTGLRDDA
MASZ_PSEFL       GKGYNKVRGDKVIAFARAFLDEAAPLSAGSHVDSTGYKIADGKLIVSLKGGSNSGLRDDA
MASZ1_PSESM      GKGYNKVRGDKVIAFARAFLDQAAPLAAGSHVDSTAYKLIDGRLVISLKGGSNTGLRDDA
MASZ_RHOFA       GTSYNKVRGDKVIAFARDFLDEALPLSSGSHVGTTGYVVDAASLTVTLADGSTVGLKDPS
MASZ_COREF       GAEYNPVRGQKVIQWGRDFLDAVLPLDGASHADVEKYNITDGKLAAHVNDGI-YRLKDRD
MASZ_CORGL       GKEYNPVRGQKVIEWGREFLDSVVPLDGASHADVEKYNITDGKLAAHIGDSV-YRLKNRE
MASZ_BACHD       TGTYNPKRGTKVIQFAKDFLDHTFPLTSGSHHEAINYAIMDKQLVVTLESGKMTRLKDET
MASZ_ECOLI       VSGYDPQRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPA
MASZ_SHIFL       VSGYDPQRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPA
MASZ_ECOL6       VSGYDPQRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPA
MASZ2_PSESM      RAGYNPLRGAKVIAFARELLDTSAPLANGSHSDANRYRIEDGELRITLADGSQTLLQHPE
                    ::  ** :**   : ::*   **            :    *                

MASZ_RHILV       HFAGYRGDAAAP-THILLKNNGIHIEIVIDAATTIGKADSAHISDVWLESAITTIMDCED
MASZ_RHIME       QFAGYAGDPAAP-SEIVLRRNGLHIVIVLDATTPIGKADAAGISDVVLESAITTIMDCED
MASZ_AGRFC       QFKGFSGEAAKP-ATILLGKNGLHTEIVIDPSTEIGKSDRAGISDVILESALTTIMDCED
MASZ_RHILO       QFAGYRGDAANP-DAVLLVKNGLHIEIVVDRNNQIGRTDPAGIADVILESALTTIQDCED
MASZ_BRUME       QFKGYNGDAASP-TNVLLAKHNMHVDIVINADHPIGKTDPAHIADVVLESAISTIQDCED
MASZ_BRUSU       QFKGYNGDAASP-TNVLLAKHNMHVDIVINADHPIGKTDPAHIADVVLESAISTIQDCED
MASZ_BRADU       QFAGFQGDAAAP-SAVLLVNNGLHVEVTINRNSAIGKDDPAGVADMVMEAAVSTILDMED
MASZ_MYCLE       KFVGYNRQLRSSNWSVLLANHGLHIEVLIDPESPIGKTDPVGIKDVILESAITTIMDFED
MASZ_MYCTU       QFAGYTGAAESP-TSVLLINHGLHIEILIDPESQVGTTDRAGVKDVILESAITTIMDFED
MASZ_PSEAE       QFLAFQGDAAKP-QAVLLKHNGLHFEIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCED
MASZ_PSEPK       QLIGFHGDAAAP-TAVLLKHNGLHFEIQVDASTPVGSTDAAGVKDILMESALTTIMDCED
MASZ_PSEFL       QLIGFQGPAAQP-IAILLKHNGLHFEIQIDASTPVGQTDAAGVKDVLMEAALTTIMDCED
MASZ1_PSESM      QLVGFQGDASAP-FAVLFKHNGLHFELQIDAASPVGQTDPAGVKDIVMEAALTTIMDCED
MASZ_RHOFA       QLLGYQGTPDAP-TAILFVHNGLHFEIQIDPESPIGKTDGAGVKDVLLESAVTTIMDFED
MASZ_COREF       AYLGFTGYFEDP-TSILLQNNGLHIELQIDPTHPIGKEDKTGLKDIILESAITTIMDFED
MASZ_CORGL       SYRGFTGNFLDP-EAILLETNGLHIELQIDPVHPIGKADKTGLKDIVLESAITTIMDFED
MASZ_BACHD       QFVGYQGSQGDP-SVILLLHHGLHVEIQIDARHPIGKSDRAKVKDIVLESALTTIMDCED
MASZ_ECOLI       QFVGYRGDAAAP-TCILLKNNGLHIELQIDANGRIGKDDPAHINDVIVEAAISTILDCED
MASZ_SHIFL       QFVGYRGDAAAP-TCILLKNNGLHIELQIDANGRIGKDDPAHINDVIVEAAISTILDCED
MASZ_ECOL6       QFVGYRGDTAAP-TCILLKNNGLHIELQIDANGRIGKDDSAHINDVIVEAAISTILDCED
MASZ2_PSESM      KYVGFTGEPDQP-QAILLKNHGLHIEIQFDPQHPVGKTDAAGIKDLLLESALSTIVDCED
                    .:      .   :::  :.:*  : .:    :*  * . : *: :*:*::** * **

MASZ_RHILV       SIAAVDAEDKVVVYRNWLGLMKGDLQEEVAKGGTSFIRTLNPDLQYAGPDG-AAFEVHRR
MASZ_RHIME       SIAAVDAEDKVLVYRNWLGLMKGDLEEEVTKGGRAFTRRLNPDRAYTAPDG-ATLTLPGR
MASZ_AGRFC       SVAAVDAEDKVLVYGNWLGLMRGDLTEAVSKGGNTFTRRLNPDRYYTAPDG-SALTLPGR
MASZ_RHILO       SVAAVDAQDKVVVYRNWLGLMKGDLAEEISKAGRSFVRKLNADRAYTAPAG-GQITVPGR
MASZ_BRUME       SIAAVDAEDKVAVYRNWLGLMNGKLEDTFEKNGKQMTRRLNGDRTYTAPDG-STLTLKGR
MASZ_BRUSU       SIAAVDAEDKVAVYRNWLGLMNGKLEDTFEKNGKQMTRRLNGDRTYTAPDG-STLTLKGH
MASZ_BRADU       SVAAVDAEDKVLVYRNTLGLMNGTLSADFEKGGKTLTRSLNADRSYKTPDGKGEVKLHGR
MASZ_MYCLE       SVTAVDADDKVRGYRNWLGLNKGDLTEEVNKDGKTFTRVLNADRSYTTPDG-GELTLPGR
MASZ_MYCTU       SVAAVDAADKVLGYRNWLGLNKGDLAAAVDKDGTAFLRVLNRDRNYTAPGG-GQFTLPGR
MASZ_PSEAE       SVAAVDADDKVVIYRNWLGLMKGDLAEEVSKGGSTFTRTMNPDRVYTRADG-SELTLHGR
MASZ_PSEPK       SVAAVDADDKVIVYRNWLGLMKGDLAESVSKGGKTFTRTMNPDREYAAPNG-GSVTLHGR
MASZ_PSEFL       SVAAVDADDKVVIYRNWLGLMKGDLAEEVAKGGKTFTRTMNPDRVYTGVDG-QDVTLHGR
MASZ1_PSESM      SIAAVDADDKVVVYRNWLGLMKGDLVESVSKGGETFTRTMNPDRVYTTPQG-GEVTLHGR
MASZ_RHOFA       SVAAVDADDKVLGYRNWLGLMKGDLTEEVSKGGKTFTRAMNKDRTYTSVDG-SELTLHGR
MASZ_COREF       SVAAVDAEDKTLGYRNWFLLNTGELTEEVAKGDRTFTRKLNDDRVFIGKNG-AELTLHGR
MASZ_CORGL       SVAAVDAEDKTLGYSNWFGLNTGELKEEMSKNGRIFTRELNKDRVYIGRNG-TELVLHGR
MASZ_BACHD       SVAAVDAEDKVAVYQNWLGLMKGTLEATFTKEGKTKKRKLNEDRSYTAPNG-ETFSLPGR
MASZ_ECOLI       SVAAVDAEDKILLYRNLLGLMQGTLQEKMEKNGRQIVRKLNDDRHYTAADG-SEISLHGR
MASZ_SHIFL       SVAAVDAEDKILLYRNLLGLMQGTLQEKMEKNGRQIVRKLNDDRQYTAADG-SEISLHGR
MASZ_ECOL6       SVAAVDAEDKILLYRNLLGLMQGTLQEKMEKNGRQIVRKLNDDRQYTAADG-SEISLHGR
MASZ2_PSESM      SVAAVDADDKVLVYRNWLGLMKGDLTETLDKGGKAITRSLNPDRVYHAAAG-GELTLRGR
                 *::**** **   * * : *  * *   . * .    * :* *  :    *   . :  :

MASZ_RHILV       SLMLVRNVGHLMTNPAILDRDGN----EVPEGIMDAAITGLIALYDIGP---SGRRKNSR
MASZ_RHIME       SLMLVRNVGHLMTNPAVLDRDGE----EVPEGLMDAMVTALIALHDIGR---NGRRANSR
MASZ_AGRFC       SLMLVRNVGHLMTNPAILDRDGR----DVPEGIMDAVVTALIALYDVGP---SGRRQNSR
MASZ_RHILO       SLMLVRNVGHLMTNPAILDRDGN----EVPEGIMDAALTALIALHDVGP---EGRRANSR
MASZ_BRUME       SLMLVRNVGHLMTNPAILDAEGN----EVPEGIMDAAFTSLIALHDIGP---NGRHMNSR
MASZ_BRUSU       SLMLVRNVGHLMTNPAILDAEGN----EVPEGIMDAAFTSLIALHDIGP---NGRHMNSR
MASZ_BRADU       SLLLMRNCGHHMFTDAVLDERGE----EVPEGLLDAAVSGLLAIHDLKG---NSKVKNSR
MASZ_MYCLE       SLLFVRNVGHLTTSDAILVDGGDGQEKEVFEGIIDAVFTGLAAIHGLKTGEANGPLTNSR
MASZ_MYCTU       SLMFVRNVGHLMTNDAIVDTDGS----EVFEGIMDALFTGLIAIHGLKASDVNGPLINSR
MASZ_PSEAE       SLLFVRNVGHLMTNDAILDKDGN----EVPEGIQDGLFTSLIAIHDLNG---NTSRKNSR
MASZ_PSEPK       SLLFVRNVGHLMTNPAILDAQGN----EIPEGIQDGLFTNLIALHNLNG---NTSRKNTR
MASZ_PSEFL       SLLFVRNVGHLMTIDAILDKAGN----EVPEGILDGLLTSLAAIHSLNG---NSSRKNSR
MASZ1_PSESM      SLLFIRNVGHLMTIDAILDKHGN----EVPEGILDGLLTSLAAIHNLNG---NNTRSNSR
MASZ_RHOFA       SLLFVRNVGHLMTSDAILDADGN----EVPEGILDALFTSLAGLHSLTP---DNVLSNSR
MASZ_COREF       SLLFVRNVGHLMTNPAILVD-GE----EIYEGIMDAIITTVCAIPGIAP---QNKKKNSR
MASZ_CORGL       SLLFVRNVGHLMQNPSILID-GE----EIFEGIMDAVLTTVCAIPGIAP---QNKMRNSR
MASZ_BACHD       SLMFVRNVGHLMTTPVIRTQSGE----EVPEGILDGIVTSLIAKHDLLQ---NGTFRNSK
MASZ_ECOLI       SLLFIRNVGHLMTIPVIWDSEGN----EIPEGILDGVMTGAIALYDLKV---QK---NSR
MASZ_SHIFL       SLLFIRNVGHLMTIPVIWDSEGN----EIPEGILDGVMTGAIALYDLKV---QK---NSR
MASZ_ECOL6       SLLFIRNVGHLMTIPVIWDSEGN----EIPEGILDGVMTGAIALYDLKV---QK---NSR
MASZ2_PSESM      SLLLIRNVGHLMSNPAIVDQDDK----EIPEGILDGVITSLIGLHDLTR---HG---NSR
                 **:::** **      :    .     :: **: *. .:   .  .:          *::

MASZ_RHILV       TGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGLPRNTIKMGIMDEERRTTVNLKECIRAA
MASZ_RHIME       SGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPANAMKMGIMDEERRTTVNLKECIRAA
MASZ_AGRFC       AGSMYVVKPKMHGPEEVAFANEIFARVENLVGMAPNTMKMGIMDEERRTTVNLKESIRAA
MASZ_RHILO       AGSMYVVKPKMHGPEEVAFAVEIFDRVEALLGMPRNTIKMGIMDEERRTTVNLKEAIRAA
MASZ_BRUME       EGSVYIVKPKMHGPEEVAFANEIFTRTEEMLGMKPNTLKIGIMDEERRTTVNLKEAIRAA
MASZ_BRUSU       EGSVYIVKPKMHGPEEVAFANEIFTRTEEMLGMKPNTLKIGIMDEERRTTVNLKEAIRAA
MASZ_BRADU       TGSAYIVKPKMHGPDEVSFTCEIFDRVEKMLGLPENTLKVGIMDEERRTTVNLKACIQRA
MASZ_MYCLE       TGSIYIVKPKMHGPAEVAFTCELFSRVEDVLGLPQGTLKVGIMDEERRTTLNLKACIKAA
MASZ_MYCTU       TGSIYIVKPKMHGPAEVAFTCELFSRVEDVLGLPQNTMKIGIMDEERRTTVNLKACIKAA
MASZ_PSEAE       TGSVYIVKPKMHGPEEAAFTNELFGRVEDVLGLPRNTLKVGIMDEERRTTVNLKACIKAA
MASZ_PSEPK       SGSVYIVKPKMHGPEEVAFATEIFSQVEDLLGMPRNTVKVGIMDEERRTTVNLKSCIKAA
MASZ_PSEFL       TGSVYIVKPKMHGPEEAAFTNELFGRIEDVLNLPRNTLKVGIMDEERRTTVNLKACIKAA
MASZ1_PSESM      SGSMYIVKPKMHGPQEAAFTNELFGRIEQVLGLPRNTLKVGIMDEERRTTVNLKACIQAA
MASZ_RHOFA       TGSLYIVKPKMHGPDEVAFTAELFGRVEQVLGLPTNTLKVGIMDEERRTTVNLKACIQAA
MASZ_COREF       KGSIYIVKPKQHGPEEVAFTNELFARVEDLLDLPRHTLKVGVMDEERRTSVNLDACIMEV
MASZ_CORGL       KGSIYIVKPKQHGPEEVAFTNELFGRVEDLLDLPRHTLKVGVMDEERRTSVNLDASIMEV
MASZ_BACHD       KGSVYIVKPKMHGSEEVAFANRLFNRIEDILGLERHTLKIGVMDEERRTSLNLKACIEKV
MASZ_ECOLI       TGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQA
MASZ_SHIFL       TGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQA
MASZ_ECOL6       TGSVYIVKPKMHGPQEVAFANKLFSRVETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQA
MASZ2_PSESM      AGSIYIVKPKMHGAAEVAFADQLFSRIEDVLHLPRNTLKMGIMDEERRTSVNLKACINAA
                  ** *:**** **. *.:*: .:* : *  : :   ::*:*:*******::**  .*  .

MASZ_RHILV       RERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMRQAAWISAYENWNVDIGLECGLAGHA
MASZ_RHIME       RERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQAPWISAYENWNVDVGLECGLSGHA
MASZ_AGRFC       KDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQAAWIAAYENWNVDIGLECGLSGHA
MASZ_RHILO       RERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQAAWISAYEAWNVDTGLECGLAGHA
MASZ_BRUME       KDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQAAWIGAYEQWNVDIGLECGLSGHA
MASZ_BRUSU       KDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQAAWIGAYEQWNVDIGLECGLSGHA
MASZ_BRADU       SKRIMFINTGFLDRTGDEIHTSMEAGPMIRKNEMKAQAWIKAYEDWNVDMGLIDGLPGHA
MASZ_MYCLE       ADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKNSTWIKAYEDANVDIGLAAGFKGKA
MASZ_MYCTU       ADRVVFINTGFLDRTGDEIHTSMEAGPMVRKGTMKSQPWILAYEDHNVDAGLAAGFSGRA
MASZ_PSEAE       KDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGAMKSEKWIGAYENNNVDVGLATGLQGKA
MASZ_PSEPK       AERVVFINTGFLDRTGDEIHTSMEAGAVVRKGAMKNEKWIGAYENNNVDVGLATGLQGRA
MASZ_PSEFL       SERVVFINTGFLDRTGDEIHTSMEAGAMVRKAAMKTEKWIGAYENWNVDIGLSTGLQGRA
MASZ1_PSESM      SERVVFINTGFLDRTGDEIHTSMEAGPVVRKAQMKAEKWISAYENSNVDIGLKCGLQGRA
MASZ_RHOFA       SERVVFINTGFLDRTGDEIHTSMEAGPVVRKGAMKGEKWIAAYEDFNVDTGLAAGLQGKA
MASZ_COREF       ADRLAFINTGFLDRTGDEIHTSMEAGAMVRKADMQTAPWKQAYEDNNVDAGIQRGLPGKA
MASZ_CORGL       ADRLAFINTGFLDRTGDEIHTSMEAGAMVRKADMQTAPWKQAYENNNVDAGIQRGLPGKA
MASZ_BACHD       KERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKSSSWLSAYERSNVAAGLTCGFQGRA
MASZ_ECOLI       RNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTPWIKAYERNNVLSGLFCGLRGKA
MASZ_SHIFL       RNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTPWIKAYERNNVLSGLFCGLRGKA
MASZ_ECOL6       RNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTPWIKAYERNNVLSGLFCGLRGKA
MASZ2_PSESM      SARVAFINTGFLDRTGDEIHSAMQAGPVLRKGEMKNTPWIKAYERNNVQVGLACGLRGRA
                   *: *************:*: *:**.::**  *:   *  ***  **  *:  *: *:*

MASZ_RHILV       QIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHRVNVARVQQGLK-
MASZ_RHIME       QIGKGMWAMPDLMAAMLEQKIVHPKAGANTAWVPSPTAATLHATHYHRVNVAEVQASLK-
MASZ_AGRFC       QIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKVDVAAVQEGLK-
MASZ_RHILO       QIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKVDVHAVQAALK-
MASZ_BRUME       QIGKGMWAMPDMMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKIDVAAVQEKLK-
MASZ_BRUSU       QIGKGMWAMPDMMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKIDVAAVQEKLK-
MASZ_BRADU       QIGKGMWAAPDKMADMLAQKLAHPQAGATTAWVPSPTAATLHALHYHQVNVIARQEELTK
MASZ_MYCLE       QIGKGMWAMTELMADMVEQKIGQPKAGATTAWVPSPTAATLHAMHYHQVDVAAVQQELT-
MASZ_MYCTU       QVGKGMWTMTELMADMVETKIAQPRAGASTAWVPSPTAATLHALHYHQVDVAAVQQGLA-
MASZ_PSEAE       QIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWVPSPTAATLHALHYHKVDVFARQAELA-
MASZ_PSEPK       QIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWVPSPTAATLHALHYHKVDVQARQRELA-
MASZ_PSEFL       QIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWVPSPTAAALHALHYHKVDVFARQAELA-
MASZ1_PSESM      QIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWVPSPTAAALHALHYHKVDVFARQAELA-
MASZ_RHOFA       QIGKGMWAMPDLMHDMLEQKIGHPKAGANTAWVPSPTAATLHALHYHKVDVFARQHEIA-
MASZ_COREF       QIGKGMWAMTELMGEMLEKKIGQLREGANTAWVPSPTGATLHATHYHRVDVFKVQDELRA
MASZ_CORGL       QIGKGMWAMTELMAEMLEKKIGQPREGANTAWVPSPTGATLHATHYHLVDVFKVQDELRA
MASZ_BACHD       QIGKGMWAMPDLMNEMMEQKGTQLEAGANTAWVPSPTAATLHAIHYHRHHVPAIQKTLA-
MASZ_ECOLI       QIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQANIAQ
MASZ_SHIFL       QIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHHTNVQSVQANIAQ
MASZ_ECOL6       QIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQANIAQ
MASZ2_PSESM      QIGKGMWAMPDRMADMLEQKIAHPKSGATTAWVPSPTAATLHAWHYHHVDVRQVQEQLEQ
                 *:*****: .: *  *   *  :   **.********.*:*** ***  .*   *  :  

MASZ_RHILV       ----DRARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQGILGYVVRWVDQGVGCSKVPD
MASZ_RHIME       ----SRTRAKLADILSVPVAARPNWTEEEIQRELDNNAQGILGYVVRWVDQGVGCSKVPD
MASZ_AGRFC       ----SRGRAKLSDILSVPVAPRPNWTPEEIQRELDNNAQGILGYVVRWVDQGVGCSKVPD
MASZ_RHILO       ----SRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQGILGYVVRWIDQGVGCSKVPD
MASZ_BRUME       ----SRPRAKLDDILSVPVAVRPNWTPDDIQHEIDNNAQGILGYVVRWIDQGVGCSKVPD
MASZ_BRUSU       ----SRPRAKLDDILSVPVAVRPNWTPDDIQHEIDNNAQGILGYVVRWIDQGVGCSKVPD
MASZ_BRADU       ----GGPRAKLSDILTIPVS-KSNWAPDDVKQEIDNNCQGILGYVVRWIDQGVGCSKVPD
MASZ_MYCLE       ----GQRRATVDQLLTIPLAKKLAWAPEEIREEVDNDCQSILGYVVRWVDQGIGCSKVPD
MASZ_MYCTU       ----GKRRATIEQLLTIPLAKELAWAPDEIREEVDNNCQSILGYVVRWVDQGVGCSKVPD
MASZ_PSEAE       ----KRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNAQGILGYVVRWIDQGVGCSKVPD
MASZ_PSEPK       ----SRTPASVDDILAIPLAADTNWSAEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPD
MASZ_PSEFL       ----KRERASVDDILTIPLAKNTDWSEEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPD
MASZ1_PSESM      ----QREQASVDDILTIPLALNTDWTPEQVQNELDNNAQGILGYVVRWIDQGVGCSKVPD
MASZ_RHOFA       ----KAKRATVDEILEIPLAPSTDWTDEEKQNELDNNSQSILGYVVRWIDHGVGCSKVPD
MASZ_COREF       ----AGRRDSLGKILDVPVAPDTNWTDAEKREELDNNCQSILGYVVRWVEQGVGCSKVPD
MASZ_CORGL       ----AGRRDSLRNILTIPTAPNTNWSEEEKKEEMDNNCQSILGYVVRWVEHGVGCSKVPD
MASZ_BACHD       ----DDQTCYRKEILEIPLAGSTDWTNEDIQAELNNNAQGILGYVVRWVEQGIGCSKVPD
MASZ_ECOLI       TEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPD
MASZ_SHIFL       TEFSAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPD
MASZ_ECOL6       TEFNAEFEPLLDDLLTIPVAENANWSVEEIQQELDNNVQGILGYVVRWVEQGIGCSKVPD
MASZ2_PSESM      QSLVDVSDQWLDDLLTIPVVGKPEWTREQILEELENNTQGLLGYVVRWVEQGIGCSKVPD
                             .:* :*      *:  :   *::*: *.:*******:::*:*******

MASZ_RHILV       INNVGLMEDRATLRISAQHMANWLHHKVVTEAQIIETMRRMAAVVDRQNASDPAYRPMAG
MASZ_RHIME       INNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMQRMAAIVDGQNAGDPNYQPMAG
MASZ_AGRFC       INNIGLMEDRATLRISAQHMANWLRHGVVTEAQIIKTMKRMAAVVDTQNAGDPAYLPMAS
MASZ_RHILO       INDVGLMEDRATLRISSQHIANWLRHKVCSEIQVRDSLQRMAAIVDRQNVGDPLYRPMAP
MASZ_BRUME       INNVGLMEDRATLRISAQHIANWLYHGVVSEAQVMETMKRMAAIVDKQNEGDPLYRPMAA
MASZ_BRUSU       INNVGLMEDRATLRISAQHIANWLYHGVVSEAQVMETMKRMAAIVDKQNEGDPLYRPMAA
MASZ_BRADU       IHDVGLMEDRATLRISSQHLANWLHQGVITEAQVMESLKRMAVVVDKQNAGDAIYKPMAP
MASZ_MYCLE       IHNVALMEDRATLRISSQLLANWLRHGVITSEDVRASLERMAPLVDQQNAEDPAYRPMAP
MASZ_MYCTU       IHDVALMEDRATLRISSQLLANWLRHGVITSADVRASLERMAPLVDRQNAGDVAYRPMAP
MASZ_PSEAE       INDVGLMEDRATLRISSQLLANWLRHGVISQEQVVESLKRMAVVVDRQNASDPSYRPMAP
MASZ_PSEPK       INNVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESLKRMAVVVDQQNAGDPLYRPMAP
MASZ_PSEFL       INDVGLMEDRATLRISSQHIANWLRHGVVTQDQVMESLKRMAPVVDRQNAGDALYRPLAP
MASZ1_PSESM      INDIGLMEDRATLRISSQHMTNWLRHGIVTETQVLESLKRMAPVVDRQNANDPLYRPLSP
MASZ_RHOFA       INDIALMEDRATLRISSQFIANWLRHGIVTEEQVRESLKRMAPVVDRQNASDPTYKPLAP
MASZ_COREF       IHDIDLMEDRATLRISSQILANWLRHGVVTEEQVIESLERMAVVVDEQNAGDPNYLNMAP
MASZ_CORGL       IHDIDLMEDRATLRISSQMLANWIRHDVVSKEQVLESLERMAVVVDKQNAGDEAYRDMAP
MASZ_BACHD       IHNTALMEDRATLRISSQHMANWLRHGIVSKEQVIRTMERMAKVVDEQNAGDPAYRPMAD
MASZ_ECOLI       IHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASLENMAKVVDQQNAGDPAYRPMAG
MASZ_SHIFL       IHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASLENMAKVVDQQNAGDPAYRPMAG
MASZ_ECOL6       IHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASLENMAKVVDQQNAGDPAYRPMAG
MASZ2_PSESM      IHNVGLMEDRATLRISSQHMANWLLHDIAGKEDIQNVLERMAKVVDKQNAGDSHYRPMTR
                 *::  ***********:* ::**: : :  . ::   :..** :** **  *  *  :: 

MASZ_RHILV       NFDDSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAKQAA--------------
MASZ_RHIME       RFEESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAKQGA--------------
MASZ_AGRFC       DFDGSVAFQAAVELVLKGREQPNGYTEPVLHRRRLELKAKQAG--------------
MASZ_RHILO       DFDKSIAFQAACDLVFKGTSQPNGYTEPVLHARRLELKAQR----------------
MASZ_BRUME       DFDKSIAFQAACDLVFKGREQPNGYTEPVLHRRRLELKQAS----------------
MASZ_BRUSU       DFDKSIAFQAACDLVFKGREQPNGYTEPVLHRRRLELKQAS----------------
MASZ_BRADU       AFD-GVAFKAACDLIFKGREQPNGYTEYILTARRREAKAAG----------------
MASZ_MYCLE       NFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRREFKAQNR---------------
MASZ_MYCTU       NFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRREFKARAAEKPAPSDRAGDDAAR
MASZ_PSEAE       NFDDNVAFQAALELVVEGTRQPNGYTEPVLHRRRREFKAKNGL--------------
MASZ_PSEPK       NFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFKARNGL--------------
MASZ_PSEFL       DFDSNIAFQAAVELVIEGTKQPNGYTEPVLHRKRREFKAKNGL--------------
MASZ1_PSESM      DFDSNIAFQAAVELVIEGTRQPNGYTEPVLHRRRREFKAKNRV--------------
MASZ_RHOFA       DFDTNIAFQAASDLIFQGTSQPNGYTEPILHRRRREYKAVNA---------------
MASZ_COREF       NFTESVAFQAARDLILKGTESPAGYTEPILHARRREFKELHGIK-------------
MASZ_CORGL       NYDASLAFQAAKDLIFEGTKSPSGYTEPILHARRREFKAKN----------------
MASZ_BACHD       NLEQSVAFQAALELVLKGTEQPSGYTEPILHRRRLEFKQKIAKELV-----------
MASZ_ECOLI       NFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREKESH----------------
MASZ_SHIFL       NFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREKESH----------------
MASZ_ECOL6       NFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREKESH----------------
MASZ2_PSESM      DFKNSAAFKAACALVFKGTEQPSGYTEPLLHESRLAFKDAH----------------
                     . ** **  *:. *  .* **** :*   *   *