CLUSTAL format seed alignment for MF_00642

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBE_MARPO      --MSG-NTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_ADICA      --MSG-NTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFS
PSBE_PHYPA      --MSG-NTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_NYMAL      --MSG-STGERAFADIITSIRYWVIHSITIPSLFIAGWSFVSTGLAYDVFGSPRPNEYFT
PSBE_PHAAO      --MSG-STGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_CUSGR      --MSG-NTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_PANGI      --MSG-NTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_PINTH      --MSG-NTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_GINBI      --MSG-NTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_STAPU      --MSG-NTGERPFGDIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_ZYGCR      --MSG-NTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_CHAGL      --MSG-NTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_TUPAK      --MAG-TTGERPFSDILTSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_CHLRE      --MAG-KPVERPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_CHLVU      --MSG-ATGERPFSDILTSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_BIGNA      --MAG-TTGERPFSDILTSIRYWIIHSITVPSLFIAGWLFVSTGLAYDVFGSPRPNEYFS
PSBE_EUGGR      --MAG-STGERPFSDIITSIRYWVIHSVTIPSLFVGGWIFVSTGIVYDIFGTPRPSEYFT
PSBE_MESVI      --MAG-STEERPFSDIITSIRYWVIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_NEPOL      --MSG-STGERPFSDILTSIRYWVIHSITIPSLFVAGWLFVSTGLAYDVFGSPRPNEYFT
PSBE_SYNJA      --MAG-NTGERPFVDIITSVRYWVIHALTIPALFLAGWLFVSTGLAYDIFGTPRPNEYFT
PSBE_SYNJB      --MAG-STGERPFVDIITSVRYWVIHALTIPALFLAGWLFVSTGLAYDIFGTPRPNEYFT
PSBE_EMIHU      --MSGGSTGERPFSDIITSIRYWIIHSITIPSLFVAGFLFVSTGLAYDAFGTPRPNEYFT
PSBE_TRICV      --MSGGSTGERPFSDIITSVRYWIIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_GUITH      --MSGGSTGERPFSDIITSIRYWIIHSITIPALFVAGWLFVSTGLAYDIFGTPRPNEYFT
PSBE_GRATL      --MSGGSTGERPFSDIITSIRYWVIHSITIPSLFVAGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_PORPU      --MSGGSTGERPFSDIITSVRYWVIHSITIPALFVAGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_CYAM1      --MAGGSTGERPFSDIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFT
PSBE_CYACA      --MSGGSTGERPFSDIITSVRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFS
PSBE_CYAPA      --MSGGTTGERPFSDIVTSIRYWVIHTVTIPSLFVAGWLFVSTGLAYDVFGTPRPDEYFT
PSBE_SYNP2      --MAG-STGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDTFGTPRPDQYFT
PSBE_SYNY3      --MSG-TTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYFT
PSBE_NOSS1      --MSG-TTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDEYYT
PSBE_THEVL      --MAG-TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYA
PSBE_SYNE7      --MAGGSTGERPFTDIITSIRYWVIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYFT
PSBE_PROMA      --MAAGSTGERPFFEIITSVRYWIIHAVTLPAIFIAGFLFVSTGLAYDAFGTPRPDTYFQ
PSBE_PROMT      --MAAGSTGERPFFEIITSVRYWIIHAVALPAIFVAGFLFVSSGLAYDAFGTPRPDTYFQ
PSBE_PROMP      MIMAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAYDAFGTPRPDSYFQ
PSBE_SYNPX      --MAAGSTGERPFFEIITSIRYWVIHFVTLPSIFLAGFLFVSTGLAYDAFGTPRPDAYFQ
PSBE_SYNSC      --MAAGSTGERPFFEIITSIRYWVIHAVTLPSIFLAGFLFVSTGLAYDAFGTPRPDAYFQ
PSBE_SYNS9      --MAAGSTGERPFFEIITSIRYWVIHAVTLPSIFLAGFLFVNTGLAYDAFGTPRPDAYFQ
PSBE_PROMM      --MAAGSTGERPFFEIVTSIRYWVIHAVTLPSIFLAGYLFVSTGLAYDTFGTPRPDAYFQ
PSBE_GLOVI      --MSSRSTGERPFTDIITSTRYWIIHIPAITILFASGFLFVYTGLAYDVFGTPRPDEYYN
                  *:.  . **.* :*:** ***:**  ::. :* .*: ** :*:.** **:***. *: 

PSBE_MARPO      ENRQEVPLITGRFNSLEQIDEFTKSF-
PSBE_ADICA      ESRQEVPLITGRFDSLEQVDAFTKSF-
PSBE_PHYPA      ESRQEVPLITGRFNSLEQVDEFTRSF-
PSBE_NYMAL      ESRQGIPLITGRFDSLEQLDEFSRSF-
PSBE_PHAAO      ESRQGIPLITGRFDSLEQLDKFSNPF-
PSBE_CUSGR      ENQQGIPLITGRFEPLEEQNEFSRRSQ
PSBE_PANGI      ENRQGIPLITGRFDPLEQLDEFSRSF-
PSBE_PINTH      ESRQEVPLVTGRFDPLEQLDEFTRSF-
PSBE_GINBI      DSRQEVPLITGRFDSLEQLDEFTRSF-
PSBE_STAPU      ESRQEVPLITGRFNSLDQLDEFTRSL-
PSBE_ZYGCR      ESRQEIPLITGRFNSLEQLDEFTRAL-
PSBE_CHAGL      ADRQEVPLITGRFNSLEQLNEITKSL-
PSBE_TUPAK      EDRQEAPLITDRFNSLEQVKKLSNIR-
PSBE_CHLRE      EDRQEAPLITDRFNALEQVKKLSGN--
PSBE_CHLVU      EDRQETPLITDRFNALEQVKKFSEVN-
PSBE_BIGNA      NGQQEAPIVLDRFGKL-----------
PSBE_EUGGR      ETRQQAPLISDRFNALEQMDQFTK---
PSBE_MESVI      EDRQDIPLITDRFNALEQLNQYTK---
PSBE_NEPOL      EERQTTPLITDRFNALQQMDILTEGL-
PSBE_SYNJA      AERQELPIVSDRFNALEQLEKLTR---
PSBE_SYNJB      AERQELPIVSDRFNALEELERLTR---
PSBE_EMIHU      QDRQQIPLVNDRFSAKQELEDLTKGL-
PSBE_TRICV      QDRQQIPLVNDRFSAKQELEDLTKGL-
PSBE_GUITH      QERQQVPLVNDRFSAKQELEDLTKGL-
PSBE_GRATL      QDRQQVPLVNDRFSAKQELEDLTKGI-
PSBE_PORPU      QDRQQVPLVNDRFNAKQELEDLTKGI-
PSBE_CYAM1      QERTQIPLVNDRFNAKQELEDLL----
PSBE_CYACA      ENRQQVPLINDRFNAREELDDLTSNL-
PSBE_CYAPA      EERQEVPIINQRFSTN-----------
PSBE_SYNP2      ETRQEIPIVTDRYKAIDQINEFNN---
PSBE_SYNY3      QTRQELPILQERYDINQEIQEFNQ---
PSBE_NOSS1      QARQELPIVNNRFEAKKQVEQLIQK--
PSBE_THEVL      QEQRSIPLVTDRFEAKQQVETFLEQLK
PSBE_SYNE7      QDRTEVPIVSDRYSAKQQVDRFSAK--
PSBE_PROMA      ASETKAPVVSQRFESKAQLDLRLK---
PSBE_PROMT      AGESKAPVVVQRFDSKAELDTRLK---
PSBE_PROMP      ASESKAPVVTQRYDAKSQLDLRTK---
PSBE_SYNPX      ASESKAPVVSQRYEGKSELDVRLK---
PSBE_SYNSC      ASESKAPVVSQRYEGKSELDIRLK---
PSBE_SYNS9      ATDTKAPVVSQRYEGKAQLDVRLK---
PSBE_PROMM      ASESKAPVVSQRYEAKSQLDLRLQ---
PSBE_GLOVI      SDNTKKPLVNKRFEAKQQLDEATKNK-
                      *::  *: