CLUSTAL format seed alignment for MF_00643

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBF_ARATH      ------------MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR
PSBF_BETVU      ------------MTIDRTYPIFTVRWLAVHGLAIPTVSFLGSISAMQFIQR
PSBF_LOTJA      ------------MTIDRTFPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR
PSBF_PINTH      ------------MTIDRTYPIFTVRWLAVHGLAIPTVFFLGSISAMQFIQR
PSBF_MARPO      ------------MTIDRTYPIFTVRWLAVHGLAVPTVFFLGAISAMQFIQR
PSBF_ORYSA      ------------MTIDRTYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR
PSBF_NEPOL      ----------MTTNTQYIYPIFTVRWLAVHALAVPTVFFLGSISAMQFIQR
PSBF_GNEGN      ------------MTTEKIYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR
PSBF_CUSEU      ------------MTMDRTSPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR
PSBF_PINKO      ------------MTLDRTFPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR
PSBF_EPHSI      ------------MTIDRIYPIFTVRWLAIHGLAVPTVFFLGSISAMQFIQR
PSBF_PSINU      ------------MTLDRTYPIFTVRWLAIHGLAVPTVFFLGSISAMQFIQR
PSBF_WHEAT      ------------MTIDRTYPIFTVRWLAIHGLAVPTVFFLGSISAMQFIQR
PSBF_CHLMO      -------MTTRKSAEVITYPIFTVRWVSIHALAVPTIFFLGSITAMQFIQR
PSBF_CHLRE      -------MTTKKSAEVLVYPIFTVRWLAIHGIAVPTIFFLGAITAMQFIQR
PSBF_CHLVU      ----------MTARKSYTYPIFTVRWLAVHALAVPTVFFLGAITAMQFIQR
PSBF_MESVI      ----------MAAEKTIQYPIFTVRWLSVHALAVPTVFFLGAISAMQFIQR
PSBF_CYAPA      ---------MNNPNQPVSYPIFTVRWLAIHAIGIPAVFFIGSITAMQFIQR
PSBF_GLOVI      MTTSSNRPTPGGPTQPVSYPVFTVRWLAVHALTVPTIFFLGALAAMQFIQR
PSBF_SYNE7      -------MTSNNSNQPITYPIFTVRWLSVHALGVPSVFFLGAIAAMQFIQR
PSBF_NOSS1      ------MTSGNNINQPVTYPIFTVRWIAVHTLAVPTVFFLGAIASMQFIQR
PSBF_THEEB      ------MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
PSBF_THEVL      ------MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
PSBF_SYNP2      --------MTSGPNQPVSYPIFTVRWLAVHTLAVPSVFFLGAIAAMQFIQR
PSBF_SYNY3      -------MATQNPNQPVTYPIFTVRWLAVHTLAVPSVFFVGAIAAMQFIQR
PSBF_SYNPX      ------MSQTPVATTPRNYPIFTVRWLALHTLGVPTVFFLGALAAMQFIRR
PSBF_CYACA      --------MANKPLQPISYPIFTFRWLAIHGLAIPTVFFFGAITAMQFIQR
PSBF_CYAM1      -----------MKKQPINYPIFTFRWLAIHGLAVPTVFFFGAITAMQFIQR
PSBF_GUITH      ---------MSKIKQPISYPIFTFRWLAIHGLAVPTVFFLGAITSMQFIQR
PSBF_PORPU      -------MTKGNANQPVSYPIFTFRWLAIHGLAIPTVFFLGAITSMQFIQR
PSBF_TRICV      --------MTKNINQPVAYPIFTFRWLAIHGLAIPTVFFLGGITAMQFIQR
PSBF_EUGGR      ----------MTTNKDTRYPIFTFRWLAVHALAIPTVFFLGSISAMQFIQR
PSBF_PROMA      -MTNSS--SPLQAVEVRTYPIFTVRWLAVHALAIPTVFFLGAIAAMQFIRR
PSBF_PROMP      ---MSNSQAPMQAVEVRVYPIFTIRWLAVHALAIPSVFFLGAIAAMQFLR-
PSBF_PROMM      --MAQSSSAPLQALNVRVYPIFTVRWLAVHVLGVPTVFFLGAITAMQLIRR
                                   *:**.**:::* : :*:: *.*.:::**:::