CLUSTAL format seed alignment for MF_00644

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBZ_GUITH      ---MVTILQLLVSILILLSFALVVGVPVILVSPGEWERSKNLVYASAGLWFGLVIVTAAF
PSBZ_PORPU      ---MIIAIQLLVLLLITLSTILVVGVPVVLASPGQWEQSKGLIYTGAGLWTGLVIVTSLV
PSBZ_CYAPA      ---MLIAFQGAVFALVLLSFVLIVAVPVALASPGEWERSQRLIYAGAALWTSLIIVIGVL
PSBZ_CHLRE      ---MTSILQVALLALIFVSFALVVGVPVVFATPNGWTDNKGAVFSGLSLWLLLVFVVGIL
PSBZ_CHLVU      ---MLLIFQLALFAFIVVSFLLVVGVPVVLATPEGWAENKSTVFSGIGIWFLLVFLVGIL
PSBZ_NEPOL      ---MTFIFQLALFALVALSFLLVVGVPVAFAAPEGWNVTKGYVFQGVSAWFALVFTVGVL
PSBZ_ARATH      ---MTIAFQLAVFALIITSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGIL
PSBZ_PEA        ---MTIAFQLAVFALIVTSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGIL
PSBZ_LOTJA      ---MTIAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIALVFLVGIL
PSBZ_SPIOL      ---MTIAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNIVFSGTSLWLGLVFLVGIL
PSBZ_ATRBE      ---MTLAFQLAVFALIATSLILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGIL
PSBZ_TOBAC      ---MTLAFQLAVFALIATSLILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGIL
PSBZ_OENEH      ---MTIAFQLAVFALIATSSLLLISVPVVFASPEGWSSNKNVVFSGTSLWIGLVFLVGIL
PSBZ_ORYSA      ---MTIAFQLAVFALIVTSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAIL
PSBZ_WHEAT      ---MTIAFQLAVFALIATSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAIL
PSBZ_MAIZE      ---MNIAFQLAVFALIATSSVLVIRGHLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAIL
PSBZ_MARPO      ---MTIAFQLAVFALIAISFLLVIGVPVVLASPEGWSSNKNVVFSGASLWIGLVFLVGIL
PSBZ_PINTH      ---MTIAFQSAVFALIAISFLLVIGVPVALASPDGWSSSKNVVFSGVSLWIGSVLFVGIL
PSBZ_ANTAG      ---MTIAFQLAVFALIATSFLLVIGVPVVLASPDGWSSSKNAVFSGASLWIGLVFLVGIL
PSBZ_PSINU      ---MTIAFELSVFALITISFLLVIGVPVVLASPDGWSSSKNIVFSGASLWIGLVFLVGIL
PSBZ_CHAGL      ---MILAFQLSVFALVAISFLLVVGVPVVLASPDGWSTSKNAVFSGASLWIALVFLVGVL
PSBZ_MESVI      ---MLAAFQLTVLALIATSFLMVIGVPVIFASPEGWVKSKNFVFSGALLWISLVFAVGIL
PSBZ_NOSS1      ---MTIIFQFALVALVLVSFVLVVGVPVAYATPQNWVESKKLLWLGSGVWIALVLLVGLL
PSBZ_SYNY3      ---MSIVFQIALAALVLFSFVMVVGVPVAYASPQNWDRSKPLLYLGSGIWAILVIVVALL
PSBZ_THEEB      ---MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVL
PSBZ_EUGGR      MLLFTFTFQALVLALIIFSFILVLTLPVIFASPKGWENNKSRIWLACRFWFFLVFLIGIL
PSBZ_TRICV      ------MITALVALLVFISLGLVITVPVALATPGEWEASKSTFTRAFQAWVGLVIVIAAA
PSBZ_SKECO      ------MITALTALLVLISLALVVTVPVALATPGEWESSKDQFNKAFQLWVGLVVAIATA
                       :      ::  *  :::   :  .:*  *  .:  .  .   *   :.  .  

PSBZ_GUITH      NSFVI---
PSBZ_PORPU      NSLVV---
PSBZ_CYAPA      DSVVANQA
PSBZ_CHLRE      NSFVV---
PSBZ_CHLVU      NSFVV---
PSBZ_NEPOL      NSLVA---
PSBZ_ARATH      NSLIS---
PSBZ_PEA        NSLIS---
PSBZ_LOTJA      NSLIS---
PSBZ_SPIOL      NSLIS---
PSBZ_ATRBE      NSLIS---
PSBZ_TOBAC      NSLIS---
PSBZ_OENEH      NSLIS---
PSBZ_ORYSA      NSLIS---
PSBZ_WHEAT      NSLIS---
PSBZ_MAIZE      NSLIS---
PSBZ_MARPO      NSFIS---
PSBZ_PINTH      NSFIS---
PSBZ_ANTAG      NSFIS---
PSBZ_PSINU      NSLIS---
PSBZ_CHAGL      NSFIS---
PSBZ_MESVI      NSFVV---
PSBZ_NOSS1      NFFVV---
PSBZ_SYNY3      NFLVV---
PSBZ_THEEB      NFFVV---
PSBZ_EUGGR      DGIFL---
PSBZ_TRICV      DGISSAI-
PSBZ_SKECO      DGISSSI-
                : .