CLUSTAL format seed alignment for MF_00646

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EFPL_ECOLI        MPRANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDD
EFPL_CROS8        MPRANEIKKGMVLNYNGKLLIVKDIDIQSPSARGAATLYKMRFSDVRTGQKVEERFKGDD
EFPL_KLEP7        MPRANEIKKGMVLNYNGKLLIVKNIDIQSPSARGAATLYKMRFSDVRTGLKVEERFKGDD
EFPL_ENT38        MPRANEIKKGMVLNYNGKLLIVKDIDVQSPSARGAATLYKMRFADVRTGLKVEERFKGDD
EFPL_PECAS        MARANEIKRGMVVNYNDKLLLVKDIDVQSPSARGASTLYKMRFSDVRTGLKVEERFKGDD
EFPL_YERE8        MARANEIKRGMAVNLNGKLLLVKDIDVQSPSARGASTLYKMRFSDVRTGLKVEERFKGDE
EFPL_ERWT9        MPRANEIKKGMAVNLNGKLLLVKDIDVQSPSARGASTLYKMRFTDIRSGMKVEERFKGDE
EFPL_PHOLL        MAKANEIKRGSAVSYNGKLLLVKDIDIQAPSARGASTLYKMRFTDIRTGQKVEERFKGDD
EFPL_PROMH        MAKANEIKRGMAISYNNKLLLVKDIDIQAPSARGASTLYKMRFTDIRTGQKVEERFKGDD
EFPL_SERP5        MAKANEIKRGMAISYNGKLLLVRDIDVQSPSARGASTLYKMRFSDVRTGLKVEERFKGDD
EFPL_HAHCH        MPRASEIKKGEVVDLNGQLLIVKDIEVHSPSARGAATLYKMRFSNVRTGLKYEESFKGDD
EFPL_PSYIN        MPKASDIKKNTAIEYNNNVYIIRDIERSVPQGRAGGSLYRMRMYDVVSGSKIDQTFKDNE
EFPL_COLP3        MPKASDIKKNAAIEHNGKVLIVRDITRSVPQGRAGGSLYRMRLYDVVTGGKVDETFKAED
EFPL_MARMS        MPKASEIKKNIAISYDNKTYIVKDIERSVPQGRAGGSLYRMRMYDVVTGRKLDETFKDSD
EFPL_MARHV        MPKASEIKKNQAVEYEGRVYFVKDIERSVPQGRAGGSLYRMRMYDVVTNQKLDETFKDSD
EFPL_PSET1        MPKASEVKKGTAIDFNGRVLVVKDIVRSVPQGRAGGSLYRMRLYDVVTGSKVDETFKDSD
EFPL_ALIF1        MPKASDIKKGSAIEHNGKVFFVKEISKLTPSGRAGATLFRMRMYDVATGAKSDESFKADD
EFPL_ALISL        MPKASDIKKGSAIEHNGKVYFVKEITKLTPSGRAGATLFRMRMYDVATGSKADESFKTDE
EFPL_PHOPR        MPKASEIKKFAAIEHNGKVFLVKDIKKLTPSGRAGASLYRMRLYDVATGSKTDESFKADE
EFPL_PSEA6        MPKASEVKKNAAIEHNDKVYVVKDINKLTPSGRAGASLYRMRLYEVTTGAKADESFKADE
EFPL_SACD2        MPKASDIKKNQAIEHNGKVYLIKDVYKSTSQGRAGGSIYRVRMYEVATGLKVDESFKADE
EFPL_SHESH        MPKASEVKKNTAIEFNNNVYLIRDIERSVPQGRSGGSLYRMRMYDVATGSKLDHTFKADE
EFPL_VIBCB        MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGRGGAKIYKMRCTDLNTGARVDERYKSDD
EFPL_VIBPA        MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGRGGAKIYKMRCTDLTTGARVDERYKSDD
EFPL_VIBVY        MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGRGGSKIYKMRCTDLATGARVEERYKSDD
EFPL_VIBCM        MPKASELKKGFAIISNGKTLLIKDIEVTTPGGRGGSKIYKLRCTDLNTGARVDERYKSDD
EFPL_VIBA3        MPRASEIKKGFAINVDGKTVLVKDIEVTTPGGRGGQKIYRFRGHDVATGVKTEVRHKADE
EFPL_XANOP        -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRFIMYSVPGGVKTDASLDADD
EFPL_XANCB        -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRFIMYSVPGGAKLDASFDADD
EFPL_STRM5        -MKANDIKKGNVVEFNNGVYQIRDIERSSPQGRGGNVRFRFIMYSVPGGNKLDASFDADD
EFPL_XYLFT        -MKASEMKKGSIVEYSNGTYQIRDIQRSSPQGRGGNVRFRFVMYSVPGGSKLEASFDADE
EFPL_XYLFM        -MKASEMKKGSIVEYNNGTYQIRDIQRSSPQGRGGNVRFRFVMYSVPGGSKLEASFDADE
EFPL_XYLFA        -MKASEMKKGSIVEYNNGTYQIRDIQRSSPQGRGGNVRFRFVMYSVPGGSKLEASFDADE
EFPL_ALCBS        MTRASELKKSDVIEVNGTLYAIRQIEVQSPSARGAATLYRVKASAVGGGPKFEERFKGDD
S7VK26_DESML      MIKANTLKKGNIVDIGGQPHQVKDMEVQTPSARGSNTLYKVRFTNVVTGQKLDQTFKGND
L0DA24_SINAD      MVPAKDFKRRMVVEIDGSPHMIEQIHVQTPSARGAATLYKIKARNLKTKSRVEKAYRGTD
G4SZL2_META2      MAKASDFKRGMVVEINGVPHIIKQIEVRSPSSRGATTLYKVRFNNLKTGQKLDETLKGDD
Q31HI7_HYDCU      MPKANELKKGMVVEINDAPYVVKTVDCKSPSSRGAATLYKVRFNNVKTGQKLDESLKGDD
C0QEV1_DESAH      MPKACDLKRGSVVEIDNQVYTVKQVDVKSPSARGAATLYKIRFNNVKTRQKHEQTFKGND
                     *  .*:   :   .    :. :    . .*..   ::.    :    : :      :

EFPL_ECOLI        IVDTVTLTRRYVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTW
EFPL_CROS8        ILDTITLTRRFVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTW
EFPL_KLEP7        IVDTVTLTRRFVDFSYVDGNEYVFMDKEDYTPYTFTKEQIEEELQFIPEGGMPDMQVLTW
EFPL_ENT38        IVDTVTLTRRFVDFSYIDGNEYVFMDKEDYTPYIFTKDQIEDELLFIPEGGMPDMQVLTW
EFPL_PECAS        IIDTITLTRRTVTFSYIDGDEYVFMDDEDYAPYLFKKDQIEEELLFIPEGGMPGIQVLSW
EFPL_YERE8        ILDTITLTRRSVNFSYIDGDEYVFMDDEDFTPYNFKKEQIEEELLFIPEGGMPGMQVLTM
EFPL_ERWT9        IIDTISLSRRQVTFSYIDGDEYVFMDDEDYTPYNFKREQIEDELLFLPEGGIPGIQVLTM
EFPL_PHOLL        ILDTISLTRRSVNFSYIDGDEYVFMDDEDFTPYHFKKEQIEEELLFIPEGGLPGMQVLTI
EFPL_PROMH        ILDTINLTRRAVSFSYIDGDEYVFMDNEDYTPYTFKKDQIEEELLFIPEEGLAGMQVLTM
EFPL_SERP5        ILDTISLSRRKVNFSYIDGEEYVFMDDEDYTPYIFKKDQIEDELLFIPEAGLPGMQVLTL
EFPL_HAHCH        MLSTTQLERRQVAFSYIDGDDYVFMDNEDFSQYMLKKNDIEDQLLFLTEE-IQGLQVLMV
EFPL_PSYIN        MLPLADLVRRNVMFSYIDGEQYVFMDNEDYTPYNLDKDSIADEILLINED-TQGLQVVLV
EFPL_COLP3        MLNFADLSRRPSMFSYIDGEEYVFMDNEDYTPYNLNKESIADEILFIDEE-TQGISVIIV
EFPL_MARMS        MIDLADLVRRQVMFSYSDGDEFVFMDNEDYTPYSLNKSAIEEEILFVNEE-TVGIQVVLV
EFPL_MARHV        MLNLADLVRREATFSYADGDEYVFMDTEDFTQYMLNRSAIEDELLFITED-TQGVMVILV
EFPL_PSET1        MLTLADLTRREAMLSYIDGDEYVFMDNEDYTPYNLSKDAISEEILFVNEE-TQGVHVIVI
EFPL_ALIF1        MINLADFSRRSATFSYVDGNEYVFMDSEDYTPYNFNKEAIEEELLFITEE-TQGLQILIV
EFPL_ALISL        IITLADFSRRSATFSYVDGNEYVFMDSEDYTPYTFNKEAIEEELLFISED-TQGIQILIV
EFPL_PHOPR        MITLADFRRHPVMFSYIDGEEYVFMDSEDYTPYNFNKDSIVEELLFITED-TQGLQVLTV
EFPL_PSEA6        MIKTADFVRQPVTFSYIDGDEYVFMNSEDYTPYNINKETIEEELLFIAED-TTGLQVMIV
EFPL_SACD2        MITLADFSRHQATFSYVDGDEYVFMDNEDYTPYNLHKDAIAEELPFVTET-TEGIQVFTV
EFPL_SHESH        MINLADLSRHEVSFSYIDGDEYVFMDIADYTPYHFNKDSIADEILFINEE-TQGLQVLTV
EFPL_VIBCB        VVETVEMNKRAVVYSYADGDEHIFMDNEDYSQYTFKHNEVEDELLFINED-TQGIHLILI
EFPL_VIBPA        VVETVEMNKRAVVYSYADGDEHIFMDNEDYSQYTFKHNEVEDDMLFINED-TQGIHIILV
EFPL_VIBVY        VVETVEMNKKAVSFSYVDGDDYIFMDNADYSQYVFKHADVEDDLLFINED-TQGIHVILV
EFPL_VIBCM        VLDTVEMNKRPISFSYIDGDEYVFMNNDDYTPYNFKKDEIEDELLFITEE-IQGMSVVLV
EFPL_VIBA3        IVETIDVTKRAVMFSYVDGNEYIFMDNEDYTQFIFNGEMIEDELLFINED-TQGMYAILI
EFPL_XANOP        NLPDVELLRRLSTFSYKDGEAFVFMDDEDFTPYTLDADVIGTDAGYITDG-LTGIYVQVI
EFPL_XANCB        NLPEVELLRRQSTYSYKDGEAFVFMDDEDYTPYMLDAEVIGTDAGYITDG-LTGIFVQVI
EFPL_STRM5        NLVEVELLRRQSTYSYKDGDAFVFLDDEDYTPYTLDADVIGDDAGYITDG-LTGIYVQVI
EFPL_XYLFT        MLTAVELLRREASFSYKDGEAFVFLDEEDYTLYTLDAEAIGDNAGYISEG-LSGCYVQLI
EFPL_XYLFM        MLTAVELLRREASFSYKDGEAFVFLDEENYTLYTLDAEAIGDNAGYISEG-LSGCYVQLI
EFPL_XYLFA        MLTAVELLRREASFSYKDGEAFVFLDEEDYTLYTLEAEAIGDNAGYISEG-LSGCYVQLI
EFPL_ALCBS        DVATVALQRRAVQFSYVDGDDYIFMDNEDFSQYLLKQDDIRDELAFITEE-TQGVLALKV
S7VK26_DESML      TLEELEMERRPVSFIFRNQDMYTFMDSENFEQYTLGEASLEGKTEWLVEG-LEEITALLL
L0DA24_SINAD      ALNESSFERRPVQFLYRDPDGCHFMDSADFNQFSFTTDDLRDQLPYMTEN-MEGVEALVV
G4SZL2_META2      FFKDADCVRVKVQFSYMDGENYVFMNMEDYSQYSVGADDLEEQKGYLTEG-LEDIVALLF
Q31HI7_HYDCU      FLKELDCQRMPVQFSYMDGENYVFMNLTDYSQYTLSPEDLDGQTGYLSES-LEGMDAIVL
C0QEV1_DESAH      MVTGVDLARRSVQYLYPDGPIHVFMDNDTYVQYMISQDGIEDELVWLTDG-MEGLVALII
                   .      :      : :     *::   :  : .    :  .   : :           

EFPL_ECOLI        DGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSPGEKIRIHI
EFPL_CROS8        DGQLLALELPQTVDLEIVETAPGIKGASASARSKPATLSTGVVIQVPEYLSAGEKIRVHI
EFPL_KLEP7        DGQLLALELPQTADLEIIETAPGIKGASASSRTKPATMSTGLVIQVPEYLTTGEKIRIHI
EFPL_ENT38        DGQLLALELPQTVDLEIVETSPGIKGASASARNKPATLTTGLVVQVPEYLSAGEKIRIHI
EFPL_PECAS        DGQIIALELPQTVDLEIIETAPGIKGASASSRNKPATMSTGLVIPVPEYLSAGEKIRIHI
EFPL_YERE8        DGQLLALELPQTVDMEIVETAPSIKGASASARNKPAVMSTGLSIQVPEYISPGEKIRIHI
EFPL_ERWT9        DGQILALELPQTVDMEIVETTPGIKGASASARTKPAAMSTGLIIQVPEYLSNGDKIRIHI
EFPL_PHOLL        EGQVIALELPQTVDMVIEETAPGIKGASASARTKPAKMSTGLTVQVPEYISSGERIRIHI
EFPL_PROMH        DGQVLALELPQTVDMEIIETVPGIKGASASARTKPATLPTGLVIQVPEYLSTGDKIRIHI
EFPL_SERP5        EGQVLALELPQTVDMEIVDTAPGIKGASASARNKPATMATGLTIQVPEYLSAGDKIRIHI
EFPL_HAHCH        DGQVLALELPQTVEMEVIETTPAMKAASASARTKPAKFVTGLTIQVPEYLEQGERVKIHT
EFPL_PSYIN        DGAPVALELPSSVELEIVETSPSIKGGSATARTKPAILSTGLTVQVPEHISTGDKIKVNT
EFPL_COLP3        DDAPVGIALPASVELLITETDPSIKGASASARTKPALLSTGLTIQVPEHISTGDKVKVNT
EFPL_MARMS        NEVPVVIELPTNVELEVIETDPSIKGASATSRNKPAKLSTGAVIQVPEHISTGDRIKVNV
EFPL_MARHV        SENPVAIDLPPTVELTIEETDPSIKGGSATARTKPARLTTGLVVQVPEHISTGDRIRVNV
EFPL_PSET1        DGAPVGLDLPSSVELVVEETDPSIKGASASARSKPARMSTGLNISVPEHISTGDRIRINT
EFPL_ALIF1        DGAPVAIELPSAVDLEIVETAPSIKGASASARTKPATMTTGLTVQVPEYIANGEKVKINT
EFPL_ALISL        DGVPVAIELPSAVDLEIVDTAPSIKGASASARTKPATMTTGLTVQVPEYIANGEKVKINT
EFPL_PHOPR        DDLPVAIELPATVDMVISETDPSIKGASASARTKPAIMSTGLSVQVPEYIASGEKIKINT
EFPL_PSEA6        NGSAVGIELPPNVELVITETDPSIKGASASARTKPATLSTGLTVQVPEYISSGERIKIST
EFPL_SACD2        NGQPVAIDLPASVDLVIVETDPSIKGASATARTKPATLSTGLVIQVPEYIASGEKIKVST
EFPL_SHESH        DGTPVAIELPANVELVIVETDPSIKGASASARTKPAILSTGLSVQVPEYIANGEKIKINT
EFPL_VIBCB        NGSAVGIELPSSVELVIEETDPSIKGASASARTKPARFASGLVIQVPEYIATGDRVIINT
EFPL_VIBPA        DGSAVGLELPSSVELVIEETDPSIKGASASARTKPARFASGLVVQVPEYIATGDRVVINT
EFPL_VIBVY        NGESVGLELPSSVELVIEETDPSIKGASASARTKPARLSTGLVVQVPEYIATGDRVIINT
EFPL_VIBCM        DGEAVAIELPSSVEMVIEETDPSIKGASASSRTKPARMPTGLVVQVPEYIATGDRIVINT
EFPL_VIBA3        DGTAATLELPTSVELVIEETDPSIKGASASARTKPARLSTGLTVQVPEYIATGDKVVVNT
EFPL_XANOP        DDQPVAVQLPQTVTLEVVETPPELKGGTATKRPKPAKLNTGMEIMVPEYITNGERVLVNT
EFPL_XANCB        DDQPVAVQLPQTVTLEVVETPPELKGGTATKRPKPAKLNTGLEIMVPEYITNGERVLVNT
EFPL_STRM5        DEQPVAIQLPASVVLEVIETPPELKGGTATKRPKPAKLNTGIEIMVPEYIVNGERVLVNT
EFPL_XYLFT        DASPVALQLPQHVVLEVVDTPPELKGGTATKRPKPAKLITGIEVMVPEYITTGERILVNT
EFPL_XYLFM        DASPVALQLPQHVVLEVVDTPPELKGGTATKRPKPAKLITGIEVMVPEYITTGERILVNT
EFPL_XYLFA        DASPVALQLPQHVVLEVVDTPPELKGGTATKRPKPAKLITGIEVMVPEYITTGERILVNT
EFPL_ALCBS        EESVIGLELPASVVLDVTETTPAMKAASSSARTKPATLNTGLVVQVPEYIVAGEKVRVNT
S7VK26_DESML      NGRVMAVELPASIDLEIVDTAPALKGASATNRNKPATLSNGMTVLVPEYLTPGEMIRVNT
L0DA24_SINAD      DDEVIAVELPDTVDLLIVETAPGVRGNSATGRTKPATLATGHVIQVPEHLEQGVTVRVDT
G4SZL2_META2      DDTVLGIELPSSVALEIVETAPEIKGATATGRTKPARLTTGLEVQVPEYLKTGEIVKINT
Q31HI7_HYDCU      DEQVISIELPIAIALEITETAPGMKSASATSRTKPAILSTGLEIQVPEYIEQGEVVKVNS
C0QEV1_DESAH      EEEMVSLEVPNALVFEISETAPGIKGASASARTKPAVLANGVEIQVPEYLEPGELIKVNT
                  .     : :*    : : :* * ::. ::: * *** : .*  : ***::  *  : :  

EFPL_ECOLI        EERRYMGRAD--
EFPL_CROS8        AERRYMGRAE--
EFPL_KLEP7        EECRYMGRAD--
EFPL_ENT38        EEKRYMGRAD--
EFPL_PECAS        PERRYMGRAD--
EFPL_YERE8        VERRYMGRAD--
EFPL_ERWT9        PERRYMSRAD--
EFPL_PHOLL        AERRYMGRCD--
EFPL_PROMH        AERRYMGRAD--
EFPL_SERP5        AERRYMSRAD--
EFPL_HAHCH        AEKRFMGRAD--
EFPL_PSYIN        AEHKFMGRADK-
EFPL_COLP3        EERKFMGRADSK
EFPL_MARMS        EERKFAGRAEK-
EFPL_MARHV        EERKFLSRA---
EFPL_PSET1        AEHKFMGRAEK-
EFPL_ALIF1        TEHKFMSRA---
EFPL_ALISL        TEHKFMSRA---
EFPL_PHOPR        AEQKFMSRADSK
EFPL_PSEA6        SEHKFVSRADK-
EFPL_SACD2        VDHKFMSRA---
EFPL_SHESH        AEHKFMSRADSK
EFPL_VIBCB        TERKYMSRA---
EFPL_VIBPA        AERKYMSRA---
EFPL_VIBVY        AERKYMSRA---
EFPL_VIBCM        AERKFMNRA---
EFPL_VIBA3        AERKYMNRAS--
EFPL_XANOP        TTGEFAGRAD--
EFPL_XANCB        TTGEFAGRAD--
EFPL_STRM5        ATGEFAGRAD--
EFPL_XYLFT        TTGAFGGRAS--
EFPL_XYLFM        TTGAFGGRAS--
EFPL_XYLFA        TTGAFGGRAS--
EFPL_ALCBS        AERKFMSRA---
S7VK26_DESML      ETGKFMSRVKS-
L0DA24_SINAD      RTGEYLGRAN--
G4SZL2_META2      VTGKFMSRA---
Q31HI7_HYDCU      ETGKYMSRA---
C0QEV1_DESAH      ETRKFMSKA---
                      : .: