CLUSTAL format seed alignment for MF_00648

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NCPP_BACHD      ---------MWTIMIGSKNRAKVHALQ--EVVIR--DKIIVRSEAVPSDVASQPFSDQET
NCPP_OCEIH      ----------MQIQVGSQNPTKIQAVK--EMF----PNIDVIGVQAESGVSAQPFSDEET
NCPP_SULIL      ---------MVTIALGSKNPVKINATKEALDVLK--LNWDLIGIEVDSGVDKQPFCD-QT
NCPP_SULIY      ---------MVTIALGSKNPVKINATKEALDVLK--LNWDLIGIEVDSGVDKQPFCD-QT
NCPP_SULIN      ---------MVTIALGSKNPVKINATKEALDVLK--LNWDLIGIEVDSGVDKQPFCD-QT
NCPP_SULIA      ---------MVTIALGSRNPVKINATKEALDVLK--LNWDLIGIEVDSGVDKQPFCD-QT
NCPP_SULIK      ---------MVTIALGSRNPVKINATKEALDVLK--LNWDLIGIEVDSGVDKQPFCD-QT
NCPP_SULIM      ---------MVTIALGSRNPVKINATKEALDVLK--LNWDLIGIEVDNGVDKQPFCD-QT
NCPP_SACS2      ---------MVTIALGSKNPVKISATKEALEILR--LNWDLIATDIDSGVDKQPFCD-QT
NCPP_SULTO      ----------MFVAIGSTNKAKVEAVKEALKIIG--LNADVISVNVESGVSSQPFCH-ET
NCPP_KORCO      ----------MIVAVGSTNPVKVEAVRRAFSLF---WEADVRGVDVESGVPKEPFGP-NA
NCPP_ECO55      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECOLC      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECOBW      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECODH      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECOSE      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECOLI      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECO45      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECOL6      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECO27      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEET
NCPP_ECO57      ---------MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASIAVESGVPEQPFGSEET
NCPP_SALA4      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALG2      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALEP      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALDC      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALCH      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALPB      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALPC      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALSV      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALTY      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALHS      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALNS      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALPA      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALPK      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEET
NCPP_SALAR      ---------MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPIAVESGVPEQPFGSEET
NCPP_ENT38      ---------MHQVVSATTNPAKIQAILRAFEEIFGEGSCHIEAVAVESGVPEQPFGSEET
NCPP_CITK8      ---------MHHVVSATTNPAKIQAILQAFNEIFGEGSCHIESVSVESGVPEQPFGSQET
NCPP_KLEP3      ---------MHHVVSATTNPAKIQAILQAFNEIFGEGSCHIESVSVESGVPEQPFGSEET
NCPP_KLEP7      ---------MHHVVSATTNPAKIQAILQAFDEIFGEGSCHIESVAVESGVPEQPFGSEET
NCPP_CROS8      ---------MYHVVCATTNPAKIQAILRAFSEIFGEASCHIDAVSVDSGVPEQPLGSEET
NCPP_PECAS      ---------MYHVVAATTNPAKIKAISLAFIDVFGAENCRIEGVDVDSGVPRQPLGSIET
NCPP_PECCP      ---------MYHVVAATTNPAKIKAITLAFTDVFGAENCRIEGVDVDSGVPRQPLGSIET
NCPP_YERPE      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERPP      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERPG      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERPA      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERPN      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERPS      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERPY      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERPB      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERP3      ---------MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQPIGSTET
NCPP_YERE8      ---------MYHVVAATTNPAKIKAISLAFDDVYGPGQYRIEGINVDSGVPLQPIGSTET
NCPP_SERP5      ---------MYHVVAATTNPAKIKAIQLAFEDTFGQDQCRIESVDVASGVSLQPIGNHET
NCPP_PHOLL      ---------MYHVIAATTNPAKIKAISLAFDDVFGPGTYRIEDINVDSSVPQQPIGNTET
NCPP_PROMH      ---------MYHVIAATTNPAKINAIKLAFEQVFGKDTFDIEDINVDSRVPQQPIGNTET
NCPP_ERWT9      ---------MYHVVAATINPAKIKAISQAFSDIFGAGSCHIEGVEVDSGVAAQPISNTET
NCPP_VIBCH      MPPIIKRRVMRKIIIASQNPAKVNAVRSAFSTVFPDQEWEFIGVSVPSEVADQPMSDEET
NCPP_VIBCM      MPPIIKRRVMRKIIIASQNPAKVNAVRSAFSTVFPDQEWEFIGVSVPSEVADQPMSDEET
NCPP_VIBVU      MSKKIM--ATQKVIIASLNPAKITAVESAFTSAFPNGTFEFVGVNVPSEVADQPMSDSET
NCPP_VIBVY      MSKKIM--ATQKVIIASLNPAKITAVESAFTSAFPDGTFEFVGVNVPSEVADQPMSDSET
NCPP_VIBPA      MSKKIM--ATQKVVIASLNPAKINAVKSAFQSAFPQQVFEFVGISVPSEVADQPMTNEET
NCPP_ALIF1      ----------MKVIIASQNPAKIAAVESAFNLAFPNDTFSFEGVSVKSGVPDQPMSCEET
NCPP_ALIFM      ----------MKVIIASQNPAKIAAVESAFNLAFPNDTFSFEGVSVKSGVPDQPMSCEET
NCPP_PHOPR      ---------MSKIIVASANPAKISAVASAFSQAFPEQSFTVEGISVASEVRDQPLCADET
NCPP_SHEB8      -----MQQNIIKIKVGSKNPVKINAATKAMAQLFPDSIIDASGMDAPSGVAAQPMTDKDT
NCPP_SHEB9      -----MQQKIIKIKVGSKNPVKINAATKAMAQLFPESIIDASGMDAPSGVAAQPMTDKDT
NCPP_SHESA      -----MQQNIIKVIVGSKNPVKINAAANAMALLFPDYEIQTQGMDAPSGVPAQPMTDSDT
NCPP_SHESR      -----MQQNIIKVIVGSKNPVKINAAANAMALLFPEYEIQTQGMDAPSGVPAQPMTDSDT
NCPP_SHESM      -----MQQNIIKVIVGSKNPVKINAAANAMALLFPEYEIQTQGMDAPSGVPAQPMTDSDT
NCPP_SHEON      -----MQQNIIKVIVGSKNPVKVNAAANAMTLLFPEYQIQTIGMDAPSGVPAQPMTDSDT
NCPP_METTH      ---MDSVVFYMKVNVGSGNPVKVRATENVLGLIYGNVEVR--GVEVESGVPDQPVGLEET
NCPP_METAR      ----------MKVAVGTVNPVKVNAVKNVFGKLFDNVEVE--GRKVGSGVPDQPFG-SET
NCPP_ARCFU      --------------MGSKNPTKIEGARRAFEQYFDDVEIV--GVEVSTSAPPQPFD-AET
NCPP_THEKO      ----------MKVAVGSTNPAKVEAVREVFLGIYGDVEVV--PIEVDSGVPDQPVGLEET
NCPP_METJA      ----MARHKLRIVAVGSTNPVKIEAVKEGFEKVLGAVEVI--GVDVISGVSSHPIGLEET
NCPP_METKA      ----------MKVRVGTTNPVKVRATERAFLRTFPDREITVEAVSVDPGVPPQPVGMEEV
NCPP_PYRAE      ----------MIVAVGTKNPNKIRAVEDAYRLF--GIPARIVPAPRPLTTPPQPVGLEAV
NCPP_PYRAR      ----------MIVAAGTKNPNKIKAVKDAYRLF--GFPAEVVPVGRPAGTPPQPVGLEEV
NCPP_PYRIL      ----------MIVAVASRNPNKLRAVQAAYKLF--GMRAQVVPVEKPVSLPPQPIGVETV
NCPP_PYRNV      ----------MKVAVASRNPNKVRAVEEAYRLF--GIPARVSSVDKPPSLPPQPVGLEAV
NCPP_PYRCJ      ----------MKVAAATRNPNKLRAIREAYRTF--GFPAEVVPVDKPPGAPPQPIGLDAV
NCPP_CALMQ      ----------MKVALASRNPSKVKAVEEALRIL--NINGTVEAVDPPPGIPPEPMGLEAT
COPP_THEAC      -----------<VGISTRNEAKIQAVEKFVRRLVKNYQIVK---NENYNLKTQQPFGEET
COPP_THEVO      -----------<VAIATNNSAKLKATNDFFHKLMKNFDVIQ---NTDYKLETQQPFGEVT
NCPP_AERPE      --------MAVTVAVGTSNPIKYRAVLRAFSRYYDVRVVMV---SVDSGVGPQPSGVADV
                               .: *  *  .                           .      .

NCPP_BACHD      IQGAINRANHCLSFD----GVDYGVGLEGGVVRS---EYGLFLCNWGALVSQTGDQWVAG
NCPP_OCEIH      KLGAITRAKYCAMNN----PYTIGVGLEGGVMYI---DNELYLCNWGALVTPENDIITAS
NCPP_SULIL      YVGARNRALNVIRVT----NADIGLGIEGGVCNV---YGKFIANAVVYVITKEGLENFAI
NCPP_SULIY      YVGARNRALNVIRVT----NADIGLGIEGGVCNV---YGKFIANAVVYVITKEGLENFAI
NCPP_SULIN      YVGARNRALNVIRVT----NADIGLGIEGGVCNV---YGKFIANAVVYVITKEGLENFAI
NCPP_SULIA      YVGARNRALNVIRVT----NADIGLGIEGGVCNV---YGKFIANAVVYVITKEGLENFAI
NCPP_SULIK      YVGARNRALNVIRVT----NADIGLGIEGGVCNV---YGKFIANAVVYVITKEGLENFAI
NCPP_SULIM      YVGARNRALNVIRVT----NADIGLGIEGGVCNV---YGKFIANAVVYVITKEGLENFAI
NCPP_SACS2      YVGARNRALNAIKAT----NADIGLGIEGGVCNV---YGKFIANAVVYVITKEGVENFAI
NCPP_SULTO      FVGAKNRAYNALNAT----NADIGIGIEGGICYY---ENKYLAFAVVYAANKEGLENFSF
NCPP_KORCO      IEGARNRARNALRAL----NADFGVGIEGGIFHL---FGKYYCAGFVWIERKDGVHSTGM
NCPP_ECO55      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENAS-QRGEAR
NCPP_ECOLC      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENAS-QRGEAR
NCPP_ECOBW      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENAS-QRGEAR
NCPP_ECODH      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENAS-QRGEAR
NCPP_ECOSE      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENAS-QRGEAR
NCPP_ECOLI      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENAS-QRGEAR
NCPP_ECO45      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENTS-QRGEAR
NCPP_ECOL6      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENTS-QRGEAR
NCPP_ECO27      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENTS-QRGEAR
NCPP_ECO57      RAGARNRVANARRLL---PEADFWVAIEAGID-------GDSTFSWVVIENTT-QRGEAR
NCPP_SALA4      RAGARNRVDNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALG2      RAGARNRVDNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALEP      RAGARNRVDNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALDC      RAGARNRVDNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALCH      RAGARNRVDNAQRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALPB      RAGARNRVDNAQRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALPC      RAGARNRVDNAQRLH---PQADFWVAIEAGIN-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALSV      RAGARNRVDNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALTY      RAGARNRVDNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALHS      RAGARNRVGNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALNS      RAGARNRVGNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALPA      RAGARNRVGNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALPK      RAGARNRVGNARRLH---PQADFWVAIEAGID-------DDATFSWVVIDNGV-QRGEAR
NCPP_SALAR      RTGARNRVANARLLC---PEADFWVAIEAGID-------DNSTFSWVVIESVE-LRGESR
NCPP_ENT38      RAGARNRVLNAKALR---SDADFWVAIEAGID-------DGATFSWVVIENRE-QRGEAR
NCPP_CITK8      RAGARNRVENARCLR---PQADFWVAIEAGID-------DDSTFSWVVIENAA-QRGEAR
NCPP_KLEP3      RAGARNRVANARLVQ---PSADFWVAIEAGID-------DGSTFSWVVIESAD-RRGEAR
NCPP_KLEP7      RAGARNRVANARLAR---PNADFWVAIEAGID-------DDSTFSWVVIESAS-QRGEAR
NCPP_CROS8      RTGARQRVINARALR---PQADYWVAIEAGID-------DDSTFSWVVIESAD-QRGEAR
NCPP_PECAS      RTGARNRVMMARQVR---PEANFWVGVEAGIE-------ESMTFAWMVIENAN-LRGESR
NCPP_PECCP      RTGARNRVMMARQVR---PEADFWVGVEAGIE-------ESMTFAWMVIENTH-LRGESR
NCPP_YERPE      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVVEHLQ-ARGESR
NCPP_YERPP      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVVEHLQ-ARGESR
NCPP_YERPG      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVVEHLQ-ARGESR
NCPP_YERPA      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVVEHLQ-ARGESR
NCPP_YERPN      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVVEHLQ-ARGESR
NCPP_YERPS      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVIEHLQ-ARGESR
NCPP_YERPY      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVIEHLQ-ARGESR
NCPP_YERPB      RIGARQRVKNARQVR---PEADFWVGIEAGIE-------DNMTFAWMVIEHLQ-ARGESR
NCPP_YERP3      RIGARQRVKNARQVR---PKADFWVGIEAGIE-------DNMTFAWMVIEHLQ-ARGESR
NCPP_YERE8      RTGARQRVSNARQMR---PEADFWVGVEAGIE-------DNMTFAWMVIEHLQ-WRGESR
NCPP_SERP5      RTGARQRVMEARQVR---PEADFWVGVEAGIE-------ENMTFAWMTVENPQ-TRGESR
NCPP_PHOLL      RTGARQRVMAARQVR---PEADFWVGVEAGIE-------DDMTFAWMVVEYQQ-IRGESR
NCPP_PROMH      RTGARQRVMAARQVR---PEADFWVGVEAGIE-------DDMTFAWIVIEHEQ-IRGESR
NCPP_ERWT9      RTGARQRVMNARRVR---PEADFWVAIEAGIE-------EDTAFAWMVVENQK-LRGESR
NCPP_VIBCH      KQGALNRVRNAKQRH---PGAEYYVGLEAGIE-------ENKTFAWMIVESDQ-QRGESR
NCPP_VIBCM      KQGALNRVRNAKQRH---PGAEYYVGLEAGIE-------ENKTFAWMIVESDQ-QRGESR
NCPP_VIBVU      HLGALNRVRNAKACR---ADGAFYVGLEAGID-------GNVTFAWTVIESHT-HRGESR
NCPP_VIBVY      HLGALNRVRNAKACR---ADGAFYVGLEAGID-------GNVTFAWMVIESHT-HRGESR
NCPP_VIBPA      HRGALNRVKNAKLEM---PTADFYVGLEAGIE-------GNVTFAWMVIESDT-HRGESR
NCPP_ALIF1      KQGAMNRINNAKIKL---PNCDYYVGLEAGIE-------GNSTFAWMIIDNGL-TVGESR
NCPP_ALIFM      KQGAINRVNNAKIKL---PNCDYYVGLEAGIE-------GNSTFAWMIIDNGL-TVGESR
NCPP_PHOPR      LLGARNRVKNARKLQ---ADADFYVGLEAGID-------GGFTFAWMVIENHK-QRGEAR
NCPP_SHEB8      RQGAINRVHYCQQQDQQDTQADYYFAMEGGVDCF---DFGPATFAYIAIGHKD-QLAIGR
NCPP_SHEB9      RQGAINRVHYCQQQDQQDTQADYYFAMEGGVDCF---DFGPATFAYIAIGHKD-QLAIGR
NCPP_SHESA      RQGAINRVHYCQQQ----IEADYYFAMEGGVDCF---EFGPATFAYIAIAHQA-RLSIGR
NCPP_SHESR      RQGAINRVHYCQQQ----VEADYYFAMEGGVDCF---EFGPATFAYIAIAHQA-RLSIGR
NCPP_SHESM      RQGAINRVHYCQQQ----IEADYYFAMEGGVDCF---EFGPATFAYIAIAHQA-RLSIGR
NCPP_SHEON      RQGAINRVNYCQQH----AEADYYFAMEGGVDHF---EFGPATFAYIAIAHQQ-RLSIGR
NCPP_METTH      VRGAVNRARRAFR------DCELSVGIESGLHRVPETITGFVDLQWCAIYDGE-HITLGV
NCPP_METAR      IKGAINRAKNAYRTG----DYDYGVGIEAGLTDVEGYV---LDIQFCAVFDGL-DCTTGC
NCPP_ARCFU      VRGAIERAKKAYSP-----DFDFSVGIEAGLFRSECTITGYLDFQVAAVYDGE-RCTIGF
NCPP_THEKO      VKGAINRAKQAIEKT----DADFGVGIEAGLYRVPETITGYMDVQFCAVVDREGRITLGH
NCPP_METJA      YLGALNRAKNAFEKV----QCTYAVGIEAGLIKVGEHY---IDIHICVVFDGV-NETVGL
NCPP_METKA      HQGAKNRAREAWNR------GSYSVGLEAGLIRVGDVY---VDLHVAVVRDPKGRETVGT
NCPP_PYRAE      LKGAVERAKAALQAV---EKAEHGVGIEAGVV---EAGGVHLDITIAAIVDAGGRTTIGF
NCPP_PYRAR      VKGAVARAKAALEAV---PGAEHGVGVEAGAV---HAGGAHLDITVAAIADRGGAVTLGF
NCPP_PYRIL      VAGAIERARAALSVV---QNAEHGVGIEAGVL---QAGGRYLDVTVAAIADRNGVVTIGF
NCPP_PYRNV      VAGAVERAKAALAAA---GEAEHGVGIEAGAL---EAGGRHLDVTVAAVADRGGLVTLGF
NCPP_PYRCJ      AKWALERARHALAAA---PGADHGVGIEAGVV---EVAGYHLDITIAAIVDREGYVTVGT
NCPP_CALMQ      VNGAVVRARHALSSI---KDSTYGIGIEAGVLML-SAFNVNFDVTVAAVIDRKGLITLGL
COPP_THEAC      MELATQRAMEALKDND------YSVGIESGIIYE-SFSKKYYDVHYCVVIDRFGNVTRGM
COPP_THEVO      MNMATKRAMQSLGDND------YAIGIESGIVYE-RFSRKYFDFHYCVVIDRFGNVTRGS
NCPP_AERPE      VGGALARAVRAVEKADS----YFGVGVEAGPIEF-PASGGYVETQVAAIVDRDCRATIGM
                   *  *                 ..:*.*                            . 

NCPP_BACHD      GARVPLPQEVAHELEG-GKELGDIMESLTKNPDVRMTDGAIGYLTDGEISRKAMFQHVVH
NCPP_OCEIH      GARIKIPNDVEEGLLK-NIELGELMDTYAEKKDVSKKEGAIGIFTNQLITRKEMFRHVVT
NCPP_SULIL      SSSFTLPSSMVSLILQ-GKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIV
NCPP_SULIY      SSSFTLPSSMVSLILQ-GKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIV
NCPP_SULIN      SSSFTLPSSMVSLILQ-GKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIV
NCPP_SULIA      SSSFTLPSSMVSLILQ-GKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIV
NCPP_SULIK      SSSFTLPSSMVSLILQ-GKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIV
NCPP_SULIM      SSSFTLPSSMVSLILQ-GKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIV
NCPP_SACS2      SSSFTLPSSIVSLILQ-GKELGEASDIIFKTINSKTKEGAVGLLTNNIIDRKTLYVQPII
NCPP_SULTO      SMAFSLPYSMVKHILE-GRELGEATDLIFSTKDSKQHEGAIGYLTK-VITRKELYIQPVI
NCPP_KORCO      SGWFECPEAFLPDMLR-GRELGDLMARLSGNENIKREEGAIGFFTRGAVKRVDLYTHGTL
NCPP_ECO55      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVI
NCPP_ECOLC      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVI
NCPP_ECOBW      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVI
NCPP_ECODH      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVI
NCPP_ECOSE      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVI
NCPP_ECOLI      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVI
NCPP_ECO45      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRTSVYHQAVI
NCPP_ECOL6      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRTSVYHQAVI
NCPP_ECO27      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRTSVYHQAVI
NCPP_ECO57      SATLPLPAVILEKVRE-GEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVI
NCPP_SALA4      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALG2      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALEP      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALDC      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALCH      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALPB      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALPC      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALSV      SATLPLPAVILDRVHQ-GKALGPVMSQYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALTY      SATLPLPAVILDRVRQ-GEALGPVMSQYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALHS      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALNS      SATLPLPAVILDRVRQ-GEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALPA      SATLPLPAVILDRVRQ-GEALGPVMSQYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALPK      SATLPLPAVILDRVRQ-GEALGPVMSQYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVI
NCPP_SALAR      SATLPLPAVILENVRA-GDALGPVMSRYTGIDEIGRKEGAIGIFTAGKLTRSSVYHQAVI
NCPP_ENT38      SATLPLPAIILEKVRA-GEALGPVMSQYTGIDEIGRKEGAIGVFTAGALTRSSVYHQAVI
NCPP_CITK8      SATLPLPAVILEKVRQ-GEALGPVMSQYTGIDEIGRKEGAIGVFTAGKLTRSSVYHQAVI
NCPP_KLEP3      SATLPLPEVILEQVRA-GEALGPVMSQYTGIDQIGRKEGAIGVFTGGKLTRSSVYHQAVV
NCPP_KLEP7      SATLPLPDVILEQVRA-GEALGPVMSQYTGIDQIGRKEGAIGVFTGGRLTRSSVYHQAVV
NCPP_CROS8      SATLPLPAAILNEVRA-GKALGPVMSAWTGIDEIGRKEGAIGIFTAGKLTRSSVYHQAVI
NCPP_PECAS      SASLVLPESILHGIRE-GRELGDEMERLTGVQNIKHKGGAIGVFTDGKLSRTSVYHQALL
NCPP_PECCP      SASLVLPESILHGIRE-GRELGDEMERLTGVQNIKHKGGAIGVFTDGKLSRTSVYHQALL
NCPP_YERPE      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERPP      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERPG      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERPA      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERPN      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERPS      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERPY      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERPB      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERP3      SASLMLPDIILQGIRQ-GRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALL
NCPP_YERE8      SASLMLPDIILQGIRQ-GRELGDEMADLTGISNVKHKGGAIGIFTDGKLTRTSVYHQALL
NCPP_SERP5      SASLMLPETILQGIRA-GRELGSEMATITGNAEVKRQGGAIGIFTDGRLSRTSVYHQALL
NCPP_PHOLL      SASLMLPEKILDGIRE-GRELGHEMAYLTGIDNINQKEGAIGFFTDGILTRTSVYHQALI
NCPP_PROMH      SASLMLPEQILKGVRE-GRELGDEMAFLTKIDNIKQKGGAIGYFTDGLLSRTSVYQQAIV
NCPP_ERWT9      SASFTLPAIVMKGIHQ-GRELGDEMARLTGIDNIKHKGGAIGAFTAGHLTRSSVYHQALI
NCPP_VIBCH      SACLMLPPLVLERLRQ-AKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALI
NCPP_VIBCM      SACLMLPPLVLERLRQ-AKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALI
NCPP_VIBVU      SASLMLPPNVIAKLAN-ANELGDVMDEVFGTENIKQKGGAISLLTQNQLTRSSVYHQALI
NCPP_VIBVY      SASLMLPPNVIAKLPN-ANELGDVMDEVFGTENIKQKGGAISLLTQNQLTRSSVYHQALI
NCPP_VIBPA      SASLMLPPEVLAQLAD-ANELGDVMDKVFGTENIKQKGGAISLLTQNQLTRSSVYHQALI
NCPP_ALIF1      SSSLPLPPQVIDEVKK-GKELGDVMDEQFNTDNIKQKGGAIGLLTNNLLTRTSVYQQALI
NCPP_ALIFM      SSSLPLPPQVIDEVKK-GKELGDVMDEQFNTDNIKQKGGAIGLLTNNLLTRTSVYQQALI
NCPP_PHOPR      SASLPLPPIALEKIQQ-GIELGDVMDDMFNQQNVKQKGGAIAMLTNHTLSRSSVYQQALI
NCPP_SHEB8      SAILPLPMQVYRALEA-GEELGHVMDRLFNTVNIKQKGGAIGLLTHGHATRESNYTQAII
NCPP_SHEB9      SAILPLPMQVYRALEA-GEELGHVMDRLFNTVNIKQKGGAIGLLTHGHATRESNYTQAII
NCPP_SHESA      GALLPLPMQVYQALEA-GEELGHVMDRLFNTVNIKQKGGAIGLLTHGHATRESNYTQAII
NCPP_SHESR      GALLPLPMQVYQALEA-GEELGHVMDRLFNTVNIKQKGGAIGLLTHGHATRESNYTQAII
NCPP_SHESM      GALLPLPMQVYQALEA-GEELGHVMDRLFNTVNIKQKGGAIGLLTRGHATRESNYTQAII
NCPP_SHEON      GALLPLPRQVYQALEA-GEELGHVMDRLFNTVNIKQKGGAIGLLTHGHATRESNYTQALI
NCPP_METTH      SAGFEYPPMVVEEVLA-GREVGDVMDELTGVDELGRKRGAVSFLSGGLLDRTGNTEQCVL
NCPP_METAR      GSGFQYPPTVLAEVLT-GREVGDVMSELTGIENLGQKMGAIGYLSRGMLDRTQLTEQSVL
NCPP_ARCFU      GPGFEYPKLVVEEVLK-GKEVGEVMEKVSGIKNLGKKVGAVHYLSKGAISRTDLSRISVT
NCPP_THEKO      GPGFEYPPGVIRRVFEEGVEVGIAMGELVNDPELKRKIGAIGVLTHGMLVRKELNKLAVL
NCPP_METJA      SQGFEYPKIVAEKVLE-GIEGGKIAEEISGIKDIGKNIGLIGYLTDNNITRKDLCRESVI
NCPP_METKA      SPGFQLPPDVTEEALS-GEEVGEVFSELVGVREIGKRSGAIGVLSNGKVLREDLCELAIL
NCPP_PYRAE      GPAFQIPPPFLSQVLS-GVEMGAVAEQYFKRPSIGYREGLIGVLTKRRVTRYHLNLAAVA
NCPP_PYRAR      GPAFQIPTAFLPDVLK-GVELGELAERYFKKPSVGYREGIIGVLTGRRVTRYQLNLAAVA
NCPP_PYRIL      GPAFQVPDIFLNDVLR-GVELGVLAERYFGRVAIGYKEGIIGVLTKGVVSRFDLNMAAVV
NCPP_PYRNV      GPAFQIPDVFLGDVLR-GVELGVLAERHFGKAAVGYREGIIGLLTRGRVTRLDLNVVAVA
NCPP_PYRCJ      SPAFQIPTALLHDVLQ-GRELGATAEAHYGRPAVGYREGIIGLLTRGVVKRIDLNYAAVL
NCPP_CALMQ      SPAFMIPPAFMRELMT-GKELNDVVEKYYGVPNAGKGIGFIGLLSRGLIKRINLNTEAVY
COPP_THEAC      SSGFEIPDHIVDRMKR-DRTFSEAYSGYLNVQEIDQSEGIIGKISEGKLRRIDLIEESIR
COPP_THEVO      SSGFEVPDRIIDLIKR-DMSFSQAYGKVIDTNGIDDSTGIVGKISNGRVRRYDLIMECIR
NCPP_AERPE      SPSFEVDRRVLALMLD-GVEMEKAVG-VERHGGLGESVGFVGVATSGAVTRQDLTEHAVI
                .  .                                  * :   :     *         

NCPP_BACHD      LLIGQARRDGHLLRTVTH-----------------
NCPP_OCEIH      LLKGQW----MLLNSNNH-----------------
NCPP_SULIL      LALYPIYNTMINNTPF-------------------
NCPP_SULIY      LALYPIYNTMINNTPF-------------------
NCPP_SULIN      LALYPIYNTMINNTPF-------------------
NCPP_SULIA      LALYPIYNTMINNTPF-------------------
NCPP_SULIK      LALYPIYNTMINNTPF-------------------
NCPP_SULIM      LALYPIYNTMINNTPF-------------------
NCPP_SACS2      LALYPIYNTIINNTLF-------------------
NCPP_SULTO      AALYPFYNKIE------------------------
NCPP_KORCO      MALAKFIAAGRWPR---------------------
NCPP_ECO55      LALSPFHNAVY------------------------
NCPP_ECOLC      LALSPFHNAVYQAL---------------------
NCPP_ECOBW      LALSPFHNAVY------------------------
NCPP_ECODH      LALSPFHNAVY------------------------
NCPP_ECOSE      LALSPFHNAVY------------------------
NCPP_ECOLI      LALSPFHNAVY------------------------
NCPP_ECO45      LALSPFHNAVYQPLQA-------------------
NCPP_ECOL6      LALSPFHNAVYQPLQA-------------------
NCPP_ECO27      LALSPFHNAVYQPLQA-------------------
NCPP_ECO57      LALSPFHNAVY------------------------
NCPP_SALA4      LALSPFHNAVYR-----------------------
NCPP_SALG2      LALSPFHNAVYR-----------------------
NCPP_SALEP      LALSPFHNAVYR-----------------------
NCPP_SALDC      LALSPFHNAVYR-----------------------
NCPP_SALCH      LALSPFHNAVYR-----------------------
NCPP_SALPB      LALSPFHNAVYR-----------------------
NCPP_SALPC      LALSPFHNAVYR-----------------------
NCPP_SALSV      LALSPFHNAVYR-----------------------
NCPP_SALTY      LALSPFHNAVYR-----------------------
NCPP_SALHS      LALSPFHNAVYR-----------------------
NCPP_SALNS      LALSPFHNAVYR-----------------------
NCPP_SALPA      LALSPFHNAVYR-----------------------
NCPP_SALPK      LALSPFHNAVYR-----------------------
NCPP_SALAR      LALSPFHNAVYR-----------------------
NCPP_ENT38      LALSPFHNAIYR-----------------------
NCPP_CITK8      LALSPFHNAVYR-----------------------
NCPP_KLEP3      LALSPFHNAIYR-----------------------
NCPP_KLEP7      LALSPFHNAIYR-----------------------
NCPP_CROS8      LALSPFHNAIYR-----------------------
NCPP_PECAS      LALVPFHNPIYQISVQTTTQ---------------
NCPP_PECCP      LALVPFHNPIYQIPVQAAKP---------------
NCPP_YERPE      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERPP      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERPG      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERPA      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERPN      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERPS      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERPY      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERPB      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERP3      LALVPFHNEIYQRPSPSKPAI--------------
NCPP_YERE8      LALVPFNNEIYQRPAQ-------------------
NCPP_SERP5      LALVPFHNPIYQNHNNAAQK---------------
NCPP_PHOLL      LALVPVHHEIYKELNAR------------------
NCPP_PROMH      LALVPVTHDIYKQLNKKDDE---------------
NCPP_ERWT9      LALCPFHNDIYQRKADDEDSDLI------------
NCPP_VIBCH      LALIPFINPEHYPSA--------------------
NCPP_VIBCM      LALIPFINPEHYPSA--------------------
NCPP_VIBVU      LALIPFTNPEHFPANLS------------------
NCPP_VIBVY      LALIPFTNPEHFPANLS------------------
NCPP_VIBPA      LALIPFTNPDHFPANL-------------------
NCPP_ALIF1      LALIPFLHPTRF-----------------------
NCPP_ALIFM      LALIPFLHPTRF-----------------------
NCPP_PHOPR      LALIPFMNEQWFPCR--------------------
NCPP_SHEB8      LAMAPLLNPDIYAQTC-------------------
NCPP_SHEB9      LAMAPLLNPDIYAQTC-------------------
NCPP_SHESA      LAMAPFLNPELYP----------------------
NCPP_SHESR      LAMAPFLNPELYP----------------------
NCPP_SHESM      LAMAPFLNPELYP----------------------
NCPP_SHEON      LAMAPFLNPEIYL----------------------
NCPP_METTH      MAMIPRMNPSLYGLK--------------------
NCPP_METAR      MAMIPRLNPKLYRQID-------------------
NCPP_ARCFU      MALIPFINREMYL----------------------
NCPP_THEKO      MALVPRLNPEWYGL---------------------
NCPP_METJA      MALIPRMIKNAHLY---------------------
NCPP_METKA      MALIGLETSR-------------------------
NCPP_PYRAE      MALTPRLPHNSQLYLKP------------------
NCPP_PYRAR      MALVPRLPKNAKLYRT-------------------
NCPP_PYRIL      MALVPRLSTNAPLYRF-------------------
NCPP_PYRNV      MALVPRLPANAQLYRFWKTAP--------------
NCPP_PYRCJ      MALTPRLPHNAPHYRKA------------------
NCPP_CALMQ      MALLPRMPWNKDLYELSD-----------------
COPP_THEAC      NAFILRLDPDFYDSTYTPP----------------
COPP_THEVO      NAFIPRFDPDFYDTTYTPP----------------
NCPP_AERPE      MALIPRLMGYGSIATVEEIAAQAGASVECRSTRAI