CLUSTAL format seed alignment for MF_00651

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YQGF_AERHY      ----------------------MSSRSIMGFDYGTKSIGVAIGQELT-GTGQPLRAIKAN
YQGF_AGRFC      ---------MATLTIEELAQTLQPAQAIAGLDLGTKTIGLAMSDLSR-RFATPRPVIKRV
YQGF_BRADU      -------MPALILPLVDAATHWPERGGLVGLDLGTKTIGVAVSNPDR-RLATGVETIQRK
YQGF_BACHD      -------------------------MRTLGLDVGTKTIGIAVSDALG-WTAQGLETWRRS
YQGF_BACSU      -------------------------MRILGLDLGTKTLGVALSDEMG-WTAQGIETIKIN
YQGF_NOSS1      ---------------------MTKYISALGLDVGRKRVGVAGCDRTG-LIATGITTVERT
YQGF_AQUAE      -------------------------MKVLAVDYGTKRVGLAIGDEEL-KIVSPKGTVSSK
YQGF_BACTN      ------------------------MSRIVAIDYGRKRTGIAVSDTLQ-LIANGLTTVPTH
YQGF_BRUME      ---------MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGL-SFAHPRPVIKRV
YQGF_BRUSU      ---------MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGL-SFAHPRPVIKRV
YQGF_RHIME      ---------MAILTMEELAERLPPYQSVAGLDLGTKTIGISVSDLGR-RFATPREVIRRV
YQGF_RHILO      -----------------MPAWLADGRTLAGLDLGDKTIGVAVSDRGF-AFAHPRPVIMRR
YQGF_RHOCB      ---------MICPGMDDFAAALPRVGALAGLDLGTKTIGVAVSDTLR-GIATPLRTIRRE
YQGF_CAUVC      ---------MPVLDIEDFADALPQYAAVVGLDPGEKTIGVAVSDVTR-TVASPLALIEKT
YQGF_CLOAB      -------------------------MRILGIDVGNKTIGVALSDPLG-FTAQGITTIRRK
YQGF_CLOPE      -------------------------MRILGLDIGSKTIGVAVSDPLG-WTAQGVTTIKRD
YQGF_CLOTE      -------------------------MRILGLDVGDRTIGVAISDPLG-WTAQGVKTIKRS
YQGF_CALS4      -------------------------MRVLGLDVGDKTIGVAISDVSS-TIAQGITTIRRK
YQGF_LACLA      -----------------------MFARILGLDVGTKTVGVSVSDLLG-MTAQPVETIKID
YQGF_LACPL      -------------------------MKLMGLDVGSRTVGVAISDAFG-WTAQGVEIIRIN
YQGF_LISIN      -------------------------MRIMGLDVGSKTVGVAISDPLG-WTAQGVETIQID
YQGF_LISMO      -------------------------MRIMGLDVGSKTVGVAISDPLG-WTAQGVETIQID
YQGF_STRA3      -------------------------MRIMGLDVGSKTVGVAISDPLG-FTAQGLEIIKID
YQGF_STRMU      -------------------------MRIIGLDVGSKTVGVAVSDPLG-FTAQGLEIIPIN
YQGF_STRR6      -------------------------MRIMGLDVGSKTVGVAISDPLG-FTAQGLEIIQIN
YQGF_STRP1      -------------------------MRIMGLDVGSKTVGVAISDPLG-FTAQGLEIIKID
YQGF_STRP3      -------------------------MRIMGLDVGSKTVGVAISDPLG-FTAQGLEIIKID
YQGF_OCEIH      -------------------------MKIIGLDVGSKTIGVAVSDALG-WTAQGVKTIRWD
YQGF_STAAM      ----------------------MLQHKILGLDVGSRTVGIAISDIMG-WTAQGLDTLRIN
YQGF_STAES      ----------------------MLKHKILGLDVGSKTVGIAISDLMG-WTAQGLDTLRIN
YQGF_BUCAI      -------------------------MIVIAFDFGIKKIGVAVGENIT-KKGRPLSVLNAQ
YQGF_BUCAP      -------------------------MIVIAFDFGLKNIGVAVGENIL-KKGRALNKLSAK
YQGF_WIGBR      --------------------MMYRNNLLISFDFGTKNIGVAIGQMKT-NTSKPLESVSYV
YQGF_ECOLI      -----------------------MSGTLLAFDFGTKSIGVAVGQRIT-GTARPLPAIKAQ
YQGF_ECO57      -----------------------MSGTLLAFDFGTKSIGVAVGQRIT-GTARPLPAIKAQ
YQGF_SALTI      -----------------------MSDTLLAFDFGTKSIGVAIGQRIT-GTARPLPAIKAQ
YQGF_SALTY      -----------------------MSGTLLAFDFGTKSIGVAIGQRIT-GTARPLPAIKAQ
YQGF_HAEIN      -----------------------MGITALAFDFGTKSIGCAIGQSIT-GTAQALPAFKAQ
YQGF_PASMU      -----------------------MGMTVLAFDFGTKSIGCAVGQSIT-GTAQALPAFKAQ
YQGF_YERPE      ----------------------MANRTIIAFDFGTKSIGVAIGQEVT-GTARALTAFKAQ
YQGF_VIBCH      -----------------------MSRTVMAFDYGTKSIGSAIGQEIT-GTASPLKAFKAN
YQGF_VIBVU      -----------------------MSRTIMAFDFGTKSIGSAIGQEIT-GTASPLKAFKAN
YQGF_VIBPA      -----------------------MSRTIMAFDFGTKSIGSAIGQEIT-GTASPLKAFKAN
YQGF_SHEON      ----------------------MNAKTVLGFDFGTKSIGVAVGQQIT-ASATPLLSIKAV
YQGF_PSEAE      ------------------MASDKPLRLLLGFDYGTRQIGVAVGQAVT-GQARELCVLKAQ
YQGF_PSEFL      ----------------------MALRLLLGFDYGTKQIGVAVGQVIT-GQARELCTLKAQ
YQGF_PSESM      ---------------------MAALRLLLGIDYGTKQIGVAVGQAIT-GQARELCTLKAQ
YQGF_PSEPK      ---------------------MADLRLLLGFDYGSKQIGVAVGQVIT-GQARELCTLKAQ
YQGF_BUCBP      -------------------------MIIIALDFGTKNIGVAVGQNYT-NTARSLPSIKVK
YQGF_NEIMA      -------------------MHKIPKGTALAFDFGEARIGVAQGDAEL-GLSHPLATVTGG
YQGF_NEIMB      -------------------MHKIPKGTALAFDFGEARIGVAQGDAEL-GLSHPLSTVTGG
YQGF_RALSO      ----------MPEPARPAPAPVPVHGTLLAFDYGEKRIGVALGNSIT-RSARALEVIPNR
YQGF_XANAC      ---------------MPEAGAIRPDGTVLGFDVGSRRIGVAVGSALG-AGARAVAVINVH
YQGF_XANCP      ---------------MPEAGAIRPDATVLGFDVGSRRIGVAVGTALG-AGARAVAVINVH
YQGF_XYLFA      ---------------MPEASSPFPDGIVLGFDVGTRRIGVAVGSALG-AGARAVAVIDVH
YQGF_MYCPE      --------------------MQNLNSKILAIDFGTKIIGTAINDINL-NLCLPYCEITNN
YQGF_MYCGE      ------------------------MKYILAIDFGLKKIGTAIANTLD-KYPSAFHVFEVK
YQGF_MYCPN      ------------------------MQYILGIDFGLKRIGTALVNTID-RFPSPFRVFAVQ
YQGF_MYCPU      ---------------------MAKVMRKIALDLGTKSCGFAISDPISNSFAIPLENFFFE
YQGF_UREPA      -------------------------MRKLALDLGTKSCGFAISDLLG-IIASGLDNFIYE
YQGF_CHLMU      ------------------MNSMKQKEAFLGVDYGKKRIGLAFASAPL-LITLPIGSINTC
YQGF_CHLTR      ------------------MNIAKQQQAFLGIDYGKKRIGLAFASSPL-LIPLPIGNVEAR
YQGF_CHLPN      ------------------MSKPSSCKAYLGIDYGKKRIGLAYAAEPL-LLTLPIGNIEAG
YQGF_CHLTE      -------------------MSSSSHKRIIGIDFGTKRIGVALSDPLR-MFAQPLGTFDM-
YQGF_DEIRA      ----------MLARMSGPDPAPAALPTVLALDVSKSRIGFAVSAG---RLAFGRGSVDRK
YQGF_RICCN      ---------MIIKNLQEFYRLLIPNVPLIAIDYGNKKLGIALSNQER-SIAMPLNTITEI
YQGF_RICPR      ---------MIIKNLQEFYRLLIPNKPLIAIDYGSKKIGVALSDQEL-SIAMPFNTITAV
YQGF_THEEB      ------------------------MISVLGLDLGRKRIGVAGCDRLG-QLATGITTIYRR
YQGF_SYNY3      ---------------------MSKKVAALGLDVGRKRIGVAGCDGTG-LIATGITTIVRS
YQGF_COREF      ----------MKVTPDTPGRDDPGPGRRIGLDVGTVRIGVAASDRDA-RLAMPVETVPRE
YQGF_CORGL      ----------MKVSADTPGHDDPGPGRRLGLDVGTVRIGVAASDRDA-KLAMPVETVPRE
YQGF_FUSNN      ------------------------MKRYIALDIGDVRIGVARSDIMG-IIASPLETINRK
YQGF_STRCO      ---------MSTPENDQADGPRMRRGRRLAVDVGDARIGVASCDPDG-ILATPVETVPGR
YQGF_MYCLE      MFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDG-ILATPVETVRRY
YQGF_MYCTU      ----MVPAQHRPPDRPGDPAHDPGRGRRLGIDVGAARIGVACSDPDA-ILATPVETVRRD
YQGF_CAMJE      -------------------------MRALALDVGLKRIGVALC--IDKKIALPLDAVLRK
YQGF_HELPY      --------------------------MILACDVGLKRIGIAA---LLNGVILPLEAILRH
YQGF_HELPJ      --------------------------MILACDVGLKRIGIAA---LLNGVILPLEAILRH
                                             . * .    * :                   

YQGF_AERHY      DGI-----PNWDDIDKLLKE--WQPDLLVVGLPLNM-DGTE-QEITVRARKFGNRL-HGR
YQGF_AGRFC      KFT-----QDAQVLLAFAEK--EKVAAFVIGLPINM-DGSA-GPRAQATRAFVRTM-GEK
YQGF_BRADU      AFK-----QDAARLLAIAAE--RKVVGFVLGLPINM-DGSE-GPRAQSTRAFARNL-ANL
YQGF_BACHD      DAN---EQADFEHIASLVKE--HEVTTIVIGLPKNM-DGSI-GPSGERSETFAAEL-RRY
YQGF_BACSU      EAE---GDYGLSRLSELIKD--YTIDKIVLGFPKNM-NGTV-GPRGEASQTFAKVL-ETT
YQGF_NOSS1      SFD-----RDVQQIQNIVNE--RQVQVLVVGLPYSM-DGSL-GFQARQVQKFTSRL-AKA
YQGF_AQUAE      E--------AVKKIKEIVEK--SRVGKVIVGLPLTP-SGKE-GQRAKLVKDFVEKL-REE
YQGF_BACTN      EL--------LNFIGGYVAK--EPVERIIIGLPKQM-NNEA-SENMKNIEPFVRSL-KKR
YQGF_BRUME      KFT-----IDAQVLLKALET--DKVGVIVIGLPMNM-DGTA-GPRVQATRAFVRTM-QPL
YQGF_BRUSU      KFT-----IDAQVLLKALET--DKVGVIVIGLPMNM-DGTA-GPRVQATRAFVRTM-QPL
YQGF_RHIME      KFG-----ADAQALLSFAEK--EKIAAFIIGLPVNM-DGSE-GPRCQATRAFVRNM-GEK
YQGF_RHILO      KFS-----LDAAVLLALLKK--ENVGAVAIGLPINM-DGSE-GPRAQKSRAFVRNM-AQL
YQGF_RHOCB      KFS-----LDLADLMKTVAE--RQIAGFVLGLPVNM-DGSE-GPRAQSTRAFARNL-EKL
YQGF_CAUVC      KFS-----KDAEQLFKLMDS--RGAVAIVIGLPMNM-DGTE-GVRCQSNRALGRNLLRLK
YQGF_CLOAB      NEE-----EDIKELKELCEK--YEVDTIVCGLPKNM-NGTI-GFQSEKVLGFCEVI-KQN
YQGF_CLOPE      CYT-----KDVEAVMKICKE--YGVETIVAGMPKNM-NGTI-GPSGEMVKNLCEQI-EKS
YQGF_CLOTE      NLK-----NDIKEIEDICNE--YKVDKIVSGLPKNM-NGTL-GPQSEKVTEFCDIL-KKE
YQGF_CALS4      SFV-----EDVKAIEEIVKK--YSVEKVVVGLPKNM-NGSI-GPQGEKVIKFGEKL-REV
YQGF_LACLA      SEA---GELGFERLGVLIKE--YKPEKVVLGLPKHM-NGDE-GIRAEASRDYGTKL-ANE
YQGF_LACPL      EDA---EEFGIDRVAELVEE--LDAGGFVLGLPKNM-NNTL-GPRAEAAQHYGELL-TAR
YQGF_LISIN      ESR---KQFGYDRVKELVLE--YEVEKVVVGLPKNM-NNTI-GPRAESSKIYAEVL-ESR
YQGF_LISMO      ENR---KQFGYDRVKELVLE--YEVEKVVVGLPKNM-NNTI-GPRAESSKIYAEVL-EAR
YQGF_STRA3      EES---GNFGFDRLAELVKE--YKVDKFVVGLPKNM-NNTS-GPRVEASQAYGDKI-TEL
YQGF_STRMU      EAK---GEFGFDRLADLVKD--YKVEKFVVGLPKNM-NNTS-GPRVEASQAYGKKI-KEL
YQGF_STRR6      EEQ---GQFGFDRVKELVDT--YKVERFVVGLPKNM-NNTS-GPRVEASQAYGAKL-EEF
YQGF_STRP1      EEK---AEFGFTRLEELVKQ--YQVEQFVIGLPKNM-NNTN-GPRVDASITYGNHI-EHL
YQGF_STRP3      EEK---AEFGFTRLEELVKQ--YQVEQFVIGLPKNM-NNTN-GPRVDASITYGNHI-EHL
YQGF_OCEIH      END---LSSADEELEKIISE--HEIGKAIIGLPKNM-NGTI-GERGEASQRYANHI-EKV
YQGF_STAAM      EEN---NELGIDQLVDIIKK--HNVGTVVIGLPKNM-NNSI-GFRGEASLTYKEKL-LEA
YQGF_STAES      EEQ---DDLGIDQLVKIIKD--NQVGTVVIGLPKNM-NNSI-GFRGEASIKYKEKL-QES
YQGF_BUCAI      NGC-----PNWQLVKNLIQY--WQPQFIVVGLPLNI-NGTK-QKITNKSEKFANLL-KYK
YQGF_BUCAP      NGS-----PDWNNIKNLLKI--WQPKFLVVGLPLNI-DGTR-QDITKKAEKFAFLL-KYK
YQGF_WIGBR      KGV-----PNWGKINNIILL--WEPKYIIVGLPLNM-DGSY-QTSTIKAKKFAKQL-RNK
YQGF_ECOLI      DGT-----PDWNIIERLLKE--WQPDEIIVGLPLNM-DGTE-QPLTARARKFANRI-HGR
YQGF_ECO57      DGT-----PDWNLIERLLKE--WQPDEIIVGLPLNM-DGTE-QPLTARARKFANRI-HGR
YQGF_SALTI      DGT-----PDWTLIERLLKE--WQPDEIIVGLPLNM-DGTE-QPLTARARKFANRI-HGR
YQGF_SALTY      DGT-----PDWTLIERLLKE--WQPDEIIVGLPLNM-DGTE-QPLTARARKFANRI-HGR
YQGF_HAEIN      DGI-----PNWEAIEKCLKE--WKPDVVIVGLPLNM-DGTE-QDLTLRARKFANRL-QGR
YQGF_PASMU      DGI-----PNWDAIGKCLAE--WQPDRVVVGLPLNM-DGTE-QDLTVRARKFAHRL-HGR
YQGF_YERPE      DGT-----PDWQQVEKLLKE--WQPNLVVVGLPLNM-DGTE-QPLTARARRFANRL-HGR
YQGF_VIBCH      DGI-----PNWDEIEKQIKE--WQPNLLIVGLPTDL-HGKDLDTITPRAKKFAQRL-HGR
YQGF_VIBVU      DGI-----PNWDEIEKQIKE--WQPNLLVVGLPTDL-HGKALETITPRAKKFAQRL-QGR
YQGF_VIBPA      DGI-----PNWDDIEKQIKE--WQPDLLVVGLPTDL-HGKDLETITPRAKKFAKRL-QGR
YQGF_SHEON      DGI-----PNWEEIAKLIQE--WQPDLVVVGLPLNM-DGTE-QEMTHRARKFANRL-NAK
YQGF_PSEAE      NGV-----PDWNRVEALIKE--WQPDAIVVGLPLNM-DGSP-SEMSERAEKFGRRL-NGR
YQGF_PSEFL      NGV-----PDWNQVEALIKE--WKPDAVVVGLPLNM-DGTP-SDMCLRAEKFARRL-NGR
YQGF_PSESM      NGV-----PDWDKVQALINE--WKPDAIVVGLPLNM-DGTP-SEMSARAEKFSRKL-NGR
YQGF_PSEPK      NGV-----PDWAQVEKLIAE--WKPDAIVVGLPLNM-DGTP-SEMSARAEKFARRL-NGR
YQGF_BUCBP      NKK-----LNIEKLNKLIDE--WKPNAIVVGHPLNI-DGTK-QKITQCSENFSKKL-KNI
YQGF_NEIMA      SND-----EKFAAIAKLVQE--WQPRYFVVGLPVHT-DGTK-HEMTHLSRKFGRRL-NGR
YQGF_NEIMB      SND-----EKFAAIAKLVQE--WQPRYFVVGLPVHT-DGTK-HEMTHLSRKFGRRL-NGR
YQGF_RALSO      SVE-----YRFTQITRLVNA--WQPVGFVVGMPVHP-EGED-QPMIKLAKRFGNQL-HGR
YQGF_XANAC      ANG-----PDWVALDRVHKQ--WRPDGLVVGDPLTL-DDKD-QPARKRAHAFARQL-RER
YQGF_XANCP      ANG-----PDWVALDRVHKE--WRPAGLVVGDPLTL-DDKD-QPARKRAHAFAREL-RER
YQGF_XYLFA      GVA-----VDWNALDRVKRN--WLPVGLVVGDPLTL-EGHD-QPIRKQAHAFACQL-RER
YQGF_MYCPE      E-------LKFKKILEIVEE--ENIKEIVIGFPKTQ-NSYV-SERHQLIIDFKNQL-SEL
YQGF_MYCGE      NNF----KTAVNNLFLRIKNDGYELEKIVIGFPKF----HYYSDIQKAIKSFKQLL-EKR
YQGF_MYCPN      NNL----QQAVNTLFKDLKQAGYELVQIVIGFP-HF---HYQSSIQVSIHKFVELI-KTR
YQGF_MYCPU      ENN---FKKVINKLKHYEKK--YEFDTIILGYPLRM-TGTR-SERSIMVEEFEKLL-RKT
YQGF_UREPA      END---FTAVLAKIDEIMINYHHEIDTIVLGYPTNVYDGSK-NERTYLIESFYALL-KQH
YQGF_CHLMU      SSL----ALTAQALITIIKE--RAVTTVVFGNPLPM-QKSYASSVQSEIQELAALV-RDM
YQGF_CHLTR      SSL----TLTAQALVSIIKE--RAVTTVVFGNPLPM-QKAYASSVQSEIQELAALI-QEM
YQGF_CHLPN      KNL----KLSAEALHKIILS--RNITCVVLGNPLPM-QKGLYSSLQEEVSLLAEEL-KKL
YQGF_CHLTE      EGL-------VRVLSRVRDD--EGIELVVVGYPMSD-KGEE-NRMTGVIDRFVAEL-RES
YQGF_DEIRA      R-----LPLDLKAVRLKVEE--TGAERLVLGLPLRT-DGKP-SPTADRVRAFGRVL-MDK
YQGF_RICCN      NKK-----IVITSLLNIIEK--YKVCGVIIGLPIDM-SGAV-TEQTNIVMKFAEEL-AKS
YQGF_RICPR      NKK-----VVITSLLNIIKK--YKVCGIVIGLPIDM-SGGV-TQQTNIVMKFAEKL-KQS
YQGF_THEEB      NFA-----SDVAQLRRICQE--RGVEKLIVGLPYTL-DGQL-GSQARQVQHLAEKI-GAA
YQGF_SYNY3      SYD-----QDIAQIKQLVEE--RNVNLLVVGLPYTM-AGEI-GSQAKQVQKFARRV-AEQ
YQGF_COREF      TGMKGPDRGDIDRLIDIITE--YDAVEVVVGLPRDL-QGNG-SASVKQAREIAFRI-RRR
YQGF_CORGL      TGFKGPDLADIDRLVAIVEE--YNAVEVIVGLPTDL-QGNG-SASVKHAKEIAFRV-RRR
YQGF_FUSNN      K------VKSVKRIAEICKE--NDTNLVVVGIPKSL-DGEE-KRQAEKVREYIEKL-KKE
YQGF_STRCO      DVP-----AAHRRLRQLVAE--YEPIEVVVGLPRSL-KGGE-GPAAAKVRRFTQEL-AKG
YQGF_MYCLE      RSA-----KHLRRLAELVVE--LQVVEVVVGLPWTL-TDRT-GSSAKDAIDTAEAL-ARR
YQGF_MYCTU      RSG-----KHLRRLAALAAE--LEAVEVIVGLPRTL-ADRI-GRSAQDAIELAEAL-ARR
YQGF_CAMJE      NR-----NQAANEIKNLLKI--HEISLLIVGIPKG---GSSEEEMTRRIKHFVSLL---E
YQGF_HELPY      NRN-----QASRDLSDLLRE--KNIQVLVVGKPHE-----SYADTNARIEHFIKLV---D
YQGF_HELPJ      NRN-----QASRDLSDLLRK--KDIQVLVVGKP-----NESYADTHARIEHFIKLV---D
                             :                * *                      :    

YQGF_AERHY      F-----WQAVEFKDERLTTTDARARLFE-RGGYRA-LE--KGSVDGVSAQLILEAWMEEQ
YQGF_AGRFC      T-----ALPFIYWDERLSTVAAERALLE-MDVSRA-KR--AERIDSAAASFILQGALDRL
YQGF_BRADU      T-----TLPIGLWDERLSTAAVERELIG-MDVSRA-KR--AEVIDEHAAIFILQGALDRL
YQGF_BACHD      V-----PCEIVMWDERLTTTAAERMLIS-ADVSRK-KR--KSVIDKMAAVMILQGYLDRQ
YQGF_BACSU      Y-----NVPVVLWDERLTTMAAEKMLIA-ADVSRQ-KR--KKVIDKMAAVMILQGYLDSL
YQGF_NOSS1      L-----QLPVEYVDERLTSFQAEQMLIA-ENVSPS-RN--KGLIDRKAAALILQQWLDIR
YQGF_AQUAE      L----PNTEIILWDERWTTAEAMRRL---EGLPPK-KK--KELKDVISAMIILEEYLNSV
YQGF_BACTN      F----PELPVEYVDERFTSVLAHRTMLE-AGLKKK-DRQNKALVDEISATIILQTYLESK
YQGF_BRUME      T-----DLPFVFWDERLSTVAVERALIG-MDVSRG-KR--ADRIDSAAAAFILQGALDRL
YQGF_BRUSU      T-----DLPFVFWDERLSTVAAERALIG-MDVSRG-KR--ADRIDSAAAAFILQGALDRL
YQGF_RHIME      T-----DIPFVLWDERLSTVAAERVLIE-MDVSRK-KR--AERIDSAAASFILQGALDRL
YQGF_RHILO      S-----DLPFVFWDERLSTVAAERTLIE-MDFSRA-KR--AGKIDSAAAAFILQGVLDRL
YQGF_RHOCB      T-----PLPITFWDERLSTVAAERAMLE-ADLSRK-RR--AELVDHVAAGFILQGALDRL
YQGF_CAUVC      P-----DLPITFWDERLSTAAVTRVLIDEHDISRK-RR--DEVVDKMAAGWILQGALERL
YQGF_CLOAB      I-----NVPIKMWDERLTTVTANRAMLE-ADLSRK-KR--KKLVDKVAATYILQGYLNSI
YQGF_CLOPE      F-----DGKIEFWDERLTTVAAHRAMLE-ADLSRA-KR--KKIVDKIAATYILQGYLDRI
YQGF_CLOTE      L-----EKEIIMWDERLTTVAAHKAMIE-GDLSRA-KR--KKIVDKIAAIYILQGYLDSV
YQGF_CALS4      L-----RIPVVFWDERLTTLQAERFLIEGVDMSRG-KR--KKVIDKLAATIILQSYLDSQ
YQGF_LACLA      F-----GLEVAYQDERLTTAQAEKVLID-GGVRRK-ER--KKSIDKLAAVLILQNYLDAH
YQGF_LACPL      F-----HLPVDFEDERLTTVEAERMLVEEANTSRK-KR--KKVIDKLAASLILQNYLDRH
YQGF_LISIN      I-----GLPVVLWDERLTTSAAERTLIE-ADVSRK-KR--KEVIDKLAAVMILQSYLDTT
YQGF_LISMO      I-----GLPVVLWDERLTTSAAERTLIE-ADVSRK-KR--KEVIDKLAAVMILQSYLDTT
YQGF_STRA3      F-----NLPVEYQDERLTTVQAERMLVEQADISRG-KR--KKVIDKLAAQLILQNYLDRM
YQGF_STRMU      F-----DLPVEYQDERLTTVQAERMLVEQADVSRG-KR--KKVIDKLAAQLILQNYLDRM
YQGF_STRR6      F-----GLPVDYQDERLTTVAAERMLIEQADISRN-KR--KKVIDKLAAQLILQNYLDRK
YQGF_STRP1      F-----GLPVHYQDERLTTVEAKRMLIEQADISRG-KR--KKVIDKLAAQLILQNYLNRN
YQGF_STRP3      F-----GLPVHYQDERLTTVEAERMLIEQADISRG-KR--KKVIDKLAAQLILQNYLNRN
YQGF_OCEIH      F-----QIPVDLWDERLTTMAAERVLLE-ADMSRS-KR--KKVIDKMAAVMILQGYLDQK
YQGF_STAAM      Y----PSIEIVMWDERLSTMAAERSLLE-ADVSRQ-KR--KQVIDKMAAVFILQGYLDSL
YQGF_STAES      I----PSIDIVMWDERLSTMAAERSLLE-ADVSRQ-KR--KKVIDKMAAVFILQGYLDSI
YQGF_BUCAI      F-----NIVVKMHDERLTTVEAKSIIFK-KNGFKG-LK--EEKIHSCAAVIILESWFNQY
YQGF_BUCAP      F-----NIFVYLHDERLSTKEAKSLIFK-KNGFKV-LK--KEKIHSVAAVIILESWFNQN
YQGF_WIGBR      F-----FMPVMMHDERLTTIEAKSVLFK-KYGYKG-LK--KKLIDSESAVIILDSWMNSI
YQGF_ECOLI      F-----GVEVKLHDERLSTVEARSGLFE-QGGYRA-LN--KGKVDSASAVIILESYFEQG
YQGF_ECO57      F-----GVEVKLHDERLSTVEARSGLFE-QGGYRA-LN--KGKIDSASAVIILESYFEQG
YQGF_SALTI      F-----GVTVTLHDERLSTVEARSGLFE-RGGYRA-LN--KGKVDSASAVIILESYFEQG
YQGF_SALTY      F-----GVTVTLHDERLSTVEARSGLFE-RGGYRA-LN--KGKVDSASAVIILESYFEQG
YQGF_HAEIN      F-----GVNVHLQDERLTTTQARSEIFE-RGGFKA-LK--KGKIDGVSACLILESWFEYA
YQGF_PASMU      F-----GVAVELQDERLTTTEARAEIFG-RGGYKA-LN--KSKVDGISACLILESWFENQ
YQGF_YERPE      F-----GVQVALQDERLSTVEARANLFD-RGGYRA-LD--KGSVDAASAVIILESWFDEQ
YQGF_VIBCH      F-----GLPVELHDERLSTTEARAELFA-MGGYKA-LS--KGNVDCQSAVIILESWFESQ
YQGF_VIBVU      F-----GLPVELHDERLSTTEARSELFS-MGGYKA-LS--KGNVDCQSAVIILESWFEAQ
YQGF_VIBPA      Y-----GLPVELHDERLSTSEARAELFS-MGGYKA-LS--KGNIDCQSAVVILESWFEAL
YQGF_SHEON      F-----GVKIFTQDERLTTTDAKARLFE-LGGYKA-LT--KGQVDAVSAVLIIESYFENH
YQGF_PSEAE      F-----NLPVFTHDERLTTYAAKGERLA-QGQRDG-YR--ERPVDALAAALLLEGWLAEH
YQGF_PSEFL      Y-----NLPFYTHDERLTTFEAKGERLVRGGQKGS-YR--DNPVDAIAAALLLQGWLDAN
YQGF_PSESM      F-----GVTVYTHDERLTTFEAKGERMARGGQKGS-YR--DNPVDAIAAALLLQGWLDEH
YQGF_PSEPK      F-----NLPVHTHDERLTTFEAKGERMARGGQRGS-YR--DNPVDAIAAALLLQGWLEAN
YQGF_BUCBP      F-----KIPILLHDERLSTVEAKAILFE-KYGYKS-LK--KERIDSMSAVIILESWFLYS
YQGF_NEIMA      F-----NLPVYWVDERLSSVYAESLLSE-AQVFGK-KR--KSVLDQVAAQAILHGFFEGG
YQGF_NEIMB      F-----NLPVYWVDERLSSVYAESLLSE-AQVFGK-KR--KSVLDQVAAQAILHGFFEGG
YQGF_RALSO      Y-----GLPVTWVDERYSSIAAQD-----AGAT-------DDVLDAEAARIILQQFFDES
YQGF_XANAC      Y-----ALPVVLIDERSSSVEAAQRFARERADGRK-RRRDAEALDAMAAAVIVERWLAAP
YQGF_XANCP      Y-----ALPVVLIDERSSSVEAAQRFARERADGRK-RRRDADTLDAMAAAVIVERWLSAP
YQGF_XYLFA      Y-----RLPVVLVDERSSSVEAASRFAGARAAGYK-RRRDADTLDAIAAAVILERWLADP
YQGF_MYCPE      L--KNKNIEICFFDESYSTKSSKESLMN-FNVKTS-KL--KKNKDMIAASIILENYLASK
YQGF_MYCGE      F-----NLPIILVDESNTTSAVKDKLIT-MDLKHK-DF--KKAKDTLAAVLILERFFQNY
YQGF_MYCPN      F-----NVPVTLIDESGTTSEVKANLQE-LGLKNR-TF--KKAKDTLAATLILERFLNQQ
YQGF_MYCPU      F-----SQRIVLVDERLSTVKAKAMLKE-TNISQS-KI--KEKKDSMAAALLLNYYLNNF
YQGF_UREPA      F-LNHEKIKIVYEDERFSTKIATQRLKN-SCVKAA-KI--KKVKDKMSAVVILESYLSKN
YQGF_CHLMU      T-----SLEVILWDERLSSAQAERMLKNDCGLSRK-QR--KNSSDSLAATLILSSFLDSR
YQGF_CHLTR      T-----AIEVILWDERLSSAQAERMLKSDCGLNRK-QR--KNPSDSLAATLILSSFLDSR
YQGF_CHLPN      S-----TVEIILWDERLSSVQAERMLKQDCGLSRK-DR--KGKTDSLAATLILTSFLDSL
YQGF_CHLTE      F----PGTLIETFDEHRSSRTAMKILAA-SGSSRK-KRNEKGRLDTAAACLILQGYLDSH
YQGF_DEIRA      ------GYTVEYQDERFTTQRA-RAL----GAA---------DEDEAAAVQILELWLMR-
YQGF_RICCN      I-----NLPIYLQDERLTTKAANNLLKS-FGVKRK-DR--NNNDDAVAASMILETVLDSI
YQGF_RICPR      L-----GLPIYLQDERLTTKSANNFLKS-FGIKRK-DR--NHNDDAVAASMILEIVLNAI
YQGF_THEEB      L-----NLPVEYIDERLTSFQAEEILKQ-RRRSPR-HH--KDLVDQIAAALILQQWLDAR
YQGF_SYNY3      L-----HLPLEYMDERLSSVEAENQLKA-RKRFSS-YD--KGLIDQQAAEIILQQWLDLR
YQGF_COREF      LTATGREIPVRLGDERLTTVVATQALRA-SGINER-DG--RKVIDQAAAVEILQTWLDGR
YQGF_CORGL      LTNAGKNIPVRLGDERLTTVVATQALRA-SGVSEK-AG--RKVIDQAAAVEILQTWLDAR
YQGF_FUSNN      I----ENLEIIEVDERFSTVIADNILKE-LNKNGAIEK--RKVVDKVAASIILQTYLDMK
YQGF_STRCO      I----APVPVRLVDERMTTVTASQGLRA-SGVKSK-KG--RSVIDQAAAVIILQQALESE
YQGF_MYCLE      V----APVPVRLVDERLTTVSAQRLLRA-AGVRAK-DQ--RAVIDQAAAVVILQNWLDQC
YQGF_MYCTU      V----SPTPVRLADERLTTVSAQRSLRQ-AGVRAS-EQ--RAVIDQAAAVAILQSWLDER
YQGF_CAMJE      F-----DKEICFVDESGTSKEA---LGYGVANTR--KK--DGKLDSLSAFIMIKDYFAL-
YQGF_HELPY      F----KGEIVFINEDR-SSIEAYENL-EHLGKKNKRLAIKDGRLDSLSACRILERYCQKV
YQGF_HELPJ      F----KG-EIVFINEDNSSVEAYENL-EHLGKKNKRIATKDGRLDSLSACRILERYCQQV
                         .   ::  ::                         .  :*  ::       

YQGF_AERHY      YG---------------------
YQGF_AGRFC      SALTRAAD---------------
YQGF_BRADU      ANLRTGNG---------------
YQGF_BACHD      QLK--------------------
YQGF_BACSU      N----------------------
YQGF_NOSS1      RTNAQSSVAVEY-----------
YQGF_AQUAE      -----------------------
YQGF_BACTN      RF---------------------
YQGF_BRUME      HMMRRNDYDAG------------
YQGF_BRUSU      HMMRRNDYDAG------------
YQGF_RHIME      ASLARGASGDRDAP---------
YQGF_RHILO      QSLDSAARTELGGRTEPGPTDAA
YQGF_RHOCB      AHLGRAHG---------------
YQGF_CAUVC      RGL--------------------
YQGF_CLOAB      -----------------------
YQGF_CLOPE      SK---------------------
YQGF_CLOTE      YNK--------------------
YQGF_CALS4      KNS--------------------
YQGF_LACLA      ALKL-------------------
YQGF_LACPL      GKLTQE-----------------
YQGF_LISIN      N----------------------
YQGF_LISMO      N----------------------
YQGF_STRA3      F----------------------
YQGF_STRMU      F----------------------
YQGF_STRR6      F----------------------
YQGF_STRP1      F----------------------
YQGF_STRP3      F----------------------
YQGF_OCEIH      -----------------------
YQGF_STAAM      H----------------------
YQGF_STAES      Q----------------------
YQGF_BUCAI      -----------------------
YQGF_BUCAP      LY---------------------
YQGF_WIGBR      YFKK-------------------
YQGF_ECOLI      Y----------------------
YQGF_ECO57      Y----------------------
YQGF_SALTI      Y----------------------
YQGF_SALTY      Y----------------------
YQGF_HAEIN      EY---------------------
YQGF_PASMU      QVK--------------------
YQGF_YERPE      AG---------------------
YQGF_VIBCH      WG---------------------
YQGF_VIBVU      WG---------------------
YQGF_VIBPA      WGE--------------------
YQGF_SHEON      FGD--------------------
YQGF_PSEAE      PD---------------------
YQGF_PSEFL      AALFET-----------------
YQGF_PSESM      PELLNV-----------------
YQGF_PSEPK      T----------------------
YQGF_BUCBP      KN---------------------
YQGF_NEIMA      PAECFNGREG-------------
YQGF_NEIMB      PAECFNGREG-------------
YQGF_RALSO      HA---------------------
YQGF_XANAC      DQATLLP----------------
YQGF_XANCP      EQATLLP----------------
YQGF_XYLFA      MQATSLP----------------
YQGF_MYCPE      K----------------------
YQGF_MYCGE      H----------------------
YQGF_MYCPN      KPN--------------------
YQGF_MYCPU      LGVR-------------------
YQGF_UREPA      HFN--------------------
YQGF_CHLMU      KLY--------------------
YQGF_CHLTR      KLY--------------------
YQGF_CHLPN      PKKLTL-----------------
YQGF_CHLTE      S----------------------
YQGF_DEIRA      -----------------------
YQGF_RICCN      KNI--------------------
YQGF_RICPR      KRFNL------------------
YQGF_THEEB      SQTAKATLAAGDPQL--------
YQGF_SYNY3      RSHLQEGGDNLHR----------
YQGF_COREF      ATALNTLPETPHTDEKGNFPR--
YQGF_CORGL      TRALEPQSTDTQDFDEKGNFPG-
YQGF_FUSNN      K----------------------
YQGF_STRCO      RVSGRPPGEGVEVVI--------
YQGF_MYCLE      RAATPARADEPTTGSVAGEVIDG
YQGF_MYCTU      LAAMAGTQEGSDA----------
YQGF_CAMJE      -----------------------
YQGF_HELPY      LKNH-------------------
YQGF_HELPJ      LKKG-------------------