CLUSTAL format seed alignment for MF_00652

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y504_VIBPA       -MLIVVSPAKTLDYES---PLATEKFTQPELIEYSKELIDVCRKLTPAD---VASLMKVS
Y535_VIBVU       -MLIVVSPAKTLDYES---PLVTHKFTQPELVDYSKQLIEVCRQLTPAD---VASLMKVS
Y2355_VIBCH      -MLIVVSPAKTLDYES---PVSTSNFTQPELTAHSAELIQVCRTLSSQD---VSELMSVS
YAAA_ECOL6       -MLILISPAKTLDYQS---PLTTTRYTLPELLDNSQQLIHEARKLTPPQ---ISSLMRIS
YAAA_ECO57       -MLILISPAKTLDYQS---PLTTTRYTLPELLDNSQQLIHEARKLTPPQ---ISTLMRIS
YAAA_ECOLI       -MLILISPAKTLDYQS---PLTTTRYTLPELLDNSQQLIHEARKLTPPQ---ISTLMRIS
YAAA_SALTI       -MLILISPAKTLDYQS---PLATTRYTQPELLDHSQQLIQQARQLSAPQ---ISRLMGIS
YAAA_SALTY       -MLILISPAKTLDYQS---PLATTRYTQPELLDHSQQLIQQARQLSAPQ---ISRLMGIS
Y462_YERPE       -MLIIISPAKTLDYQS---PLATTKFSQPEMLDKSQALIEICRELTPAQ---ISSLMGIS
Y984_HAEIN       -MLAIISPAKTLDFES---AVKNFPVSQPHFTDYSEQLIEVCRKLSPQD---LSSLMSIS
Y066_PASMU       -MLAIISPAKTLDFES---AVPKFEFSQPQLTEYSAQLIDVCRQLSPAE---IGSLMSIS
Y1289_PSEPK      -MLTVISPAKTLDYDT---PPVTERFTLPQYLDESQALIQQLRELSPAQ---ISELMHLS
Y1244_PSESM      -MLMVISPAKTLDFET---PPTTARFTRPQYLDHSQELITQLRELTPAQ---ISELMHLS
Y3539_PSEAE      -MLMVISPAKTLDYET---PPVTHRFTQPQYLDHAQELIQQLRQLTPLQ---ISELMKLS
Y3540_SHEON      -MLILVSPAKTLDFEQ---PPLTQIHTRPDFLAQSQELIQVCQQLTPSD---IATLMKVS
Y1114_NEIMA      -MFFVLSPAKNLNEKD---PAPVSEFTQPDLLAESDILMQQLRELAPQQ---IAELMHVS
Y895_NEIMB       -MFFVLSPAKNLNEKD---PAPVSEFTQPDLLAESDILMQQLRELAPQQ---IAELMHVS
Y2009_RALSO      -MIIVLSPAKSLDYDT---PPRIKTHTLPDFIERSAVLIETLRKLSPAQ---IGTLMHIS
Y3385_CAUVC      -MLMVISPAKSLDFTA---PQTVLPLTTPELKAQIAELSKVTRKLTAAD---LKRLMHIS
Y2152_CLOPE      -MIALLSPAKTLDLTK---PNLNIETSKPIFISEAEVIMNNLKELEIQD---LCPLMKIS
Y754_RICCN       -MLAIISSAKTLNFEK---LAPKTELTIPMFLTLTNKLLSTLQSYSENQ---LSKIMNIS
Y3985_RICRS      -MLAIISSAKTLNFEK---LAPKTELTIPVFLTLTNKLLATLQSYSENQ---LSKIMNIS
Y3869_BACTN      -MLVLLSCAKTMSAVS---KVKVPLTTSPRFQKEAAEIALQMSQFSVDE---LERLLRVN
Y089_LACPL       -MKIIIAPAKKMIIDQ---D-AFPALTEPIYLDQTQQLLAQLQHLTYPE---AKTLWHCS
Y2036_STRA3      MIKILIPTAKEMKVC--------QNIARPKLSAQTKIIIDYFSTLTVSD---LEDIYRIN
Y2081_STRA5      MIKILIPTAKEMKVC--------QNIAWPKLSAQTKIIIDYFSTLTVSD---LEDIYRIN
Y2104_STRP1      MLTFLIPTAKEMTIP--------KESHPHLLPQDSQAILKIMAAMTTED---LAKSYRIK
Y1790_STRP3      MLTFLIPTAKEMTIP--------KESHPHLLPQDSQAILKIMAAMTTED---LAKAYRIK
Y2163_STRP8      MLTFLIPTAKEMTTP--------KESHPHLLPQDSQAILKIMTAMTTED---LAKSYRIK
Y2070_STRMU      -MKFLIPTAKEIKED--------NKPYPQHLSQKSQILVNHMNALSIEE---LEKSYKVS
Y1547_STRPN      -MKILIPTAKEMNTDF-------PSIEAIPLKPESQAVLDALALYSASQ---LESFYKVS
Y1405_STRR6      -MKILIPTAKEMNTDL-------PSIEAIPLKPESQTVLDALALYSASQ---LESFYKVS
Y1889_COREF      -MLILLPPSETKTPGGAGAPLDLPSLSFPELTDVRESIITDLGALSPDD---ALPVLGIS
Y1995_CORGL      -MLIVLPPSETKTHGGSGKPLDFHHLSFPSLTKARQTILADLQALEVDE---ALKVLGIS
Y2297_STRCO      -MLVLLPPSEGKAASGRGAPLKTGSLSLPGLTAAREAVLGELVELCAGDEEKAREVLGLS
Y1762_FUSNN      -MKIIFSPSKEMREEN-IFENKKIEFTESKFKDKTNILIKILSKKSINE---IENIMKLK
Y627_MYCPE       -MKILISPSKTQNKN---IDSFSNNEENILFTNKTNELNDLLIKSINNE--KFNSWLELK
                  :  :.. ::                           :          :          .

Y504_VIBPA       DK-IADLNVGRFQEWSETFTTENSRQAILAFKGDVYTGLEAETLSDADFEYAQKHLRMLS
Y535_VIBVU       DK-IADLNVGRFQEWSEEFTPDNARQAILAFKGDVYTGLEAETLNDDDFDYAQKHLRMLS
Y2355_VIBCH      DK-IAGLNVARFAQWSETFTLDNARQAIFAFKGDVYTGLEAETLSPQDLDFAQQHLRMLS
YAAA_ECOL6       DK-LAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLS
YAAA_ECO57       DK-LAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLS
YAAA_ECOLI       DK-LAGINAARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLS
YAAA_SALTI       DK-LADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFAQQHLRMLS
YAAA_SALTY       DK-LADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFAQQHLRMLS
Y462_YERPE       DK-LAGLNAARFSEWQPDFTPANARQAILAFKGDVYTGMQAESFSEADFDFAQQHLRMLS
Y984_HAEIN       DK-LAGLNAARFAEWTKIHNENNSRPALFAFKGDVYTGLDADSLSEDDVIFAQSHLRMLS
Y066_PASMU       DK-LAGLNFARFAEWQKAHTEQNSRAAIYAFKGDVYTGLDVESLSQQDVLFAQQHLRMLS
Y1289_PSEPK      DK-LAGLNAARFGSWTPDFTPANAKQALLAFKGDVYTGLDAESLSEDDFSYAQGHLRMLS
Y1244_PSESM      DK-LAGLNAARFGSWDPAFTLDNAKQALLAFKGDVYTGLQAETLSDAQLDYAQDHLRMLS
Y3539_PSEAE      DK-LAGLNAARYASWHPEFTPENAKQALLAFKGDVYTGLNAEDFGEDDFAFAQDHLRMLS
Y3540_SHEON      DS-IAGLNAARFGEWKPDYSIDNAKQAIFAFRGDVYTGFDADTLTAAQLERTQSQLRILS
Y1114_NEIMA      DK-IALLNAQRNAEWNTPFTPENAKQAVFMFNGDVYEGMDANTLNTDQIQYLQGRVRLLS
Y895_NEIMB       DK-IALLNAQRNAEWNTPFTPENAKQAVFMFNGDVYEGMDANTLDIGQIRYLQNHVRLLS
Y2009_RALSO      DP-LAVLNANRYADWSTEFTADNSKQAVLAFDGDVYGGLDANTLSADDLQFAQQHLRILS
Y3385_CAUVC      DA-LATLNRERFQAFDPEV--EEGLQAVIAFNGDVYAGLNARELDRPALEWAQDHLRILS
Y2152_CLOPE      ED-LGVQTFTKIQDWNTIYYGDE-KPFVLSFKGEAYRGLDADDFTKEDLEFCNDSLRILS
Y754_RICCN       AK-LALINKERFKDFDNQE----SKAAIFTYAGDVFNNIHIEKLTNHALNFLQSHLLIIS
Y3985_RICRS      AK-LAHINKERFKDFDNQE----SKAAIFAYAGDVFNNIHIEKLTNHALNFLQSHLLIIS
Y3869_BACTN      AK-IAVENYKRYQAFHAETTPE--LPALLAYTGIVFKRLNPKDFSAEDFGYAQEHLRLTS
Y089_LACPL       DK-LAQPNYDWLQKIDLTR---NLTPAILSYSGIQYRYMAPDVFTQPALDYIQANLRILS
Y2036_STRA3      TS-AARCEAQRWQDFKSKQL--TLNPAIKLFNGLMYRNIKRHNLSTSEAQFMENSVFITS
Y2081_STRA5      TS-AARCEAQRWQDFKAKQL--TLNPAIKLFNGLMYRNIKRHNLSTSEAQFMENSVFITS
Y2104_STRP1      EE-SAKKEQQRWQDMASQQS--LAYPAYQLFNGLMYRHIKRDKLTTQEQAYLTQQVYITS
Y1790_STRP3      EE-AAKKEQQRWQDMASQKS--LAYPAYQLFNGLMYRHIKRDKLTTQEQAYLTQQVYITS
Y2163_STRP8      EE-AAKKEQQRWQDMASQQS--LAYPAYQLFNGLMYRHIKRDKLTTQEQAYLTQQVYITS
Y2070_STRMU      PQ-IAQTELLKWQDIKNGEA--LAYPALYLFNGLMYRHIKRQHLTVEEKAFLKEKVFITS
Y1547_STRPN      AE-KAAEEFQNIQALKRQTA--QHYPALKLFDGLMYRNIKRDKLTEAEQDYLENHVFITS
Y1405_STRR6      AE-KAAEEFQNIQALKRQTA--QHYPALKLFDGLMYRNIKRDKLTEAEQDYLENHVFITS
Y1889_COREF      EK-LRPEAVANTVLRSAPT-----MPAVLRYSGVLYDALAADTLTPAALNR----LAIGS
Y1995_CORGL      EK-LRPEAESNRALETSPT-----MPAIFRYSGVLYDALDAATLPEKALER----LAIGS
Y2297_STRCO      EG-LRGEVAKNTELLTAGA-----RPAGEIYTGVLYDALDLASLDAAAKRRAARSLLVFS
Y1762_FUSNN      GE-LLNNTYKDIQNYDKLKY----IPAISMYYGVSFKELELEDYSEKSLKYLKNNLLILS
Y627_MYCPE       NNSLIEETIKDIKEFKNNK----AYKAIEFYDGLQFKNILYSQLSETQKTKLNESLIIIS
                                               : *  :  :                : : *

Y504_VIBPA       GLYGLLKPLDLMQPYRLEMGTKLANDKG--SNLYQFWGNVITDKLNEAIAEQGDNVLINL
Y535_VIBVU       GLYGLLKPLDLMQPYRLEMGTKLANPKG--SNLYQFWGNVITEKLNEAIVAQGDNVLINL
Y2355_VIBCH      GLYGVLRPLDLMQPYRLEMGTKLANARG--ANLYQFWGDIITEKLNQAIEAQGDNVLVNL
YAAA_ECOL6       GLYGVLRPLDLMQPYRLEMGIRLENARG--KDLYQFWGDIITNKLNEALAAQGDNVVINL
YAAA_ECO57       GLYGVLRPLDLMQPYRLEMGIRLENARG--KDLYQFWGDIITNKLNEALAAQGDNVVINL
YAAA_ECOLI       GLYGVLRPLDLMQPYRLEMGIRLENARG--KDLYQFWGDIITNKLNEALAAQGDNVVINL
YAAA_SALTI       GLYGVLRPLDLMQPYRLEMGIRLENPRG--KDLYQFWGDIITDKLNEALEAQGDRVVVNL
YAAA_SALTY       GLYGVLRPLDLMQPYRLEMGIRLENPRG--KDLYQFWGDIITDKLNEALEAQGDRVVVNL
Y462_YERPE       GLYGLLRPLDLMQPYRLEMGTKLANPRG--KDLYAFWGDQITEKLNQALELQGDNILINL
Y984_HAEIN       GLYGLLKPLDLMQPYRLEMGTKLANPKG--KDLYAFWGNVITQAVQQAIDEQGDNVLVNL
Y066_PASMU       GLYGLLKPLDLMQPYRLEMGTKLVNSKG--KDLYAFWGNVITDTLQQAIEAQGDNVLVNL
Y1289_PSEPK      GLYGLLRPLDLMQPYRLEMGTKLANARG--KDLYAFWGTRISEWLNQALADQGDDVLLNL
Y1244_PSESM      GLYGLLRPLDLMQPYRLEMGTRLANARG--KDLYAFWGTRISEWLNEALADQGDDLLLNL
Y3539_PSEAE      GLYGVLRPLDLMQPYRLEMGTRLANARG--KDLYAFWGERISQWLNEALAAQGDDVLLNL
Y3540_SHEON      GLYGLLRPLDLILPYRLEMGTALTNQKG--KNLYEFWGNTLTDAVNSAVAAQGDGIIINL
Y1114_NEIMA      GLYGLLRPLDLIQPYRLEMGTAFANLRG--KNLYEFWGDIITNLLNDTLAQAGSNTLVNL
Y895_NEIMB       GLYGLLRPLDLIQPYRLEMGTAFANLRG--KNLYEFWGDIITNLLNDTLAQAGSNTLVNL
Y2009_RALSO      GLYGVLRPLDRMQPYRLEMGTRLANPGG--KDLYAFWGDDVTLALNALLQADDDPVLVNL
Y3385_CAUVC      GLYGVLRPFDALQPYRLEMGTRLKTKKG--ANLYDFWGETISRTLNQAAEGHADPTLVNL
Y2152_CLOPE      GLYGALKPLDGTKAYRLEMGTKISIDGS--KNLYDFWGNKIMEAVLKDLENHKEKVIINL
Y754_RICCN       GLYGVLKPLDTIKPYRLEMATKLNE-----INLTNFWQDEVTNYINKILAKQENKYLLNL
Y3985_RICRS      GLYGVLKPLDTIKPYRLEMATKLNE-----INLTNFWQDEVTNYINKILAKQENKYLLNL
Y3869_BACTN      FCYGLLRPLDVIRAYRLEGDVVLPELGN--QTLFSYWRSRLTDTFIEDIRSAG-GILCNL
Y089_LACPL       GFYGILRPFDGIVPYRLEMQARLAVGQA--KNLYAFWGDRLYQALTPRPEP-----IINL
Y2036_STRA3      ALYGIIPAMTLISPHRLDFNTKIKIN-N--NSLKVFWRENYDTFMQS------DDIMVSL
Y2081_STRA5      ALYGIIPAMTLISPHRLDFNTKIKIN-N--NSLKVFWRENYDTFMQS------DDIMVSL
Y2104_STRP1      SFYGIIPANHPIAEHRHDFHTRIKIE-G--QSLKSYWRPCYNQFAKE------HPQVISL
Y1790_STRP3      SFYGIIPANHPIAEHRHDFHTRIKIE-G--QSLKSYWRPCYNQFAKE------HPQVISL
Y2163_STRP8      SFYGIIPANHPIAEHRHDFHTRIKIE-G--QSLKSYWRPCYNQFAKE------HPQVISL
Y2070_STRMU      ALYGIIPALKPIVPHRLDFNTKVKIK-G--ESLKNYWRKTYDNFVLD------NPSIVSL
Y1547_STRPN      ALYGVVPVLSPMAPHRLDFLMKLKVA-G--KTLKSHWKAAYDETLKK------EEVIFSL
Y1405_STRR6      ALYGVVPALSPMAPHRLDFLMKLKVA-G--KTLKSHWKAVYDEALKK------EEVIFSL
Y1889_COREF      ALFGVVRAGDHIPHYRLSGGTKLPGAQGTTPTMKARWGTTITDALAGV-----DELIIDL
Y1995_CORGL      ALFGVIHATDPIPHYRLSGGTKLPTKSGELPTMKARWGTSISEALIDV-----NQLVIDL
Y2297_STRCO      GLWGAVRMTDRIPSYRCSMGVKLPG----LGALGAHWRAPMAEVLPEAA---GDGLVLDL
Y1762_FUSNN      TLYGASLAFDLLKKYRLDMTMSITD-----KGLYNFWKKDVNDYISNILNK--DEILLNL
Y627_MYCPE       GFYGIVFPNSYIKPYRLMLGSKINIPNY--KNLYDFWFKEFNQKLEELNP---DKLIINL
                   :*          :*      .         :   *                   : .*

Y504_VIBPA       ASNEYFKAVK--PKNLDAQVITPIFKDCKNGQYKVISFYAKKARGMMARYIIENRIES--
Y535_VIBVU       ASNEYFKAVK--PKALDAQVITPIFKDAKNGQYKVISFFAKKARGMMARYIIENRISS--
Y2355_VIBCH      ASNEYFKAVN--PKRLNAQIVTPIFKDAKNGQYKIISFFAKKARGMMARYIIENRIKS--
YAAA_ECOL6       ASDEYFKSVK--PKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTK--
YAAA_ECO57       ASDEYFKSVK--PKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTK--
YAAA_ECOLI       ASDEYFKSVK--PKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTK--
YAAA_SALTI       ASEEYFKSVK--PKKLDAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIENRLTK--
YAAA_SALTY       ASEEYFKSVK--PKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIENRLTK--
Y462_YERPE       ASDEYFKAVK--PAKLSGSLIKPVFLDEKNGKYKIISFYAKKARGLMSRFIIQNKLTK--
Y984_HAEIN       ASDEYYKSVK--ESQINAKIIKPVFLDNKNGKYKVISFYAKKARGLMCRYIIQHHLTE--
Y066_PASMU       ASDEYYKSVK--ESQLNVRIIKPVFLDNKNGKYKVISFYAKKARGLMCRYIIQNRLSE--
Y1289_PSEPK      ASNEYFSAVK--RSALKARVINVDFKDQKNGQYKIISFYAKKARGMMSRFVIQQRIST--
Y1244_PSESM      ASTEYFSAVK--RSALKARIIDTEFKDLKNGHYKIISFYAKKARGMMSRFVIEERINS--
Y3539_PSEAE      ASNEYFGAVK--RKALQARVIDTEFKDLKNGQYKIISFYAKKARGMMARYVIRERLRD--
Y3540_SHEON      ASNEYFKAIK--PKFLNGQLITPVFKDFKNGQYKVISFFAKRARGMMARYIIDQQVSS--
Y1114_NEIMA      ASQEYFKSVN--TKKLRARLITPIFKDEKNGKYKIISFYAKRARGLMVRYAAEHNITD--
Y895_NEIMB       ASQEYFKSVN--TKKLRARLITPIFKDEKNGKYKIISFYAKRARGLMVRYAAEHHITD--
Y2009_RALSO      ASEEYFKVVR--PKVLKARIVTPVFEDWKGGRYKIISFYAKRARGLMARYAIEHRIAD--
Y3385_CAUVC      ASQEYFGAVD--AKALKLPVVTCHFKEEKGGELRVLGFFAKKARGRMARYIIDNRIDQ--
Y2152_CLOPE      ASNEYYKSIK--KIDKKVRVITPVFKERKGIEYKVVTVYAKKARGQMVRYITKNRITK--
Y754_RICCN       ASQEYSSVIN--PNKLKYQLVNVHFKENRNGKLSRIGINAKKARGAMVKVIANNLIDS--
Y3985_RICRS      ASQEYSSVIN--PNKLKYQLVNVHFKENRNGKLSTIGINAKKARGAMVKVIANNLIDS--
Y3869_BACTN      ASDEMKSLFDWKRVESEVRVVTPEFHVWKNGKLATIVVYTKMSRGEMTRFILKNKIGT--
Y089_LACPL       ASQEYAKTIA-PYLAPHQSMIDIVFASFIDGKLKTKATLARMARGAMVRFLAEHQIDD--
Y2036_STRA3      LSNEFETVFS---PKERQKLIHLNFIEDRDGQLKTHSTISKKARGKCLTAMMENNCQT--
Y2081_STRA5      LSNEFETVFS---PKERQKLIHLNFIEDRDGQLKTHSTISKKARGKCLTAMMENNCQT--
Y2104_STRP1      LSSEFDDVFS---KDCKQLWISPKFMAEKEGQFKTHSTISKKARGAFLTACMENNCQT--
Y1790_STRP3      LSSEFDDVFS---KDCKQLWISPKFMAEKEGQFKTHSTISKKARGAFLTACMENNCQT--
Y2163_STRP8      LSSEFDDVFS---KDCKQLWISPKFMAEKEGQFKTHSTISKKARGAFLTACMENNCQT--
Y2070_STRMU      LSSEFEAVFS---PKLRNQLITLRFLENQNGQLKSHSTISKKARGAFLTQVIQQQTKT--
Y1547_STRPN      LSSEFETVFS---KEIRAKMVTFKFMEDRGGQLKIHSTISKKARGAFLTALIENQVQT--
Y1405_STRR6      LSSEFETVFS---KEIRAKMVTFKFMEDRGGQLKIHSTISKKARGAFLTALIENQVQT--
Y1889_COREF      RSGTYQQLGK---VPGAVTVRVESV--LGDGTRKVVSHFNKHYKGELARVLATSPREATT
Y1995_CORGL      RSGTYQQLGR---VKDAVTVRVESV--MEDGSRKVVSHFNKHYKGELARVLALSEKEAHN
Y2297_STRCO      RSAAYAAAWK---PKGEVAARTATVRVLHAPTRKVVSHFNKATKGRIVRSLLATGTAPEG
Y1762_FUSNN      ASSEFSKLID----NKKISMINIDFKEEEDGTYKSISIYSKKARGKFLNYLVKNQVSN--
Y627_MYCPE       ASGEYSKLID----NSIFNVINVDFKLFKSNKYVSLSTFSKQCRGYFINQFLNINLDI--
                  *                      .               :  :*               

Y504_VIBPA       -VADLTKFDTAGYYFVEEESTPT----DLVFKREEQN-
Y535_VIBVU       -VADLTQFDSAGYYFVEEESTPT----ELVFKREEQH-
Y2355_VIBCH      -VKDLEGFNTAGYYFVASESTPT----ELVFKREEQ--
YAAA_ECOL6       -PEQLTGFNSEGYFFDEASSSNG----ELVFKRYEQR-
YAAA_ECO57       -PEQLTGFNSEGYFFDEASSSNG----ELVFKRYEQR-
YAAA_ECOLI       -PEQLTGFNSEGYFFDEDSSSNG----ELVFKRYEQR-
YAAA_SALTI       -PEQLTAFDREGYFFDEETSTQD----ELVFKRYEQ--
YAAA_SALTY       -PEQLTAFDREGYFFDEETSTQD----ELVFKRYEQ--
Y462_YERPE       -PEQLVDFNLEGYEFDAGLSAKN----ELVFKRAEQH-
Y984_HAEIN       -IEQLKEFDLGGYWFDSASSTET----EFVFKRDINE-
Y066_PASMU       -VEQLKGFDLGGYWFDPTSSSET----EFVFKRDVAE-
Y1289_PSEPK      -PEQLKQFDAQGYYYSAEQSKPD----HLVFLRDHPAE
Y1244_PSESM      -PEALKQFDVQGYRYNSEQSTPD----KLVFLRNSAED
Y3539_PSEAE      -PAGLKDFNAHGYYFSAEQSGPD----QLVFLRDAPQD
Y3540_SHEON      -IDGLKAFEVDGYYYSEELSKPN----EPTFLREAQ--
Y1114_NEIMA      -PEMLKNFNYEGYAFNDAASNES----EWVFMRSEQIK
Y895_NEIMB       -PEMLKNFNYEGYAFNDAASNES----EWVFMRSEQIK
Y2009_RALSO      -PRKLKHFDAEGYAFAAEASDDE----RWVFRRKAA--
Y3385_CAUVC      -AEALKGFDLDGYRFQPGLSTSA----DWVFARPQP--
Y2152_CLOPE      -SEDIKNFDLDGYEFNERLSEGD----TWVFTRD----
Y754_RICCN       -PELLKNFSYLGYAFSTKHSSDN----ELVFIKS----
Y3985_RICRS      -PELLKNFSYLGYAFSTKHSSDN----ELVFIKS----
Y3869_BACTN      -PEELKGFSWEGFEFDESLSDER----KLVFINGMGE-
Y089_LACPL       -VTAIRTFDHPDYQFDEKRSTAN----RFVFIYQH---
Y2036_STRA3      -LEHLKQLRFDGFCYDNELSDSK----QLTFVKKQT--
Y2081_STRA5      -LEHLKQLRFDGFCYDNELSDSK----QLTFVKKQT--
Y2104_STRP1      -VDSLKSLVFAGFYYHPDLSTDH----EFVYIKKEA--
Y1790_STRP3      -VDSLKSLVFAGFYYHPDLSTDH----EFVYIKKEA--
Y2163_STRP8      -VDSLKSLVFAGFYYHPDLSTDH----EFVYIKKEA--
Y2070_STRMU      -VDELKTISFNGFSYQDNLSEPL----KLIFIKQSK--
Y1547_STRPN      -VGEARRLNFAGFVYREDLSQPQ----GLVFVKEV---
Y1405_STRR6      -VGEARRLNFAGFVYREDLSQPQ----GLVFVKEV---
Y1889_COREF      AGEVADIARGAGMTVEINEGRKE----TLTLVV-----
Y1995_CORGL      AEDVMSIAQAAGLVVEENPNHKE----TLTLVV-----
Y2297_STRCO      PAELVEALRDLGYEVEAEAPAKGGRPWSLDVLVHEVH-
Y1762_FUSNN      -LEEIIKIELDGYNINKDLSDEK----NFIFTRKNS--
Y627_MYCPE       --NKIKDLDILGFKFNNELSYKN----NYIFTKAY---
                            .