CLUSTAL format seed alignment for MF_00657

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y3707_ACAM1      MILTIDEVLTAEELAEMKDVLAT---ADFVDGKTTAGWHAKLVKNNTQLAGKAACSMDLK
Y3668_CROS5      MILTIDNILTSEELTELTDILSQ---GNFVDGQTTAGWHAKLVKQNSQLDKTAPEVKSLE
Y2658_SYNP2      MFFKIPQVLTPEALEKITTTLTE---AEFVDGKLTAGWYAKLVKENQQLAKATPTAQALE
Y1482_SYNP6      MIITIDALLDAAQLNKIQSSLQT---AEFIDGRATAGWHAQLVKQNQQLSRTSTLAKSLQ
Y015_SYNE7       MIITIDALLDAAQLNKIQSSLQT---AEFIDGRATAGWHAQLVKQNQQLSRTSTLAKSLQ
Y1907_THEEB      MLLQIDRVLTTEELNQLNTLLQA---GVFEDGKWTAGIYAKTVKDNQQLVQEGEEYRVAS
Y2270_SYNJB      MILCIGDVLSLAELQQILSLIAD---AEFVDGALTAGWNARLVKNNRQMPKGSLQQRKIE
Y2611_SYNJA      MILCIGDVLSLAELQQILSLIAD---AEFVDGALTAGWNARLVKNNRQMPKGSLQQRKIE
Y3426_COLP3      MITKLPQVLSPIQVASIIQLIEH---GSFNSGKDTAGWHAKAVKNNLQWQGETELNEQIQ
Y759_IDILO       MILQISNAVDTDTVKSIVAGLDA---GQFSDGKKTAGWAAKDVKNNQQLSGKK--SEAAT
Y1675_MARMM      MLIHLQKVCPSEQVDHLRDLIGQ---GGFVDGGTTAGQVARAVKANEQLEAGA-RVDTVR
Y037_PARL1       MFIEIAGILGAADLRLADTVFAQK--DAFESGARTAGRIARAVKNNEQAKPAG-LAADLT
Y1619_PROM1      MEYLTHSLIDETEALQIVNKLKAEKS-SWQDGKKTAGSHAAEIKSNFQLDKNSKLSIELR
Y775_PROMT       MEYLTHSLIAKSEARQIVNKLKAEKL-SWQDGKKTAGSHASEKKSNFQLDKNSKLSIKLR
Y1271_PROMA      MDYLTHKLLDPTRAKSCIQSIQRDQS-LWKDGKSTAGLYASKVKNNLQLDKKSKVSIDNS
Y1256_PROM4      MELLIHQLLSKEESKKITSNITKDNS-CWIDGKTSAGSYAAKVKNNLQLKKDSEVGVTNS
Y1262_PROM9      MNFLTNQLLIQEEIEALIKNLNKENT-LWEDGKKTAGSHASMVKNNLQLNRESEISKKLS
Y1332_PROM5      MNFLTYKLLNLEELKILKLNLNKQNE-LWESGKMTAGSQASKVKENLQLNRNSEISKKYS
Y1353_PROMS      MNYLTSQLLINEEIETINNNLKNQSD-LWEDGKKTAGSYASKVKNNLQINRNSELSKKLA
Y1362_PROM0      MNYLIHQLLNAEEINLIKKELDKCSQQDWEDGKKTAGSHASMVKNNLQLNRNTEVSKKNA
Y1374_PROM2      MNYLTHQLLNPKEINLLKKNLTLQDI-SWEDGKKTAGNHAAKVKNNLQLDRSSNISKKCT
Y2049_PROM3      MEPLIHPLLDEATVSHLRASLLTDET-SWQDGRKTAGYQAAEVKNNLQLKRYSKTAKENS
Y286_PROMM       MEPLTHPLLDEATVSQLRATLLADET-SWQDGRKTAGYQAAEVKNNLQLDRNSKTAKENS
Y1577_SYNSC      MEFLTHSLLPLHEVCALQQRLSAPNL-PWRDGRLTAGDQAALVKKNYQLDPNAELSLAIS
Y2001_SYNS9      MDFLTSELLGVEETLQLTSELTNRES-IWLDGRLTAGEHAALVKHNRQLDPSLPLARSIA
Y1544_SYNS3      MNHLRLQILDQATCERLLERLANEAE--WLDGSLTAGAHAKGGKRNFQINYDSALRKEIH
Y1625_HYPNA      -MIVIENILGQDVLTEVAAAL---RELRWEDGRNTAGATARRVKRNQQADLSSRTGSKVR
Y2273_PSEA6      MLTVIEDLLSKKEVTQFTQALDKGQ---WLDGKHTAGSQASKVKYNQQLDDGSALAIELR
Y512_ACISJ       MLISIDQVLSKTEVRDFRAQLDAAA---WEDGAATAGTLAKSVKRNQQITDGSELCQRLG
Y612_SHEFN       -MIVIEQILSKQDVGAYRQQLAECP---WGDGRKTAMGMAASVKNNNQADAQHANVRQLA
Y721_SHEB8       MLIEIPNVFSKQEVSHLREQLDARR---WIDGNQTSGAMATTRKRNQQLDKDDPVAVALG
Y750_SHEB9       MLIEIPNVFSKQEVSHLREQLDARR---WIDGNQTSGAMATTRKRNQQLDKDDPVAVALG
Y3634_SHEB5      MLIEIPNVFSKQEVSHLREQLDARR---WIDGNQTSGAMATTRKRNQQLDKDDPVAVALG
Y717_SHESA       MLIEIPNVFSKEEVNQLREQLDART---WIDGNQTSGVMASTRKRNQQLDKDDPVALQIG
Y3244_SHESM      MLIEIPNVFSKEEVNQLREELDART---WIDGNQTSGVMASTRKRNQQLDKDDPVALQIG
Y698_SHESR       MLIEIPNVFSKEEVNQLREELDART---WIDGNQTSGVMASTRKRNQQLDKDDPVVLRIG
Y3913_SHEON      MLIEIPNVFSKQEVNQLREQLDART---WIDGNQTSGMMASTRKRNQQLDKDDPVALQIG
Y2125_NITEU      MLLTIDDVLTQEELAIARSMLARSA---WVSGLVTAGTQAAQVKNNQQVQENDPQIVNLR
Y373_NITEC       MLLTIDNVLTEEELAAASSLLAESA---WVSGLVTAGAQAAKVKNNQQLPEDSPQMAALR
Y608_AZOSB       MLITIDDVLSPEELAQARKLIAASR---WVSGHVTAGPQALHSKNNEQLPEDAEHLPALR
Y3048_POLSJ      MLLTLPDILSPQDLQAARQLLIDAP---WADGRDSAGAQARQVKNNAQLPHDCEAARAIG
Y3084_VEREI      MLLILADLLSPQELQTARQLLRNAR---WDDGKDSAGTQARQAKNNQQLPRDSEAGRRIA
Y2559_POLNA      MLLTLPNLLSPADLLAARALLSAAP---WADGRATAGIQAAQVKNNEQLPSDCEATRAIQ
Y1570_LEPCP      MLIHVRDVLSAAELQQTRELLSDAP---WADGGVTAGVQSAQVKNNQQLPQAHPVTQALQ
Y531_ACIAD       MIHHIPNVLTKQQVAEFRALMDTAQ---WVNGKVTAGTLSASVKHNQQLSEQDPLTHHLS
Y473_ACIBT       MIHHIPNVLNKEQVAEFRKLMEEAN---WVGGKVTAGTLSASVKRNQQLSEQDPLTHHLS
Y484_ACIBC       MIHHIPNVLSKEQVQYFRNEMDKIE---WVNGKVTAGTLSATVKRNQQLPEDHPLTHHLS
Y3291_ACIBY      MIHHIPNVLSKEQVQYFRNEMDKIE---WVNGKVTAGTLSATVKRNQQLPEDHPLTHHLS
Y724_ARCB4       MILHIPEVLSKEQLTECRNLLNKAN---WIDGKITAGNQAINAKNNFQLAESDPLTNYLR
YBIX_ECOLC       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_ECODH       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_ECOLI       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_ECOHS       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_SHISS       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_ECO24       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_ECO57       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_SHIBS       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_SHIFL       MMYHIPGVLSPQDVAHFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSALYAALQ
YBIX_SHIF8       MMYHIPGVLSPQDVAHFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSALYAALQ
YBIX_SHIDS       MMYHIPGVLSPQDVARFREQLGQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
YBIX_ECOL6       MMYHIPGVLSPQDVARFREHLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSALYAALQ
YBIX_ECOL5       MMYHIPGVLSPQDVARFREHLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSALYAALQ
YBIX_ECOUT       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSALYAALQ
YBIX_ECOK1       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSALYAALQ
YBIX_ECOSM       MMYHIPGVLSPQDVARFREQLEQAE---WVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQ
Y1221_KLEP7      -MYHIPDVLSTDQVAEFTRQLAQAE---WVDGRVTVGSQGAAVKQNQQIDTRTPLYARLQ
Y1553_XYLFT      MLLHIPTILSRTHATSMQERLAAAN---WTDGRETVGPQGAQVKHNLQLPETSPLRQELG
Y1638_XYLF2      MLLHIPTILSRTHATSMQERLAAAN---WTDGRETVGPQGAQVKHNLQLPETSPLRQELG
Y1709_XYLFM      MLLHIPTILSRTQATSMQERLAAAN---WTDGRETVGPQGAQVKHNLQLPETSPLRQELG
Y598_XYLFA       MLLHIPTILSRTQATSMQERLAAAN---WTDGRETVGPQGAQVKHNLQLPETSPLRQELG
Y1146_STRMK      MLLHIPDILSADQVADFRRRLDAAD---WTDGRETVGHLGAQAKHNQQLPEGSPLRRELG
Y3399_HERAR      -MLHIPSVLTSAQVIEIRQKLDAAD---WVDGKATVGAQGAQVKKNRQLPELSPVGMELG
Y3620_JANMA      MMLHIPEVLTPAQVSEIRQRLDAAD---WVDGKATVGAQGAQVKKNRQLPELSPVGMELG
Y3618_JANMA      MMLHIPEVLTAAQVVEIRKTIDTAE---WVDGKATVGAQGAKVKRNRQLPELSATGLKVG
Y3725_METPP      MMLHVPEVLTRDQVADIRTRLDATD---WVDGRATVGPQGAQVKQNRQLPELSPVGRELG
Y1978_BORBR      MLIQIADLFTPAEAAQIRARLEAAD---WVDGKVTAGYQSAQVKHNRQLSEQHPLAQELG
Y2533_BORPA      MLIQIADLFTPAEAAQIRARLEAAD---WVDGKVTAGYQSAQVKHNRQLSEQHPLAQELG
Y3529_BORPE      MLIQIADLFTPAEAAQIRARLEAAD---WVDGKVTAGYQSAQVKHNRQLSEQHPLAQELG
Y2704_BORPD      MLIQIAEVFSAAEAAQIRQRLEQAD---WVDGRVTAGHQSAQVKHNRQLPEQHPLAQELG
PIUC_PSEAE       MLLHIPAIFTAEEVSRIRAALEQAE---WADGKATAGYQSAKAKHNLQLPQDHPLAREIG
Y5858_PSEAB      MLLHIPAIFTAEEVSRIRAALEQAE---WADGKATAGYQSAKAKHNLQLPQDHPLAREIG
Y5129_PSEA7      MLLHIPALFTADEVSRIRAALEQAE---WADGKATAGYQSAKAKHNLQLPQDHPLAREIG
Y892_PSEP1       MLLHIPGLFDADELARICEALERAD---WADGKVTAGYQSAKAKHNLQLPEGHALAKEIG
Y862_PSEPK       MLLHIPGLFDADELARIREALERAD---WADGKVTAGYQSAKAKHNLQLPEGHALAKEIG
Y905_PSEPG       MLLHIPGLFDADELARIREALEQAD---WADGKVTAGYQSAKAKHNLQLPEGHALAKEIG
Y4316_PSEPW      MLLHIPGLFDADELARIREALEQAD---WADGKATAGYQSAKAKHNLQLPEGHALAKEIG
Y1031_PSEE4      MLLHIPGLFDADEISRIREALEQAD---WADGKVTAGYQSAKAKHNLQLPEGHALAKEIG
Y865_PSEF5       MLLHIPGVFTRDEVGRIREALEQAD---WADGKITAGYQSAKAKHNLQLPEGHPLAQEIG
Y799_PSEPF       MLLHIPALFEKDEVRRIREALEQAD---WADGKITAGYQSAKAKHNLQLPEGHPLAKEIG
Y995_PSEU5       MLLRIANVFSREETARIRVALEQAA---WQDGRVTAGYQSAKAKHNLQLAEDDPLAREIA
Y7101_BURL3      MMIEIPGVFSPAEAAQLVERLRAAQ---WIDGRATAGAQSRRVKENRQLDGDDPLAREIG
Y2942_XANAC      MLLPIPDVLSPAQLSQLRAQLDVAD---WADGRITAGHQSAQAKDNAQLPEDSAVAREAG
Y3086_XANC5      MLLPIPDVLSPAQLSQLRAQLDVAD---WADGRITAGHQSAQAKDNAQLPEDSAVAREAG
Y2773_XANCP      MLLPIPDVLTPAQLSQLSERLDAAD---WADGRITAGHQSAQAKDNAQLPEDSPIAREAS
Y1340_XANC8      MLLPIPDVLTPAQLSQLSERLDAAD---WADGRITAGHQSAQAKDNAQLPEDSPIAREAS
Y1388_XANCB      MLLPIPDVLTPAQLSQLRERLDAAD---WADGRITAGHQSAQAKDNAQLPEDSPIAREAS
Y2812_SACD2      MLLKIPNVLSKEQVETAKSKLLDAD---WADGNITAGYQSAKAKNNLQLPENSPIAIELG
Y3905_BRADU      MLTCIENVLSKDDVADFRRIMDASA---WEDGRSTAGSQSAMVKRNEQLPPDSEVARKLG
Y1514_NITHX      MLTCVPGVLEKDDVADFRRIMDAAE---WEDGRSTAGAQSALVKRNEQLPPDGDLARTLG
Y3334_RHOPS      MLVCIPEILSKHEVTEFRRLMDQAD---WEDGRSTAGAQSAMVKRNEQLPPDSELARMLG
Y2089_RHOP2      MLVCIPDVLSRHEVAEFRHVMDAAD---WEDGRSTAGAQSAMVKRNEQLPPDGELARALG
Y3479_RHOPA      MLVCIPEVLPKSEVAEFRRLMDAAD---WEDGRSTAGAQSAMVKRNEQLPPDSDLARALG
Y3541_BRASB      MLICIPDVLSKDEVAEFRRIMDAAE---WEDGRSTAGAQSAMVKRNEQLPPDGEAARMLG
Y4652_BRASO      MLICIPDVLSKDEVAEFRRIMDAAE---WEDGRSTAGAQSAMVKRNEQLPPDGEAARLLG
Y1313_BRASB      MLICVPGILSKDDVAEFRHIMDSSD---WEDGRSTAGAQSAMVKRNEQLPPDSEVARKLG
Y6316_BRASO      MLICVPGILSKDDVAEFRHIMAESD---WEDGRSTAGAQSAMVKRNEQLPPDSEVARRLG
Y1130_METS4      MLVCIPEVLSKDEVAEFRRIMDAAE---WEDGRATAGAQSALVKRNEQLPPDGEVARQLG
Y027_CAUVC       MMLQIPEVLTKAQVAECRAILDAGP---WVDGNVTSGFQAAMAKNNEQLPQDSAEARHVG
Y045_CAUSK       MMLQIPDVLTSDEAAYCRGVLDAAP---WVDGNVTSGFQAAMAKNNQQLPQDGAAAREIG
Y3557_BURCA      MMLHIPGVLTKAQVAQCREMLDTAD---WVDGNATSGAQSALAKRNRQLPEGSPVARTVG
Y5473_BURCC      MMLHIPGVLTKAQVAQCREMLDTAD---WVDGNATSGAQSALAKRNRQLPEGSPVARTVG
Y4810_BURCH      MMLHIPGVLTKAQVAQCREMLDTAD---WVDGNATSGAQSALAKRNRQLPEGSPVARTVG
Y4192_BURCM      MMLHIPGVLTNAQVAQCRELLDAAH---WVDGNATSGAQSALAKRNRQLPEGSPVARAVG
Y4714_BURA4      MMLHIPGVLTNAQVAQCRELLDAAD---WVDGNATSGAQSALAKRNRQLPEGSPVARAVG
Y892_BURL3       MMLHIPGVLTKAQVAQCRELLDAAE---WIDGNATSGTQSAQAKRNRQLPEGAPAARAVG
Y5206_BURPS      MMLHIPGVLTKEQVAQCRDILDAAD---WTDGNATSGAQSALAKRNRQLPEGSPAARAAG
Y4200_BURP1      MMLHIPGVLTKEQVAQCRDILDAAD---WTDGNATSGAQSALAKRNRQLPEGSPAARAAG
Y5709_BURP0      MMLHIPGVLTKEQVAQCRDILDAAD---WTDGNATSGAQSALAKRNRQLPEGSPAARAAG
Y5790_BURP6      MMLHIPGVLTKEQVAQCRDILDAAD---WTDGNATSGAQSALAKRNRQLPEGSPAARAAG
Y4601_BURTA      MMLHIPGVLTKEQVAQCRDILDAAD---WADGNATSGAQSALAKRNRQLPEGSPAARAIG
Y7194_PARXL      MMLHLQGVLSKQQVAQCREVLDAAQ---WIDGNVTSGEQSAQAKRNQQLPEGSAAARAVG
Y4660_CUPPJ      MMLQIPDVLSKAQVAQCRQMMDVAD---WTDGNATSGHQSALAKRNMQLPEGSPVARQIG
Y2317_METFK      MLIEIPEVLTKEQVAQCRQLMDAAE---WVDGNVTSGSQSALAKNNMQLPEGSPVARQVG
Y4046_SPHWW      MMIAIPGVLSGRTLDHVRTLVTEAE---WVDGNATSGHQSALAKKNRQLPEDGDAAREAG
Y1196_BORA1      MLLHIPEVLAANFAQHSLRALQGAD---WIDGAQTAGFQSAQVKRNRQLPADSPIGLQIA
Y4577_RHOP5      MLVHIPEVLSRDQVRHCRELMARAD---WVDGRITAGHQSAQVKRNLQLPEGTPEARELS
Y3637_NITHX      MLVRIPNVLTPEQVQHCREVMARTA---WVDGRVTAGHQSAQVKRNLQLPEGTPEARELG
Y3753_AZOC5      MMIHIPKVLTPEQVARCRAVMDAAG---WVDGRSTAGAQAVHVKKNLQLPDGSAEARELG
Y236_BEII9       MIVHIPAVLNAEQIARCRAVMQTGD---WIDGRVTAGHQSRLVKNNLQLPESSPEHQELG
Y4479_BURCM      MLVHIPNVLTPEQVSMVRDRLDRAGD-AWVDGRATAGYTGAPVKRNQQIAEHSPIARELG
Y5004_BURA4      MLVHIPNVLTPEQVSMLRDRLDRAGD-AWVDGRATAGYTGAPVKRNQQIAEHSPVARELG
Y7756_PARXL      MLLHIPNVLNAEQLRIVRERLDTAGD-AWVDGRATAGYQGAPVKRNQQIAEHTPIARELG
Y2877_CUPPJ      MLVVIPQVLNAEQVGAVRERLEHAGE-AWVDGRVTAGYSGAPVKFNQQIDERSDVALECQ
Y3078_CUPMC      MLVRIPQVLNAEQLAMLREQLDHAGD-AWVDGRVTAGYSGAPVKFNQQIDERSEAAAQCQ
Y1238_GLUDA      MLIHIPSVLTVEEVAHCRQIMAGAE---WVDGRVTAGPQSAMVKNNLQIPLSSDAHREMR
Y559_GLUOX       MLLHIPNVLSPEEVRYFRDRLEDAE---WTDGRVTAGEQSAKAKLNLQIPQDSAECRELG
Y4677_PARDP      MLITIPDLLTPEEVAYMRQILEGTA---WVDGRSTAGDQAGKVKRNLQVPVDSPEARELG
Y838_CUPMC       MLIQIPNVLTPEEVRYCRQRLESSN---WVDGRVTAGDLAAQSKLNLQIPVDSEVAQELG
Y377_PARL1       MMLEIPDVLTSAQLRQCREALEKAA---WQDGRQTAGHMAAQAKNNQQLAQDDPLSVELG
Y803_PSEMY       MMLSIPDVLNAEQLQQCRAALEGGN---WQDGRLTAGHQAVNVKANQQLAQDDPLTQQLG
Y701_NITWN       MIQVISDVLTPDELKRFRELLGQAQ---WQDGRATAGHVAVRAKANEQLSHEDSLGQQLS
Y1172_DELAS      MMLRIPALLSPDEVRQCRQALEQAP---WQDGRATAGPLAAQVKANLQLPLDSQAGQAIG
Y2117_HYPNA      MLLHIPEVLNGQELATLRETLAGAD---WQDGAATAGAQAVRVKQNLQLPAGAPDARPMG
Y1523_PSYWF      MLHIIENLLDTAQLSQLTSILTHQHA-QWQDGKLTAGISAQQQKNNWQLSRQDPSYQAMA
Y1910_SPHAL      -MFKLVQLLGDNAVRALRDIAASGT---FVDGKISNPH--SRVKNNLQLHDAAAYERSS-
                                             : .*  :        * * *            

Y3707_ACAM1      ERVKSALLRHPLFKVAIQPRSIHTLLFSRYQE--GMSYGDHVDNAFMGGA----------
Y3668_CROS5      ALVINALQRNLLFKLAIHPKHIHSLRFSRYEP--KMHYGSHTDNALMGGQQFF-------
Y2658_SYNP2      EQVRQALQSNALFQTAIRPKTVHTLLFSRYGP--GMAYGRHTDNALMNGM----------
Y1482_SYNP6      EIVQTALQNNALFEAAAYPQRVHSLLFSRYEP--GMEYGRHVDNALMGSGDRRD------
Y015_SYNE7       EIVQTALQNNALFEAAAYPQRVHSLLFSRYEP--GMEYGRHVDNALMGSGDRRD------
Y1907_THEEB      EIVLSALSRNQLFQAYVQPKIIGPLLFSRYEV--GMAYGTHTDNALMGSGDQLR------
Y2270_SYNJB      EIILAALERNLLFQMAARPKLIHSILISCYEA--GMSYGTHTDDALMLDRHQLM------
Y2611_SYNJA      EIILAALERNLLFQMAARPKLIHSILISCYEA--GMSYGTHTDDALMLDRHQLM------
Y3426_COLP3      TGIQGALTQHPQFTGAAYAKSMMPFIISESTL--GGGYGDHIDDALMVNET-VL------
Y759_IDILO       QVLLDRLQQNALVQSVMRPKQVARVTINRYQQ--GEYYGTHMDDSLMNG----V------
Y1675_MARMM      SEVRKALMAHAGFVSFARPKTLSRILVSRYRD--GMAYGPHIDDALMGG----R------
Y037_PARL1       MLVEKRLMKNDVFRAAARPRNFIRILLSRYTQ--GMAYGLHSDDAFMER----Q------
Y1619_PROM1      DVIVNKIISNPLLKSFTLPSLIHGVMFTQSLV--GHSYGSHIDNPYMPSG----------
Y775_PROMT       DIIVNKIISNPLLKSFTLPSLIHGVMFTQSLA--GHHYGSHIDNPYMPSG----------
Y1271_PROMA      NLIIKAIISDLLVKSFTIPRKVHGVMFSKSSK--GNSYGMHLDNAYMSTG----------
Y1256_PROM4      NKVNNKLTSDQLIKSFALPRKVHGTMFTRSSV--GQGYGMHVDNAYMSSG----------
Y1262_PROM9      HLIKKKILSSPLIKSFALPKIIHGIMFTKSLK--DMQYGRHIDNPFMSSG----------
Y1332_PROM5      QLIRKKIITNPLIKSFALPKTIHGIMFTKSLQ--NMHYGRHIDNPFMSSG----------
Y1353_PROMS      ELIKNKLLANPLIKSFALPKLIHGIMFTKSQK--NMGYGRHVDNPFMSSG----------
Y1362_PROM0      QLVTKKILSSQLIKSFSLPKKIHGIMFTKSSK--NMHYGRHIDNPYMSSG----------
Y1374_PROM2      GLIEKKILSDVLIKSFALPKRIHGTMFTKTLK--GMKYGRHIDNAFMSSG----------
Y2049_PROM3      QLVIEKLESDPLVKSFALPRHIHGVMFSRSGI--GQGYGMHVDNAYMSSG----------
Y286_PROMM       QLVIKQLESDPLVKSFALPRHIHGVMFSRSGI--GQGYGMHVDNAYMSSG----------
Y1577_SYNSC      NCISTALTSDPLVKSFSLVRKVHSLLVSRSSA--GESYGWHVDNPFSRNG----------
Y2001_SYNS9      EIVEQKIIDSPLLKSFALIRRVHSILISRSEV--GDGYGWHVDNPFSKHG----------
Y1544_SYNS3      ELVERAMWNHPVVKGFCLPRKLHRFLISKTEK--EGGYDTHVDNAYMSSG----------
Y1625_HYPNA      EVLLEAVKRHPVVEAYARPLKFAPPLISCSGE--GDAYGLHIDNPVMGKGDARL------
Y2273_PSEA6      NTVIRKLSGNALFMSSALPNKIYPPKFNRYQG--GEHYGLHVDASVMP-------IPNSH
Y512_ACISJ       QHILRRLSSTPLFISAALPRTIYPPKFNRYAD--GGTYGAHVDSALMF-------LPGSH
Y612_SHEFN       NQLLARIGETPKIVSAALPHKIFPPCFNRYNE--TEEYGYHVDAAIMR-------IPNTS
Y721_SHEB8       QQIMDRLLAHPQFVSAALPLQFYPPLFNRYQG--GETFGYHIDNAIRS-------TPDG-
Y750_SHEB9       QQIMDRLLAHPQFVSAALPLQFYPPLFNRYQG--GETFGYHIDNAIRS-------TPDG-
Y3634_SHEB5      QQIMDRLLAHPQFVSAALPLQFYPPLFNRYQG--GETFGYHIDNAIRS-------TPDG-
Y717_SHESA       ELIMARLLAHPLFVSAALPLQFYPPLFNRYQG--GETFGYHIDNAIRS-------TSEG-
Y3244_SHESM      ELIMARLLAHPLFVSAALPLQFYPPLFNRYQG--GETFGYHIDNAIRS-------TSEG-
Y698_SHESR       ELIMARLLAHPLFVSAALPLQFYPPLFNRYQG--GETFGYHIDNAIRS-------TSDG-
Y3913_SHEON      ELIMARLLAHPLFVSAALPLQFYPPLFNRYQG--GDTFGYHIDNAIRS-------TSDG-
Y2125_NITEU      RLVLGALNRNALFFTATLPEKIVPPFFNRYSGE-TNHYGFHVDNAMRL-------LPDGS
Y373_NITEC       GLVLGALNRNALFFTATLPKKIMPPFFNRYSGK-TNHYGFHVDNAMRM-------LPDGV
Y608_AZOSB       RLILGALNRNPLFFAAALPLRVLTPFFNRYAGD-SNHYGYHTDNAMRL-------APEG-
Y3048_POLSJ      TMVVGGLERSALFLTAALPKKIFTPRINRYSGA-ANHYGNHVDSAIRT-------MAG--
Y3084_VEREI      AMVLAALERSALFLTATLPKRVFPPRVNRYGGE-HNHYGDHVDSAVRQ-------LAD--
Y2559_POLNA      AMVMKGLDGSPVFFSAALPKKMFPPRINRYGGD-SNFYGNHVDNAIRA-------VPN--
Y1570_LEPCP      QLVMAGLNRHPTFFSAALPKKVFPPLFNRYGGT-ANAFGNHVDNAVRF-------ITSGP
Y531_ACIAD       DLVIQAIWNNPAFQTAALPHHIIPPLFNRYDE--HESFGFHVDNSIRL-------IRGT-
Y473_ACIBT       DIVIKAIWQNPLFQAAALPHKIIPPLFNRYDE--HESFGFHVDNSIRL-------IRGT-
Y484_ACIBC       NIILEALGTHPLFLSAAIPLDIIPPLFNRYEN--QESFGFHVDNSIRR-------IRGT-
Y3291_ACIBY      NIILEALGTHPLFLSAAIPLDIIPPLFNRYEN--QESFGFHVDNSIRR-------IRGT-
Y724_ARCB4       DIIKTALNSNPLFISAALPKHIISPFFNKYEN--GGNYGNHVDNSILF-------DMNE-
YBIX_ECOLC       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECODH       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECOLI       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECOHS       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_SHISS       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECO24       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECO57       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_SHIBS       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_SHIFL       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_SHIF8       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_SHIDS       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECOL6       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECOL5       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECOUT       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECOK1       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
YBIX_ECOSM       NEVLNAVNQHALFFAAALPRTLSTPLFNRYQN--NETYGFHVDGAVRS-------HPQN-
Y1221_KLEP7      AAVLDMLRGHPQFFSAALPRTISAPLFNRYGP--GETYGFHVDGAVRQ-------NGEA-
Y1553_XYLFT      QEILDALARSPLYFAATLPLRTLPPRFNRYQE--NHQYGFHVDGAVMS-------LPVAP
Y1638_XYLF2      QEILDALARSPLYFAATLPLRTLPPRFNRYQE--NHQYGFHVDGAVMS-------LPVAP
Y1709_XYLFM      HEILDALARSPLYFAATLPLRTLPPRFNRYQE--NHQYGFHVDGAVMS-------LPVAP
Y598_XYLFA       NEILDALARSPLYFAATLPLRTLPPRFNCYQE--NHQYGFHVDGAVMS-------LPIAP
Y1146_STRMK      EIILVALARHPLFFSAALPLKYLPPRFNRYSG--GGTYGFHVDGAVMN-------LANG-
Y3399_HERAR      QIILKALVSNPLFFSAALPMRYMPPLFNRYEG--GEHYGFHIDGSVRT-------IPGS-
Y3620_JANMA      QIILKALVNNPLFFAAALPMRYMPPLFNRYEG--GEHYGFHIDGSVRN-------IPGS-
Y3618_JANMA      QEILKALAGHPLFVSAALPMRYMPPLFNRYEG--GEHYGFHVDGSVRS-------IPGS-
Y3725_METPP      ETILKALLVHPLFVSAALPLRTVPPLFNRYEG--GEHYGLHIDGAVRS-------VPGT-
Y1978_BORBR      GLILQRLAANNLFMSAALPRKIFPPLFNRYEG--GEAFGYHVDNALRP-------VPGTA
Y2533_BORPA      GLILQRLAANNLFMSAALPRKIFPPLFNRYEG--GEAFGYHVDNALRP-------VPGTA
Y3529_BORPE      GLILQRLAANNLFMSAALPRKIFPPLFNRYEG--GEAFGYHVDNALRP-------VPGTA
Y2704_BORPD      ELILQRLSANNLFMSAALPRKIFPPLFNRYEG--GESFGYHVDNAVRV-------VPGTS
PIUC_PSEAE       EAMLQRLWNHPLFMSAALPLKVFPPLFNCYTG--GGSFDFHIDNAVRD-------VHGGR
Y5858_PSEAB      EAMLQRLWNHPLFMSAALPLKVFPPLFNCYTG--GGSFDFHIDNAVRD-------VHGGR
Y5129_PSEA7      EAMLQRLWNHPLFMSAALPLKVFPPLFNCYTG--GGSFDFHIDNAVRD-------IQGGR
Y892_PSEP1       SALIDRLWKTPRFMSAALPHKVFPPLINCYRE--GGNFGFHIDNALRQ-------PKGSP
Y862_PSEPK       TALIDRLWKTPRFMSAALPHKVFPPLINCYRD--GGNFGFHIDNALRQ-------PKGSP
Y905_PSEPG       SALIDRLWKTPRFMSAALPHKVFPPLINCYRE--GGNFGFHIDNALRQ-------PKGSP
Y4316_PSEPW      SALIDRLWKNPRFMSAALPHKVFPPLINCYRE--GGNFGFHIDNALRQ-------PKGSP
Y1031_PSEE4      SALIDRLWCNPQFMSAALPHKVFPPLINCYRE--GGNFGFHIDNALRQ-------PKGSP
Y865_PSEF5       AAMLDRLWQNPLFMSAALPHKVFPPLINCYTA--GGSFDFHIDNAVRQ-------PKGSP
Y799_PSEPF       AAMLERLWKNPLFMSAALPHKVFPPLLNCYTA--GGSFDFHIDNAVRQ-------PKGSI
Y995_PSEU5       EAMLQRLWQHPQFMSAALPSKVFPPLFNCYTA--GGEFGYHIDNAVRQ-------VRNSA
Y7101_BURL3      DEIIRRLAQNAVFMSAALPKRIYPPLFNRYAG--GESFGYHVDNAVRG-------IRASR
Y2942_XANAC      ALVLEALARSSTFFSAVLPRRIYPPLFNRYSG--GQSFGYHVDNAVRYD-----RSRGGA
Y3086_XANC5      ALVLEALARSSTFFSAVLPRRIYPPLFNRYSG--GQSFGYHVDNAIRYD-----RSRGGA
Y2773_XANCP      ALVLDALSRSSTFFSAALPRRIYPPLFNRYSG--GQSFGYHVDNAVRYD-----RSRGGA
Y1340_XANC8      ALVLDALSRSSTFFSAALPRRIYPPLFNRYSG--GQSFGYHVDNAVRYD-----RSRGGA
Y1388_XANCB      ALVLDALSRSSTFFSAALPRRIYPPLFNRYSG--GQSFGYHVDNAVRYD-----RSRGGA
Y2812_SACD2      DIVLTALAQNNMFMSAALPLKIFPPLFNCYQG--GRSFGVHVDNAIRQ-------VPGTP
Y3905_BRADU      NRIISALTSNPRFIAAAIPLQIFPPLFNRYAATSGHHFGLHVDNAIRG-------DRLTG
Y1514_NITHX      NRIISALTANPRFISAAIPLQIFPPLFNRYVASDGHHFGVHVDNAVRG-------DRMTG
Y3334_RHOPS      RRIVSALTANPKFVSAAVPLQIFPPLFNRYAASGNHHFGIHVDNAVRG-------DPLTG
Y2089_RHOP2      RRIIQALTANPKFVSAAVPLQIFPPLFNRYAAAGNHHFGIHVDNAVRG-------DPLTG
Y3479_RHOPA      RRIVSALTGNPKFVSAAVPLQIFPPLFNRYAASGGHHFGIHVDNAVRG-------DHLTG
Y3541_BRASB      QRIITALTRNPRFLSAAVPLQIFPPLFNRYTASRGDHFGIHVDNAVRG-------DPLTG
Y4652_BRASO      QRVITALTKNPRFLSAAIPLQIFPPLFNRYTSSRGDHFGIHVDNAVRG-------DPLTG
Y1313_BRASB      HRIISAMTANPRFLAAAIPQHIFPPLFNRYAADSGHHFGIHVDNAVRG-------DKLTG
Y6316_BRASO      HRIISAMTANPRFLAAAIPQQIFPPLFNRYAADAGHQFGIHVDNAVRG-------DKLTG
Y1130_METS4      ARVVRALLANPHFVSAAIPLQIFPPLFNRYGE--GHHFGMHVDNAVRG-------DPLTG
Y027_CAUVC       AIIVQALEANPLFVSAALPRTILSPMFNRYGE--GMGFRDHVDNAIRR-------DPVTG
Y045_CAUSK       AIIVQALNANPLFVSAALPRTILSPLFNRYGV--GMGFGDHVDNSVRR-------DPVTG
Y3557_BURCA      DAIQDALARHPLFFSAALPLKVFPPLFNRYEG--GETFGTHVDNAIRL-------LRGTD
Y5473_BURCC      DAIQDALARHPLFFSAALPLKVFPPLFNRYEG--GETFGTHVDNAIRL-------LRGTD
Y4810_BURCH      DAIQDALARHPLFFSAALPLKVFPPLFNRYEG--GETFGTHVDNAIRL-------LRGTD
Y4192_BURCM      DAIQDALARHALFFSAALPLKVFPPLFNRYAG--GETFGTHVDNAIRL-------LRGTD
Y4714_BURA4      DAIQDALARHALFFSAALPLKVFPPLFNRYAG--GETFGTHVDNAIRL-------LRGTD
Y892_BURL3       DAIQDALARHPLFFSAALPLKVFPPLFNRYEG--GETFGTHVDNAIRL-------LRGTD
Y5206_BURPS      DAIQDALACNALFFSAALPLKVFPPLFNRYAG--GDAFGTHVDNAIRL-------LRGTD
Y4200_BURP1      DAIQDALACNALFFSAALPLKVFPPLFNRYAG--GDAFGTHVDNAIRL-------LRGTD
Y5709_BURP0      DAIQDALARNALFFSAALPLKVFPPLFNRYAG--GDAFGTHVDNAIRL-------LRGTD
Y5790_BURP6      DAIQDALARNALFFSAALPLKVFPPLFNRYAG--GDAFGTHVDNAIRL-------LRGTD
Y4601_BURTA      DAIQDALARNALFFSAALPLKVFPPLFNRYAG--GDAFGTHVDNAIRL-------LRGTD
Y7194_PARXL      DAIQDALGRNPRFFSAALPLKVFPPLFNRYAG--GDGFATHVDNAIRQ-------LRGTD
Y4660_CUPPJ      DLIQDALGANATFFSAALPLKVFPPLFNRYEG--GQAFDNHVDNAIRY-------LRGTG
Y2317_METFK      DLIQDALGMSPLFISAALPLKVFPPLFNRYEG--GQAFGTHVDNAIRQ-------LRGTN
Y4046_SPHWW      GIILDALGATPLFIAAALPLKVFPPLFNLYGG--GERFDTHVDNAIRM-------KRGTD
Y1196_BORA1      AEIERALMRMPLFLSGALPTRIFPPLFNRYAE--GDGFGIHVDNAIRY-------PPGES
Y4577_RHOP5      ELVHGALSRHPLFMSAALPKTIFPPLFNRYDADGEMNFGSHVDNAIRT-------VPGTG
Y3637_NITHX      DMVLAALNRNPLFVSAVLPKTIFPPLFNRYDADGEMNFGSHVDNAIRT-------VPGTG
Y3753_AZOC5      EMVRAALQRSALFTSAVLPRRILPPMFNRYDAG--MTFGSHVDNAIRF-------VRDSG
Y236_BEII9       EMIVRALWHNPLFISAVLPHTIFPPLFNRYDVG--MGFGTHVDTAVRR-------NLDGS
Y4479_BURCM      DVILAALERNPLFISAALPNQVYPPLFNRYEGG--MTFGSHVDGAVRV-------LPN-G
Y5004_BURA4      DVILAALERNPLFISAALPNQVYPPLFNRYEGG--MTFGSHVDGAVRV-------LPN-G
Y7756_PARXL      DVILASIERNPLFISSVLPNQVYPPLFNRYEGG--MQFGSHVDGAVRV-------LPN-G
Y2877_CUPPJ      RLILGMLERNPRFISAALPNIVYPPMFNRYSEG--MTFGAHVDGSVRI-------HPHDG
Y3078_CUPMC      HLVLSALERNPLFISAVLPNIVYPPMFNRYSEG--MTFGLHVDGGVRL-------HPHNG
Y1238_GLUDA      DIVLRALGRNPTYNSAALPLRVVPPLFNRYDAG--MSFAAHVDNAIRP-------IHETG
Y559_GLUOX       EFVLRALGRNPTFNSAALPLRVYPPLFNRYDTG--MHFDAHVDNAIRP-------IPGAG
Y4677_PARDP      NIVLRALGRSPVYSSAALPAHILPPMFNRYDEG--MTFGAHVDGSIRV-------VPGTG
Y838_CUPMC       EFILTALGRNASYHSAALPLRVLPPMFNRYEGG--MTFGTHVDNAIRT-------VPGTG
Y377_PARL1       EFLLDRLGKTDRFIAAALPLKVLPPRFNRYSG--GGNYGNHVDAAIFS-------VPGTP
Y803_PSEMY       DFILACLAQHPRFMAAALPLKVVPPRFNRYAE--GGTYGDHIDNAVFS-------VPGTP
Y701_NITWN       EFLLERLGKISHFIAAALPLKVLPPRFNRYTG--GGSYGDHIDNAIFS-------VPGAG
Y1172_DELAS      NLILDKLGASALFMSATLPLKVLPPRFNRYEG--GGTYGNHIDNAIFT-------IPGTA
Y2117_HYPNA      ELVKAALLRHPLFQSAALPHTVLTPRFNRYEG--GGHYGNHVDSAIHA-------DPFLG
Y1523_PSYWF      NLCLEALQQHPVFMSAALPKVIMPPLFSAYQL--GQGYGMHVDNALQT-------HPDSK
Y1910_SPHAL      KILLDAMIQNADFMEFSFPARIAPPLLTRYTP--GMHYGLHPDAAYIPLPD---------
                       :                   ..         :  * *                 

Y3707_ACAM1      -------RSDVSFTLFLNAPEDYTGGELCVELAD-GVHTYKLAAGSAIAYPSSTIHRVET
Y3668_CROS5      -------RSDVSFTLFLSSPESYEGGELIIEKPE-GDLSYKLNPGSIVLYPSTFLHRVET
Y2658_SYNP2      -------RSDVSFTLFLNEPSDYEGGELVIEGAD-SEQSYKLPAGTAIAYPSTSLHRVNV
Y1482_SYNP6      -------RADLSFTLFLSDPDRYIGGALVIEGAC-DEQAYRLPAGSLLLYPSSTLHRVDP
Y015_SYNE7       -------RADLSFTLFLSDPDRYIGGALVIEGAC-DEQAYRLPAGSLLLYPSSTLHRVDP
Y1907_THEEB      -------RSDVSLTIFLNDPFAYEGGALVLDTSL-GEQYFKLPAGSMIVYPSIFLHRVET
Y2270_SYNJB      -------RTDISFTLFLSAPEDYDGGELKIESSE-GEQAYKLPAGALILYPASTLHRVEP
Y2611_SYNJA      -------RTDISFTLFLSAPEDYDGGELKIESSE-GEQAYKLPAGALILYPASTLHRVEP
Y3426_COLP3      -------RTDISCTLFLTPPQDYEGGELVMNLSG-MEMAFKLNAGDAIIYPSTTLHRVNP
Y759_IDILO       -------RTDISFTLGLSPLSDFEGGELVIEDAS-GERSWRLGQGDILMYPSHYLHRVNP
Y1675_MARMM      -------RADLSFTLFLSDPDSYDGGELVMDGPD-GETEIKLAAGDAVVYATSAIHQVAP
Y037_PARL1       -------RVDLSFTLFLSPPESYEGGELIVEEPA-GERLVKLEAGSLVLYPSATLHRVAE
Y1619_PROM1      -------RSDLSFTLFLNAPEDYEGGELCIQTIN-KTEKIKLSAGEIIIYPSTQLHSVAE
Y775_PROMT       -------RSDLSFTLFLNAPEDYEGGELCIQTIN-KTEKIKLSAGEMIIYPSTQLHSVAE
Y1271_PROMA      -------RSDLSFTLFLSDPGEYEGGELAIETIQ-ETRKIKLPQGHIIIYPSTTLHSVEE
Y1256_PROM4      -------RSDLSFTIFLSSPNEYQGGELLIQSMQ-GVKEIKLNCGQIVIYPSTSLHSVKQ
Y1262_PROM9      -------RADLSFTISLTDKNTYDGGELIIEEMN-SEKEFKLNAGEIIIYPSTYLHSVKE
Y1332_PROM5      -------RSDLSFTISLTNKADYQGGELVIETLN-SEKKLKLDAGEIIIYPSTYLHSVKK
Y1353_PROMS      -------RSDLSFTISLTPKDLYEGGELIIETIN-SENKFKLNAGEIIIYPSTYLHSVEK
Y1362_PROM0      -------RSDLSFTISLTNKDFYDGGELIIETMN-TEEKFKLNPGEIILYPSSYLHAVNE
Y1374_PROM2      -------RADLSFTIFLNEKDKYSGGELLIEGLN-SEDKFKLDSGGIIIYPSTYLHSVLE
Y2049_PROM3      -------RSDLSFTLFLSEPESYDGGALCIQTLQ-DSKQVKLPAGQLIIYPSTSLHAVET
Y286_PROMM       -------RSDLSFTLFLNEPESYEGGALCIQTLQ-DSKQVKLPAGQVIIYPSTSLHAVET
Y1577_SYNSC      -------RRDLSFTCFLSDEDSYEGGSLMIQTGGEDTKEFRLPPGQVVLYPSSTLHCVTP
Y2001_SYNS9      -------RRDLSFTLFLSDLSDYEGGELTFQLLQ-GSKEIRLPAGQIILYPSSSLHCVQP
Y1544_SYNS3      -------RSDLSFTLSLTDDTMYEGGDLEIDSIS-ESYPIKLKQGEILIYPSTSLHRVCN
Y1625_HYPNA      -------RTDLSFTLFLSPPESYDGGELEIETVF-KTESVKLPAGSMVIYPSTELHRVTP
Y2273_PSEA6      ----QMLRTDLSATLFLSEPKTYDGGELSIETQF-GLQQIKLNAGSVILYPANSLHQVNP
Y512_ACISJ       ----QQMRTDLSATLFLAEPEEYDGGELEVEGPF-GVQAVKLAAGDMVLYPSSSLHRVTP
Y612_SHEFN       ----EVIRSDVSMTVFLSEPEEYDGGELVIATEF-GQQQIKLPAGYAVVYPSSSLHKVTA
Y721_SHEB8       -----MIRTDLSATLFLSEPESYQGGELVIQDTY-GQQSIKLSAGSLVLYPSSSLHQVTP
Y750_SHEB9       -----MIRTDLSATLFLSEPESYQGGELVIQDTY-GQQSIKLSAGSLVLYPSSSLHQVTP
Y3634_SHEB5      -----MIRTDLSATLFLSEPENYQGGELVIQDTY-GQQSIKLSAGSLVLYPSSSLHQVTP
Y717_SHESA       -----MVRTDLSATLFLSEPDTYQGGELVIQDTY-GQQSIKLAAGSLVLYPSTSLHQVTP
Y3244_SHESM      -----MVRTDLSATLFLSEPDTYQGGELVIQDTY-GQQSIKLAAGSLVLYPSTSLHQVTP
Y698_SHESR       -----MVRTDLSATLFLSEPDTYQGGELVIQDTY-GQQSIKLAAGSLVLYPSTSLHQVTP
Y3913_SHEON      -----MVRTDLSATLFLSELNAYEGGELVIQDTY-GQQSIKLAAGSLVLYPSTSLHQVTP
Y2125_NITEU      ----GYVRTDVSATLFLSDPQEYDGGELVINDTF-GQHGVKLQAGSMVIYPSSSIHQVTP
Y373_NITEC       ----GYVRADVSATLFLSNPQTYDGGELVINDTF-GQQSVKLQAGSMVIYPSSSVHQVTP
Y608_AZOSB       ----GYVRADVSATVFLSDPEEYEGGVLTIADTF-GTHGVKLKAGSAVVYPSSSIHQVTP
Y3048_POLSJ      --SGQRVRTDVSCTVFLSEPDDYEGGELTIADTY-GEQRIKLPAGHAVLYPGTSLHQVQP
Y3084_VEREI      --RHDRLRTDISCTVFLSPPDEYDGGELCIDDTF-GPQRVKLPAGHAVIYPGTSVHQVRP
Y2559_POLNA      --SPQRVRTDISCTVFLNDPGDYDGGELTIADTY-GEQRVKLPAGHAVLYPGTSLHQVRP
Y1570_LEPCP      H-TGQRVRTDVSCTLFLAEPETYDGGELVIEDTY-GSQRVKLAAGDLVLYPGTSVHRVEP
Y531_ACIAD       ---SQQMRTDLSCTLFLSEPEEYDGGDLVIEDTY-GYHEVKLPAGDLVLYPSTSLHEVSS
Y473_ACIBT       ---AEQIRTDLSCTLFLSEPDEYEGGDLVIEDTY-GYHEVKLPAGDVVLYPSTSLHEVSS
Y484_ACIBC       ---NERLRTDLSCTLFLSEPEEYEGGDLVVEDTY-GYHEVKLPAGDMILYPSTSLHEVTA
Y3291_ACIBY      ---NERLRTDLSCTLFLSEPEEYEGGDLVVEDTY-GYHEVKLPAGDMILYPSTSLHEVTA
Y724_ARCB4       ---KKAFRTDISCSLFFTDPEEYEGGEMVIEDTF-GTHEVKLPAGDLILYPSTSLHRVEP
YBIX_ECOLC       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECODH       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECOLI       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECOHS       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_SHISS       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSQHCVPP
YBIX_ECO24       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECO57       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_SHIBS       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_SHIFL       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_SHIF8       ----GWMRTDLSATLFLSDPQSYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_SHIDS       ----GWMRTDLSATLFLSDPESYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECOL6       ----GWMRTDLSATLFLSDPESYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECOL5       ----GCMRTDLSATLFLSDPESYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECOUT       ----GWMRTDLSATLFLSDPESYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECOK1       ----GWMRTDLSATLFLSDPESYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
YBIX_ECOSM       ----GWMRTDLSATLFLSDPESYDGGELVVNDTF-GQHRVKLPAGDLVLYPSSSLHCVTP
Y1221_KLEP7      ----GWMRTDLSATLFLCDPESYEGGELVIEDTY-GQHRVKLPAGHLVLYPASSLHCVTP
Y1553_XYLFT      DHTPASLRSDISCTLFLNDPDEYEGGELIIADTY-GEHEVKLPAGDLIIYPSTSLHRVAP
Y1638_XYLF2      DHTPASLRSDISCTLFLNDPDEYEGGELIIADTY-GEHEVKLPAGDLIIYPSTSLHRVAP
Y1709_XYLFM      DHTPASLRSDISCTLFLNDPDEYEGGELIIADTY-GEHEIKLPAGDLIIYPSTSLHRVAP
Y598_XYLFA       GHTPASLRSDISCTLFLNDPDEYEGGELIIADTY-GEHEVKLPAGDLIIYPSTSLHRVAP
Y1146_STRMK      ----EQLRSDISCTLFLSAPYEYEGGELIISDTY-GEHEVKLPAGDLIVYPSSSLHQVRP
Y3399_HERAR      ---NLSLRTDLSCTLFLCEPEDYDGGELIVSDTY-GEHEVKLPAGDMILYPSSSLHKVEP
Y3620_JANMA      ---NLSLRTDLSCTLFLCEPEDYDGGELIVADTY-GEHEVKLPAGDMILYPSSSLHKVEP
Y3618_JANMA      ---NLSLRTDLSCTLFLSEPEEYEGGELVVADTY-GEHAVKLPAGDMILYPASSVHKVEP
Y3725_METPP      ---HLRLRTDLSSTLFLSDPDDYDGGELVVVDTY-GTHEVKLPAGDLILYPSTSLHRVEP
Y1978_BORBR      ----ERVRTDLSATLFFSEPDSYDGGELVVDDTY-GPRTVKLPAGHMVLYPGTSLHKVTP
Y2533_BORPA      ----ERVRTDLSATLFFSEPDSYDGGELVVDDTY-GPRTVKLPAGHMVLYPGTSLHKVTP
Y3529_BORPE      ----ERVRTDLSATLFFSEPDSYDGGELVVDDTY-GPRTVKLPAGHMVLYPGTSLHKVTP
Y2704_BORPD      ----ERVRTDLSATLFFSDPDTYDGGELVVDDTY-GPRSVKLPAGHLVLYPGTSLHKVNP
PIUC_PSEAE       ----ERVRTDLSSTLFFSDPEDYDGGELVIQDTY-GLQQVKLPAGDLVLYPGTSLHKVNP
Y5858_PSEAB      ----ERVRTDLSSTLFFSDPEDYDGGELVIQDTY-GLQQVKLPAGDLVLYPGTSLHKVNP
Y5129_PSEA7      ----ERVRTDLSSTLFFSDPQDYDGGELVIQDTY-GLHQVKLPAGDLVLYPGTSLHKVNP
Y892_PSEP1       ----ERVRTDLSSTLFLSDPESYDGGELVIQDTY-GVQQVKLAAGDMVLYPGTSLHKVNP
Y862_PSEPK       ----ERVRTDLSSTLFLSDPESYDGGELVIQDTY-GVQQIKLAAGDMVLYPGTSLHKVNP
Y905_PSEPG       ----ERVRTDLSSTLFLSDPDSYDGGELVIQDTY-GVQQVKLAAGDLVLYPGTSLHKVNP
Y4316_PSEPW      ----ERVRTDLSSTLFLSDPDSYDGGELVIQDTY-GEQQVKLAAGDLVLYPGTSLHKVNP
Y1031_PSEE4      ----ERIRTDLSSTLFLNDPDSYDGGELVIQDTF-GVQQVKLAAGDMVLYPGTSLHKVNP
Y865_PSEF5       ----ERVRTDLSSTLFFSDPEDYEGGELEIQDTF-GLQRVKLPAGDMVLYPGTSLHKVNP
Y799_PSEPF       ----ERVRTDLSATLFFSEPEDYDGGELEIQDTF-GTQRVKLPAGDMVLYPGTSLHKVNA
Y995_PSEU5       ----ERVRTDLSATLFFSDPDEYDGGDLVIQDTY-GTQRVKFAAGDMVLYPSTSLHKVEP
Y7101_BURL3      ----ERVRTDLSATLFLNDPASYDGGELVVRDTY-GEHHAKLAAGSMILYPGSSVHKVEP
Y2942_XANAC      ----EAVRTDVSATLFLSDPDSYDGGELVIEDTY-GTQSVKLPAGHLVIYPGTSLHRVMP
Y3086_XANC5      ----DPVRTDVSATLFLSDPDSYDGGELVIEDTY-GTQSVKLPAGHLVIYPGTSLHRVMP
Y2773_XANCP      ----DPVRTDVSATLFLSDPDSYDGGELVIEDTY-GTQSVKLPAGHLVIYPGTSLHKVMP
Y1340_XANC8      ----DPVRTDVSATLFLSDPDSYDGGELVIEDTY-GTQSVKLPAGHLVIYPGTSLHKVMP
Y1388_XANCB      ----DPVRTDVSATLFLSDPESYDGGELVIEDTY-GTQSVKLPAGHLVIYPGTSLHKVMP
Y2812_SACD2      ----VKVRTDISMTLFLSEPDEYEGGELVIEDTY-GSQSVKLAAGDMVLYPATSLHSVTP
Y3905_BRADU      ----LRIRTDLSVTLFLAEPDEYDGGELVIEDTY-GSHEVKLPAGDCVLYPSTSLHLVTP
Y1514_NITHX      ----LRIRTDLSVTLFLSEPDDYDGGDLVVEDNY-GSHEVKLPAGDLVLYPASSLHLVTP
Y3334_RHOPS      ----LRIRTDLSVTLFLAEPDEYDGGELVVEDTY-GSHEVKLPAGDCVLYPSSSLHMVTP
Y2089_RHOP2      ----LRIRTDLSVTLFLSEPDEYDGGELVIEDTY-GSHEIKLPAGDCVLYPSTSLHMVTP
Y3479_RHOPA      ----LRIRTDLSVTLFLAEPDEYDGGELVIEDTY-GSHEVKLAAGDAVLYPSTSLHMVTP
Y3541_BRASB      ----LRIRTDLSMTLFLAEPDTYDGGELVIEDTY-GSHEVKLPAGHAVLYPSSSLHMVTP
Y4652_BRASO      ----LRIRTDLSMTLFLAEPDTYDGGELVIEDTY-GSHEVKLPAGHAVLYPSSSLHMVTP
Y1313_BRASB      ----LRIRTDLSVTLFLSEPEEYDGGELVIEDLY-GSHEVKLPAGDLVLYPASSLHMVTP
Y6316_BRASO      ----LRIRTDLSVTLFLSEPDEYDGGELVIEDLY-GSHEVKLPAGDLVLYPASSLHMVTP
Y1130_METS4      ----LRIRTDLSVTLFLAEPDEYDGGELVAEDYY-GTQEVKLPAGDLVLYPSSSLHRVTP
Y027_CAUVC       ----QRLRTDLSCTLFLAEPEDYDGGELVVNDLY-GDHVVKLAAGDAILYPSTSLHHVTT
Y045_CAUSK       ----QTLRTDLSITVFLSDPDDYDGGELVVEDAY-GSHLVKLAAGAAILYPASSLHHVTE
Y3557_BURCA      ----FRVRSDLSATLFLEEPDAYDGGELCVEDTY-GVHRAKLPAGDLVLYPASSLHHVTP
Y5473_BURCC      ----FRVRSDLSATLFLEEPDAYDGGELCVEDTY-GVHRAKLPAGDLVLYPASSLHHVTP
Y4810_BURCH      ----FRVRSDLSATLFLEEPDAYDGGELCVEDTY-GVHRAKLPAGDLVLYPASSLHHVTP
Y4192_BURCM      ----FRVRSDLSATLFLEEPDAYDGGELCVEDTY-GVHRAKLPAGDLVLYPASSLHHVTP
Y4714_BURA4      ----FRVRSDLSATLFLAEPDAYDGGELCVEDTY-GVHRAKLPAGDLVLYPASSLHHVTP
Y892_BURL3       ----FRVRSDLSATLFLEEPDAYDGGELCVEDTY-GTHRAKLPAGDLVLYPASSLHHVTP
Y5206_BURPS      ----FRVRSDLSATLFLEEPEHYDGGELCVEDTY-GVHRAKLPAGDMVLYPASSLHHVTP
Y4200_BURP1      ----FRVRSDLSATLFLEEPEHYDGGELCVEDTY-GVHRAKLPAGDMVLYPASSLHHVTP
Y5709_BURP0      ----FRVRSDLSATLFLEEPEHYDGGELCVEDTY-GVHRAKLPAGDMVLYPASSLHHVTP
Y5790_BURP6      ----FRVRSDLSATLFLEEPEHYDGGELCVEDTY-GVHRAKLPAGDMVLYPASSLHHVTP
Y4601_BURTA      ----FRVRSDLSATLFLEEPDAYDGGELCVEDTY-GVHRAKLPAGDMVLYPASSLHHVTP
Y7194_PARXL      ----FRIRSDLSATLFLAEPDTYEGGELCIEDTY-GVHRARLPAGDMVLYPASSLHHVSP
Y4660_CUPPJ      ----FRVRSDLSATLFLTEPQDYDGGELVIEDTY-GQHRVKLPAGYMVLYPATSLHHVTP
Y2317_METFK      ----FRIRSDLSATLFFSEPEDYDGGVLTIEDTF-GIQEVKLPAGHMVLYPSSSLHHVTP
Y4046_SPHWW      ----FRIRSDLSATLFLNDPDSYDGGELVVEDTL-GTHKVKLGAGDMILYPASSLHHVTP
Y1196_BORA1      ----RGVRTDLSATLFLSPPDTYDGGELIIQDSY-GEHRVKLPAGDMVLYPAGSLHRVTA
Y4577_RHOP5      ----VRVRTDVSSTLFLSDPDEYDGGELVVEDTY-GSHAAKLPAGDMVVYPGTSLHHVTK
Y3637_NITHX      ----MRVRTDVSSTLFLSSPEEYDGGELVIEDTY-GAHSVKLPAGDMIVYPGTSVHHVTK
Y3753_AZOC5      ----EPLRTDVSTTLFLSEPDEYEGGELVVEDTY-GAHKVKLPAGDAIVYPATSLHHVTP
Y236_BEII9       ----LRIRTDVSATLFLAGPEDYDGGELTIEDTY-GTHSVRLPAGDLIIYPADSLHFVSP
Y4479_BURCM      ----VKLRTDVSVTLFLSAPDEYDGGELVIEDAY-GVQQVKLPAGDMIVYPATSLHQVTP
Y5004_BURA4      ----VKLRTDVSVTLFLSAPDEYDGGELVIEDAY-GVQQVKLPAGDMIVYPATSLHQVTP
Y7756_PARXL      ----VKLRTDVSVTLFISDPADYDGGELVIEDTY-GVQQVKLPAGDMIVYPATSLHQVTP
Y2877_CUPPJ      ----RKLRTDISATLFLSPHDSYDGGELQVQDTY-GMHSVKLDAGDMVVYPATSLHQVTP
Y3078_CUPMC      ----RKLRTDVSATLFLSDPASYDGGELQIEDTY-GVHSVKLAAGDMVVYPSTSLHQVKP
Y1238_GLUDA      ----ARVRTDLSSTLFLSEPDEYDGGELVLHEPG-STQELKLPAGDMVLYPTTALHSVNE
Y559_GLUOX       ----MRIRTDVSSTLFLTGPDEYDGGELVIQDTY-GTQSVKLPAGDMVLYPSTSLHSVNR
Y4677_PARDP      ----QRIRTDVSTTVFLTPPEDYDGGELVMHDTY-GQHSVKLPAGHAVVYPATSLHSVTP
Y838_CUPMC       G---MRIRADVSSTLFLTDPDEYDGGELVIKDLY-GSHTVKLPAGHMVVYPASSLHAVTP
Y377_PARL1       ----HRIRSDISATLFFSEPDEYEGGELIVEDTY-GSHAIKLPAGHMVLYPGTSLHRVAP
Y803_PSEMY       ----HRIRADLSATLFFSEPEEYEGGELVVQD-----KRIKLPAGHLILYSSGSLHRVEP
Y701_NITWN       ----VRIRGDLSATLFLSEPGDYDGGELIIQGEF-ARHQFKLPAGQMILYPASTFHQVTP
Y1172_DELAS      ----IKVRSDVSTTVFFSEPDEYEGGELIVEDTF-GHQSVKLAAGDAIVYPGTSLHRVNP
Y2117_HYPNA      ----VSVRTDVSTTVFLNDPEDYDGGELIVEDTY-GVHEVKLPAGDAILYPATSLHRVES
Y1523_PSYWF      ----QLMRTDLSLTLFLNNPADYEGGELVISDEY-GEHSIKLSAGDAVLYPSTSLHRVNT
Y1910_SPHAL      ----GQLRTDVSCTIFLSDPADYDGGALHVQLGN-ADLRFKEAPGVAIVYPSHTLHEVEP
                        * *:* :  :     : ** :            :   *  : *.    * *  

Y3707_ACAM1      VTSGTRLVAVGWVQSLVRDVQQRELLFDLDTARR--------------------------
Y3668_CROS5      VKTGTRLVVVGWVHSLIRDTAQREILFDIDTVRR--------------------------
Y2658_SYNP2      VTKGTRLVAVGWVQSWIRDAQKREIVFDLDVSRR--------------------------
Y1482_SYNP6      VEQGYRFACVGWVQSWIRDPAKRELLFDLDTARR--------------------------
Y015_SYNE7       VEQGYRFACVGWVQSWIRDPAKRELLFDLDTARR--------------------------
Y1907_THEEB      VSKGVRLVAVAWVQSLIRDPLERELLFELDTVRR--------------------------
Y2270_SYNJB      VTRGIRYAAVSWVQSLIRDPQEREILFDLQTVRQ--------------------------
Y2611_SYNJA      VTRGIRYAAVSWVQSLIRDPQEREILFDLQTVRQ--------------------------
Y3426_COLP3      VTSGSRKVALTWIESHIPQASQREILFDLDCARK--------------------------
Y759_IDILO       VTKGSRLAMIGWVQSLVKQPNYRELLFDIEQSLK--------------------------
Y1675_MARMM      VTRGERVAVVGWVRSLVRRPDQREILFDLDQVSA--------------------------
Y037_PARL1       VTSGERRAAVGWIRSLVRSAEDRETLFDVALALR--------------------------
Y1619_PROM1      VKDGERHVCVGWIQSYVQNNEDRNFLFGLDAGAK--------------------------
Y775_PROMT       VKDGERHVCVGWIQSYVQNNEDRNFLFGLDAGAK--------------------------
Y1271_PROMA      VTSGTRIVCVGWIQSYIPNNEDRKILFSLDAGAK--------------------------
Y1256_PROM4      VSQGERIVCVGWIQSYVANNEDRNFLFGLDAGAR--------------------------
Y1262_PROM9      IKNGERLVCVGWIESYVKSIEQREYLFDLDAGAK--------------------------
Y1332_PROM5      VKNGERLVCVGWIESYVKSIEEREYLFDLDAGAK--------------------------
Y1353_PROMS      ILSGERIVCVGWIESYVKSIEKREYLFDLDAGAK--------------------------
Y1362_PROM0      VNNGERLVCVGWIESYVKSTEKREYLFDLDAGAR--------------------------
Y1374_PROM2      VFSGERFVVVGWIESYVKSIEEREYLFDLDAGAR--------------------------
Y2049_PROM3      VTAGERLVCVGWIQSYISSNEDRTILFGLNAGAR--------------------------
Y286_PROMM       VTAGERLVCVGWIQSYISSNEDRTILFGLNAGAR--------------------------
Y1577_SYNSC      VLSGDRYVCVGWIESYVKAADDRSMLFNIDAGAR--------------------------
Y2001_SYNS9      ISSGVRLVCVGWIESYIQSTEDRSLLFNLDAGAK--------------------------
Y1544_SYNS3      VTSGIRTVCVGWIESYVQAENDRICLFQLESGAR--------------------------
Y1625_HYPNA      VTSGERFVFVGWIQSAIKDAAQRAILFDVTNLKA--------------------------
Y2273_PSEA6      VTKGRRTASFFWIESLVRSNDQRSMLFDLDQSIQ--------------------------
Y512_ACISJ       VTRGARVASFFWIESLVPDEGERTLLFDLDQSIQ--------------------------
Y612_SHEFN       VTRGQRIAAITWMQSMVADVTLRQTLYQLDQSIQ--------------------------
Y721_SHEB8       VLSGERTAAFMWLQSMVRDEGQRRLLFQLDQSIQ--------------------------
Y750_SHEB9       VLSGERTAAFMWLQSMVRDEGQRRLLFQLDQSIQ--------------------------
Y3634_SHEB5      VLSGERTAAFMWLQSMVRDEGQRRLLFQLDQSIQ--------------------------
Y717_SHESA       VTSGERTAAFMWLQSMVRDEGQRRLLFQLDQSIQ--------------------------
Y3244_SHESM      VTSGERTAAFMWLQSMVRDEGQRRLLFQLDQSIQ--------------------------
Y698_SHESR       VTSGERTAAFMWLQSMVRDEGQRRLLFQLDQSIQ--------------------------
Y3913_SHEON      VTSGERTSAFMWLQSMVRDEGQRRLLFQLDQSIQ--------------------------
Y2125_NITEU      VTRGERLACFMFIQSMVRNPDQRRLLYEMDMALL--------------------------
Y373_NITEC       VTHGERIACFMFIQSMVRDPNQRRLLYEMDMALL--------------------------
Y608_AZOSB       VTAGARVACFMFMQSMVRDAHQRRLLFDMDMALL--------------------------
Y3048_POLSJ      VTRGQRLACFFWVESLVRGNEQRRLLFDMDMALM--------------------------
Y3084_VEREI      VTRGYRMACFFWVESLVRSAEQRRLLYDMDMALL--------------------------
Y2559_POLNA      VTRGHRLACFFWIESLVRGDDQRRLLYELDMNLL--------------------------
Y1570_LEPCP      VTRGARVGCFFWIESMVRSDEQRRLLHEMDQHLM--------------------------
Y531_ACIAD       ITRGSRFASFFWVQSLVRDDTKRHLLFNLDETVR--------------------------
Y473_ACIBT       ITAGTRFASFFWVQSLVRDDSKRHLLFSLDESIR--------------------------
Y484_ACIBC       ITSGCRIASFFWVQSMVRDDAERHMLFNLDQTVQ--------------------------
Y3291_ACIBY      ITSGCRIASFFWVQSMVRDDAERHMLFNLDQTVQ--------------------------
Y724_ARCB4       VTKGVRMVSFMWIQSMIRSAWKRSILFELDNTIQ--------------------------
YBIX_ECOLC       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECODH       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECOLI       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECOHS       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_SHISS       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECO24       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECO57       VTRGVRVASFIWIQSMIRDDKKRAMLFELDKNIQNIQ-----------------------
YBIX_SHIBS       VTRGVRVASFMWIQSMIRDDKKRAMLFELDKNIQ--------------------------
YBIX_SHIFL       VTRGVRVASFMWIQSMIRDDKKRAMLFELDKNIQ--------------------------
YBIX_SHIF8       VTRGVRVASFMWIQSMIRDDKKRAMLFELDKNIQ--------------------------
YBIX_SHIDS       VTRGVRVASFMWIQSMIRDDKKRAMLFELDKNIQ--------------------------
YBIX_ECOL6       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECOL5       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECOUT       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECOK1       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
YBIX_ECOSM       VTRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQ--------------------------
Y1221_KLEP7      VTRGVRQASFLWIQSMVRDDKQRAMLYDLDRTIQ--------------------------
Y1553_XYLFT      VTRGMRIASFFWVQSLVRQATHRHQLLELDTAIQ--------------------------
Y1638_XYLF2      VTRGMRIASFFWVQSLVRQATHRHQLLELDTAIQ--------------------------
Y1709_XYLFM      VTRGMRIASFFWVQSLVRQATHRHQLLELDTAIQ--------------------------
Y598_XYLFA       VTRGMRIASFFWVQSLVRQATHRHQLLELDTAIQ--------------------------
Y1146_STRMK      VTAGARVASFFWVQSMVRDDVQRRLLWEMDGSIE--------------------------
Y3399_HERAR      VTRGARVCSFFWLQSMVADDGKRSLLFELDQNIQ--------------------------
Y3620_JANMA      VTRGARVCSFFWLQSMVADDAKRSLLFELDQNIQ--------------------------
Y3618_JANMA      VTHGARISSFFWVQSMVADDGKRGLLFELDQNIQ--------------------------
Y3725_METPP      VTRGTRVCSFFWTQSMVRDDGQRHLLFELDQDIQ--------------------------
Y1978_BORBR      VTRGARISAFFWLQSLVREDSQRSLLLEMDVAIQ--------------------------
Y2533_BORPA      VTRGARISAFFWLQSLVREDSQRSLLLEMDVAIQ--------------------------
Y3529_BORPE      VTRGARISAFFWLQSLVREDSQRSLLLEMDVAIQ--------------------------
Y2704_BORPD      VTRGARISAFFWMQSLVREDSQRNLLLDMDVAIQ--------------------------
PIUC_PSEAE       VTRGARYASFFWTQSLVREDSQRTLLFEMDQSIQ--------------------------
Y5858_PSEAB      VTRGARYASFFWTQSLVREDSQRTLLFEMDQSIQ--------------------------
Y5129_PSEA7      VTRGARYASFFWTQSLVREDSQRTLLFEMDQSIQ--------------------------
Y892_PSEP1       VTRGQRYAAFFWTQSLVRDDSQRTLLFEMDNAIQ--------------------------
Y862_PSEPK       VTRGQRYAAFFWTQSLVRDDSQRALLFEMDNAIQ--------------------------
Y905_PSEPG       VTRGQRYAAFFWAQSLVREDSQRALLFEMDNAIQ--------------------------
Y4316_PSEPW      VTRGVRYAAFFWTQSLVREDSQRALLFEMDNAIQ--------------------------
Y1031_PSEE4      VTRGARYAAFFWTQSLVREDSQRTLLFEMDNAIR--------------------------
Y865_PSEF5       VTRGARYASFFWTQSLVREDSQRALLFEMDGAIQ--------------------------
Y799_PSEPF       VTRGARYASFFWTQSLVREDSQRALLFEMDGAIQ--------------------------
Y995_PSEU5       VTRGARLASFFWIQSLVREDAQRTLLYEMDQAIQ--------------------------
Y7101_BURL3      VTRGERLASFFWVESLVREDAQRSLLLDMDVAIQ--------------------------
Y2942_XANAC      VTRGARVACFFWAQSMLRDAAQRRLLFELDVSIR--------------------------
Y3086_XANC5      VTRGARVACFFWTQSMLRDAAQRRLLFELDVSIR--------------------------
Y2773_XANCP      VTRGTRVASFFWIQSMLRNDAQRRLLFELDVSIR--------------------------
Y1340_XANC8      VTRGTRVASFFWIQSMLRNDAQRRLLFELDVSIR--------------------------
Y1388_XANCB      VTRGTRVASFFWIQSMLRNDAQRRLLFELDVSIR--------------------------
Y2812_SACD2      VTKGRRLASFFWLQSMVNSDEKRTLLFDMDMAIQ--------------------------
Y3905_BRADU      VTRGARVASFFWLQSMIRDDQARSMIFDLDTAIQ--------------------------
Y1514_NITHX      VTRGTRVASFFWLQSMVRDDHARSMIFDLDTAIQ--------------------------
Y3334_RHOPS      VTRGARVASFFWLQSMIRDAHARSMIYDLDGAIQ--------------------------
Y2089_RHOP2      VTRGARVASFFWLQSMIRDAHARSMIYDLDGAIQ--------------------------
Y3479_RHOPA      VTRGARVASFFWLQSMIRDAQARSMIYDLDNAIQ--------------------------
Y3541_BRASB      VTRGARVASFFWMQSMIRDAHVRSMIFDLDTAIQ--------------------------
Y4652_BRASO      VTRGARVASFFWMQSMIRDAHVRSMIFDLDTTIQ--------------------------
Y1313_BRASB      VTRGVRIASFFWLQSMIRDPLARSMIFDLDTTIQ--------------------------
Y6316_BRASO      VTRGVRVASFFWLQSMIRDPLARSMIFDLDTTIQ--------------------------
Y1130_METS4      VTRGTRVASFFWLQSMVRSPQARSLIYDLDGAIQ--------------------------
Y027_CAUVC       VTRGRRTASFFWIQSLIRDDARRSLLLDMDVAIQ--------------------------
Y045_CAUSK       VTRGVRTASFFWIQSLVRDDAKRGLLLDMDVAIQ--------------------------
Y3557_BURCA      VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQ--------------------------
Y5473_BURCC      VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQ--------------------------
Y4810_BURCH      VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQ--------------------------
Y4192_BURCM      VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQ--------------------------
Y4714_BURA4      VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQ--------------------------
Y892_BURL3       VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQ--------------------------
Y5206_BURPS      VTRGARVASFFWIQSMVRDDADRTLLYQLDTQIQ--------------------------
Y4200_BURP1      VTRGARVASFFWIQSMVRDDADRTLLYQLDTQIQ--------------------------
Y5709_BURP0      VTRGARVASFFWIQSMVRDDADRTLLYQLDTQIQ--------------------------
Y5790_BURP6      VTRGARVASFFWIQSMVRDDADRTLLYQLDTQIQ--------------------------
Y4601_BURTA      VTRGERVASFFWIQSMVRDDADRTLLFQLDTQIQ--------------------------
Y7194_PARXL      VTRGVRVASFFWIQSMVRDDGERATLFQLDNDVQ--------------------------
Y4660_CUPPJ      VTRGARVSSFFWIQSMVRDEGQRALLFELDTRIQ--------------------------
Y2317_METFK      VTRGVRVSSFFWMQSMIRDDAQRTLLFQLDGSIQ--------------------------
Y4046_SPHWW      VTRGERLCSFFWIQSMVRDDGARRTLFDLDTAIQ--------------------------
Y1196_BORA1      VTRGERIAAFFWIQSLVRDDGQRSLLFELDGAIQ--------------------------
Y4577_RHOP5      VTRGSRIASFFWTQSLIADVTRRAMMFDLDMSII--------------------------
Y3637_NITHX      VTRGSRIASFFWTESMISDVIRRAMMFDLDMSII--------------------------
Y3753_AZOC5      ITRGSRVASFFWTQSLIRDAGQRALLFDMDMAIM--------------------------
Y236_BEII9       VTRGSRIASFFWIQSLIRDKTQRNLLFNLDTAIM--------------------------
Y4479_BURCM      VTRGVRVASFFWVQSLVRSDAQRALLFDMDTAIQ--------------------------
Y5004_BURA4      VTRGVRVASFFWVQSLVRSDAQRALLFDMDTAIQ--------------------------
Y7756_PARXL      VTRGVRVASFFWVQSLVRSDTQRAMLFDMDTAIQ--------------------------
Y2877_CUPPJ      ITRGTRVASFFWIQSLIRDDTQRSLLFDMDNAIQ--------------------------
Y3078_CUPMC      ITRGVRVGCFFWIQSLIRDDGQRALLFDMDNAIQ--------------------------
Y1238_GLUDA      VTRGSRLASFFWTQSMIADEARRRIMFELDRTIM--------------------------
Y559_GLUOX       ITRGSRWASFFWSQSMVRDDTKRRLLYEFDCSII--------------------------
Y4677_PARDP      VTRGSRWASFFWAQSMVRDDWRRHMLYDLDMSIM--------------------------
Y838_CUPMC       VTRGARWASFFWAQSMVKDDGQRTMLYELDLTIM--------------------------
Y377_PARL1       VTKGVRLASFFWVQSLVREDSQRAMLWELDGAIQ--------------------------
Y803_PSEMY       VTRGARLASFFWVQSLVRQDEQRSVLLELDDSIQ--------------------------
Y701_NITWN       VTRGARLAAFFWTQSLVREHSRRALLFELDNTIQ--------------------------
Y1172_DELAS      VTRGTRYASFFWTHSLVASDEKRRILFDLDQQIQ--------------------------
Y2117_HYPNA      VTRGTRLASFLWTQSRVRDDARRGMLFQLDMTIL--------------------------
Y1523_PSYWF      VTSGQRLAMVTWVQSLVRSDEQRQILHDLDVSHILLRQKLLATSDQAQSTQAQSTQAQCG
Y1910_SPHAL      VTRGERLVAITFIQSLIPDVQQRNLMHELNEIAA--------------------------
                 :  * *   . : .* :     *  :  .                               

Y3707_ACAM1      ----SLFATHGK-TPEFDLISKSHANLLRQWAE-
Y3668_CROS5      ----SIFAKDGK-SVEFDLLAKTHANLLRQWAD-
Y2658_SYNP2      ----SLFAQSGK-TTEFDLLSKSVANLLRLWSE-
Y1482_SYNP6      ----SLFTREGK-SIEFDLLSKTYANLLRRWSE-
Y015_SYNE7       ----SLFTREGK-SIEFDLLSKTYANLLRRWSE-
Y1907_THEEB      ----SLFEKQGK-TVDFDLLCKVYSNLLRKWAEI
Y2270_SYNJB      ----QMFQESGK-TRHFDLISKVYANLLRKWAEL
Y2611_SYNJA      ----QMFQESGK-TRHFDLISKVYANLLRKWAEL
Y3426_COLP3      ----DIMEHHGK-TDAFDRITKTHANLLRQWAMT
Y759_IDILO       ----AEFDANGK-SENFDRLTKVFHNLLREWSDV
Y1675_MARMM      ----ALFARDGK-TRELDLVLKTKANLLRQWAED
Y037_PARL1       ----QAEA-AGD-RALTDRLLKIQGSLLRRWGED
Y1619_PROM1      ----GLLAKHGR-SDELDLIFQAYSNILRRLGD-
Y775_PROMT       ----GLLAKHGR-SDELDLIFQAYSNILRRLGD-
Y1271_PROMA      ----GLLAAHGQ-SHELDLVFQSYNNLLRRLGG-
Y1256_PROM4      ----GLLAKHGR-SDELDLVFQAYSNLLRRLGD-
Y1262_PROM9      ----GLLAKNGR-SDELDLIFKSYSNLLRLLGN-
Y1332_PROM5      ----GLLAKYGR-SDELDNIFKSYSNLLRLLGN-
Y1353_PROMS      ----GLLAKHGR-SDELDLIFKSYSNLLRLLGN-
Y1362_PROM0      ----SLLSKHGR-SDELDLIFKSYSNLLRDIGE-
Y1374_PROM2      ----SLLAKHGR-SDELDLIFKSYSNLLRTLGE-
Y2049_PROM3      ----ALLAEHGR-SPELDLIFQAYTNLLRRLGS-
Y286_PROMM       ----ALLAEHGR-SPELDLIFQAYTNLLRRLGS-
Y1577_SYNSC      ----GLLARHGR-SDELDLIFQSYTNAVRRLSS-
Y2001_SYNS9      ----GLLARHGR-SDELDLIFQAYANAVRRLSGR
Y1544_SYNS3      ----AVLAKHGR-SDELDLIFLAYTNLLRRLGG-
Y1625_HYPNA      ----GLARRFPPGSPELLTLAKTESNLIRMWSDI
Y2273_PSEA6      ----ALTVELGSNDAEVKRLTGVYHNLMRSWATC
Y512_ACISJ       ----QLTPLVAPDDPRLVQLTGVYHNLLRRWARP
Y612_SHEFN       ----NLIKANNTDRAELDNLHNVYHNLIRQFTQL
Y721_SHEB8       ----TLTAQQAAEQ-ELFNLTGIYHNLLRRWSEL
Y750_SHEB9       ----TLTAQQAAEQ-ELFNLTGIYHNLLRRWSEL
Y3634_SHEB5      ----SLTAQTAAEQ-ELFNLSGVYHNLLRRWSEL
Y717_SHESA       ----SLTAQAAPEQ-ELFNLTGVYHNLLRRWSEL
Y3244_SHESM      ----ALTAQAASEQ-ELFNLTGVYHNLLRRWSEL
Y698_SHESR       ----ALTAQAAPER-ELFNLTGVYHNLLRRWSEL
Y3913_SHEON      ----TLTAQQAAEQ-ELFNLTGVYHNLLRRWSEL
Y2125_NITEU      ----QLRQNIGE-TPAVVSLTGTYHNLLRQWADS
Y373_NITEC       ----QLRQNIGE-TEAVVSLTGTYHNLLRQWAES
Y608_AZOSB       ----QLRQSVGEDNDAVVRLTGTYHNLLRLWADA
Y3048_POLSJ      ----QLRQEHGESQA-TVALTGAYHNLLRMWADT
Y3084_VEREI      ----RLRQQHGESPE-TVALTGSYHNLLRMWADT
Y2559_POLNA      ----RLRERHGETAE-TTALTGTYHNLLRMWADT
Y1570_LEPCP      ----HLRRTVGETDAGVIGLTGTYHNLLRLWADT
Y531_ACIAD       ----SLRIQHGDGYPEVVKLTNIYHNLIRMWSEV
Y473_ACIBT       ----ELRKSHGDSYSEVMKLTNIYHNLIRMWSEL
Y484_ACIBC       ----NLRMQLGDNHSEVIKLTNLYHNLMRKWAEL
Y3291_ACIBY      ----NLRMQLGDNHSEVIKLTNLYHNLMRKWAEL
Y724_ARCB4       ----SLRVNYGE-IEETLNLSIHYHKLIQEWSEL
YBIX_ECOLC       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECODH       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECOLI       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECOHS       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_SHISS       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECO24       ----SLKSRYGE-NEEILSLLNLYHNLLREWSEI
YBIX_ECO57       ----SLKSRYGE-NEEILSLLNLYHNLLREWSEI
YBIX_SHIBS       ----SLKSRYGE-NEEILSLLNLYHNLLREWSEI
YBIX_SHIFL       ----SLKSRYGE-NEEILSLLNLYHNLLREWSEI
YBIX_SHIF8       ----SLKSRYGE-NEEILSLLNLYHNLLREWSEI
YBIX_SHIDS       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECOL6       ----SLKSHYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECOL5       ----SLKSHYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECOUT       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECOK1       ----SLKSRYGE-SEEILSLLNLYHNLLREWSEI
YBIX_ECOSM       ----SLKSHYGE-SEEILSLLNLYHNLLREWSEI
Y1221_KLEP7      ----SLKARFGD-GEEVLSLLNMYHNLLRQWTEV
Y1553_XYLFT      ----SLTASNTD-HNTILRLTNVYHNLLREWSET
Y1638_XYLF2      ----SLTASNTD-HNTILRLTNVYHNLLREWSET
Y1709_XYLFM      ----SLTASNTD-HNTILRLTNIYHNLLREWSET
Y598_XYLFA       ----SLTASNTD-HNTILRLTNIYHNLLREWSET
Y1146_STRMK      ----RLRQTGGD-AEAVLQLTGVYHNLLRRWSEV
Y3399_HERAR      ----KLREKLGD-CEEVVGLTGHYHNLLRQWAAV
Y3620_JANMA      ----KLRAKLGD-CEEVVGLTGHYHNLLRQWAAV
Y3618_JANMA      ----KLRARLGD-CEEIIGLTGHYHNLLRQWAMV
Y3725_METPP      ----KLREKLGD-CPEVLSLTGHYHNLLRQWAEV
Y1978_BORBR      ----RLNQDTP-GHASIVQLTGVYHNLLRRWTDV
Y2533_BORPA      ----RLNQDTP-GHASIVQLTGVYHNLLRRWTDV
Y3529_BORPE      ----RLNQDTP-GHASIVQLTGVYHNLLRRWTDV
Y2704_BORPD      ----RLNQDAA-GHPSIVQLTGIYHNLLRRWADV
PIUC_PSEAE       ----RLTRDVP-DHPSLIRLTGTYHNLLRRWSEL
Y5858_PSEAB      ----RLTHDVP-DHPSLIRLTGTYHNLLRRWSEL
Y5129_PSEA7      ----QLTRDVP-EHPSLIRLTGTYHNLLRRWSEL
Y892_PSEP1       ----QLTADVP-DHPSLLQLTGTYHNLLRRWAEV
Y862_PSEPK       ----QLTADVP-DHPSLLQLTGTYHNLLRRWAEV
Y905_PSEPG       ----QLTADVP-DHPSLLQLTGTYHNLLRRWAEV
Y4316_PSEPW      ----QLTADVP-EHPSLLQLTGTYHNLLRRWAEV
Y1031_PSEE4      ----QLTADVP-EHPSLLQLTGTYHNLLRRWAEV
Y865_PSEF5       ----ELTRDVP-DHPSLVRLTGTYHNLLRRWVEV
Y799_PSEPF       ----QLTHDMP-DHPSLIRLTGTYHNLLRRWVEV
Y995_PSEU5       ----QLTADVP-DHPSLVQLTGTYHNLLRRWVEV
Y7101_BURL3      ----RLTQRDA-DGESLLQLTGAYHNLLRMWADA
Y2942_XANAC      ----RLTQDTP-GHPSLIQLTGVYHNLLRQWADV
Y3086_XANC5      ----RLTQDTP-GHPSLIQLTGVYHNLLRQWADV
Y2773_XANCP      ----RLTQDTP-GHPSLIQLTGVYHNLLRQWADV
Y1340_XANC8      ----RLTQDTP-GHPSLIQLTGVYHNLLRQWADV
Y1388_XANCB      ----RLTQDTP-GHPSLIQLTGVYHNLLRQWADV
Y2812_SACD2      ----SLRAQVD-DSPEIVQLTGVYHNLLRQWAQT
Y3905_BRADU      ----ALVERLGRDDPETVKLTGIYHNLIRYWAEV
Y1514_NITHX      ----SLVERLGRDDPETVKLTGIYHNLIRYWAEV
Y3334_RHOPS      ----ALVERLGRDDPETVKLTGIYHNLIRYWADV
Y2089_RHOP2      ----ALVERLGRDDPETVKLTGIYHNLIRYWAEV
Y3479_RHOPA      ----ALVERLGRDDPETVKLTGIYHNLIRYWAEV
Y3541_BRASB      ----SLTERLGRDDPDAVKLTGIYHNLIRQWAEV
Y4652_BRASO      ----SLTERFGRDDPDAVKLTGIYHNLIRQWAEV
Y1313_BRASB      ----DLSRRMGRDDPEMVRLTGLYHNLIRYWAET
Y6316_BRASO      ----GLSQRMGRDDPEMVRLTGLYHNLIRYWAET
Y1130_METS4      ----GLAAELGQDHAEVVRLAGIYHNLIRTWAEV
Y027_CAUVC       ----QLSRKVERDDEAILSLTGVYHNLLRQWAEV
Y045_CAUSK       ----RLSGAVGTTDPSVLSLTGTYHNLLRMWAEV
Y3557_BURCA      ----ALSAEKGAKDPVVISLTGIYHNLLRKWADA
Y5473_BURCC      ----ALSAEKGAKDPVVISLTGIYHNLLRKWADA
Y4810_BURCH      ----ALSAEKGAKDPVVISLTGIYHNLLRKWADA
Y4192_BURCM      ----ALSAEKGAKDPMVISLTGIYHNLLRKWADA
Y4714_BURA4      ----ALSAEKGAKDPMVISLTGIYHNLLRKWADA
Y892_BURL3       ----ALSAEKGAKDPMVISLTGIYHNLLRKWADA
Y5206_BURPS      ----RLTAEKGGRDASVIALTGIYHNLLRRWADA
Y4200_BURP1      ----RLTAEKGGRDASVIALTGIYHNLLRRWADA
Y5709_BURP0      ----RLTAEKGGRDASVIALTGIYHNLLRRWADA
Y5790_BURP6      ----RLTAEKGGRDASVIALTGIYHNLLRRWADA
Y4601_BURTA      ----QLTAEKGGRDASVIALTGIYHNLLRRWADA
Y7194_PARXL      ----RLAAEKGSNDATVVSLTGIYHNLLRRWADA
Y4660_CUPPJ      ----QVAEEMGQKDSGVVGLTGVYHNLLRRWADA
Y2317_METFK      ----AIGAERGAGDPEVIRLTGVYHNLLRMWADS
Y4046_SPHWW      ----AVAADRGQDDPAIIRLTGVYHNLLRRWAEA
Y1196_BORA1      ----DAAQELGVGAPSVVTLTGVYHNLLRRWASP
Y4577_RHOP5      ----RLNADHPD-HPSVLSLTGLYHNLLRQWAEV
Y3637_NITHX      ----RLNADHPE-HPSVVSLTSLYHNLLRQWAQS
Y3753_AZOC5      ----RLNQDHPG-HISAVQLTGVYHNLLRQWAEV
Y236_BEII9       ----RLTEDVAG-NPALVSLQGVYHNLLRQWAEI
Y4479_BURCM      ----RLNASGAD-TDACRSLVGCYHNLLRIWSET
Y5004_BURA4      ----RLNASGAD-TEACRSLVGCYHNLLRIWSET
Y7756_PARXL      ----RLNATNAD-DAARRSLVGIYHNLLRTWSEP
Y2877_CUPPJ      ----RLNQTGAD-EEARRTLVGCYHNLLRQWSET
Y3078_CUPMC      ----TLNQTNAD-ERARRTLVGCYHNLLRQWSDT
Y1238_GLUDA      ----DLRTRLPDDDLAVLNLTNCYHNLMRQWCVL
Y559_GLUOX       ----ETRKALPDSHPAVLGLTSTYHNLLRQWAEL
Y4677_PARDP      ----RIRSMLPDDDPAVTGITAHYHNMIRHWAET
Y838_CUPMC       ----EVRRQLGDDKDAVLALVNHYHNLLRRWAEL
Y377_PARL1       ----RVTLDTPE-SPALPQLMALYHNLLRRWSNT
Y803_PSEMY       ----ALRQQVPD-SPELVRLTGIYHNLLRQWTQT
Y701_NITWN       ----ALAQDNPE-QPAVARLTGLYHNLLREWSET
Y1172_DELAS      ----QLTVRHPG-DPALSALSGTYHNLLRMWSQA
Y2117_HYPNA      ----SLRGKLAD-APEVVALTGHYHNLLRQWADA
Y1523_PSYWF      QLSEQHSTDQQLTHQAIEKLNQSYHNLLRLWAES
Y1910_SPHAL      ------LEGGKMEPANYTRLQAVQYQLLRMWRR-
                                    :     . ::