CLUSTAL format seed alignment for MF_00658

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLMH_UREPA       --------------MMIKIISVGKLK---------QKAFVDLINDYLKRINHYL-KCQEI
RLMH_UREP2       --------------MMIKIISVGKLK---------QKAFVDLINDYLKRINHYL-KCQEI
RLMH_UREU1       --------------MIIKIISVGKLK---------QTGFVNLVNDYLKRINYYL-KCQEI
RLMH_ACHLI       --------------MKVKIISVGKVK---------DKGLNELINYYAKQIK----TIEMV
RLMH_LACLM       --------------MKIKLVVVGKLK---------EKYLKDGIAEYVKRMGTML-PLEII
RLMH_LACLS       --------------MKIKLVVVGKLK---------EKYLKDGIAEYVKRMGTML-PLEII
RLMH_LACLA       --------------MKIKLVVVGKLK---------EKYLKDGIAEYVKRMGTML-PLEII
RLMH_LEUMM       --------------MNIKLITVGKLK---------EKYLTEGIAEYTKRLSRFC-KVQVV
RLMH_LEUCK       --------------MNIKLITVGKLK---------EHYLKDGIAEYSKRIARFA-KVELI
RLMH_STRGC       --------------MKIKLVTVGKLK---------EKYLKEGIAEYSKRLSRFT-KVEII
RLMH_STRSV       --------------MKIKLVTVGKLK---------EKYLKDGIAEYMKRLNRFC-KVEMI
RLMH_STRSY       --------------MKIKLITVGKLK---------EKYLKEGIAEYSKRLGRFT-KLDMI
RLMH_STRPC       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRPZ       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRPM       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRPF       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRP6       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRP1       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRPB       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRP8       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRPG       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STRP3       --------------MKVKLICVGKLK---------ERYLKDGISEYQKRLSRFC-QFEMI
RLMH_STREM       --------------MKIKLICVGKLK---------EAYLRDGIAEYQKRLSRFC-QCDII
RLMH_STRA1       --------------MKLKIITVGKLK---------EKYLKEGVAEYQKRLNRFS-KIETI
RLMH_STRA3       --------------MKLKIITVGKLK---------EKYLKEGVAEYQKRLNRFS-KIETI
RLMH_STRA5       --------------MKLKIITVGKLK---------EKYLKEGVAEYQKRLNRFS-KIETI
RLMH_STRT2       --------------MKVKLITVGKLK---------EKYLKDGIAEYIKRLGRFT-KFESI
RLMH_STRT1       --------------MKVKLITVGKLK---------EKYLKDGIAEYIKRLGRFT-KFESI
RLMH_STRTD       --------------MKVKLITVGKLK---------EKYLKDGIAEYIKRLGRFT-KFESI
RLMH_STRMU       --------------MKVKLITVGKLK---------EKYLKDGIAEYCKRLKRFT-KFELE
RLMH_STRP4       --------------MKIKVVTVGKLK---------EKYLKDGIAEYSKRISRFA-KFEMI
RLMH_STRPS       --------------MKIKVVTVGKLK---------EKYLKDGIAEYSKRISRFA-KFEMI
RLMH_STRPN       --------------MKIKVVTVGKLK---------EKYLKDGIAEYSKRISRFA-KFEMI
RLMH_STRR6       --------------MKIKVVTVGKLK---------EKYLKDGIAEYSKRISRFA-KFEMI
RLMH_STRP2       --------------MKIKVVTVGKLK---------EKYLKDGIAEYSKRISRFA-KFEMI
RLMH_OENOB       -------------MLNIRILVVGKIK---------EKYFRNALDQYLKRLSRFT-KIEII
RLMH2_THEPX      --------------MKIHIIAVGKIK---------ENYINNGINFYLKKLRPYC-EIEIR
RLMH1_THEP3      --------------MKIYIIAVGKIK---------ENYISDGIVFYLKKLRPYC-EIEIK
RLMH2_CALS4      --------------MKIQIIAVGTIK---------ENYIKDGIKFYLDKLKKIY-DIEIV
RLMH_ALKMQ       --------------MNITVISVGKLK---------EKYLKQGIAEYDKRLSRYC-KLNFI
RLMH_ALKOO       --------------MNITIISVGKLK---------EKYLKLGIDEYIKRLTRYA-KLNII
RLMH_LACP7       --------------MKITVVCVGKIK---------EKYLTMAIEEYSKRLSRYC-KLEII
RLMH_CLOPE       --------------MNITVISVGKLK---------EKYLKQAIDEYSKRLSRYC-KLEII
RLMH_CLOP1       --------------MNITVISVGKLK---------EKYLKQAIDEYSKRLSRYC-KLEII
RLMH1_CLOPS      --------------MNITVISVGKLK---------EKYLKQAIDEYSKRLSRYC-KLEII
RLMH_CLOTE       --------------MNITIISVGKLK---------EKYLKLAVEEYSKRLSRYC-KLNII
RLMH_CLOBA       --------------MNITIISVGKLK---------EKYLKHAIDEYSKRLSRYC-KLNIV
RLMH_CLOBB       --------------MNITIISVGKLK---------EKYLKHAIDEYSKRLSRYC-KLNIL
RLMH_CLOB8       --------------MNITIITVGKIK---------EKYLRDAIEEYSKRLGRYC-KLDIV
RLMH_CLOK5       --------------MNITIIAVGKLK---------EKYLKAAVEEYSKRLSRYC-RLNII
RLMH_CLOAB       --------------MNITLITVGKLK---------EKYLKDAVNEYAKRLQKYC-KLNII
RLMH_CLOB1       --------------MNISIISVGKIK---------EKFLKAAIDEYSKRLSKYC-KLNII
RLMH_CLOBH       --------------MNISIISVGKIK---------EKFLKAAIDEYSKRLSKYC-KLNII
RLMH_CLOBL       --------------MNISIISVGKIK---------EKFLKAAIDEYSKRLSKYC-KLNII
RLMH_CLOBK       --------------MNISIISVGKIK---------EKFLKAAIDEYSKRLSKYC-KLNII
RLMH_CLOBM       --------------MNISIISVGKIK---------EKFLRAAIDEYSKRLSKYC-KLNII
RLMH_CLONN       --------------MNITIICVGKLK---------EKYLKLAIDEYSKRLSRYC-KLNIV
RLMH_BIFLO       --------------MQIDIIAPGRVK---------ERYLRDAIDEYSKRLSRYC-KLNII
RLMH_BIFLD       --------------MQIDIIAPGRVK---------ERYLRDAIDEYSKRLSRYC-KLNII
RLMH_BIFAA       --------------MKITLITVGKVK---------EKYLRDAIAEYSKRLGRYC-KLGIV
RLMH_CLOD6       --------------MNISIVVVGKIK---------EKYLKLGIDEFKKRLSKYC-KLEII
RLMH_FINM2       --------------MNIDIISVGKVK---------EKYIKLGIAEFSKRLSAHC-KLNII
RLMH_METM5       --------------MNITIISVGKIK---------EKYLSDAINEYSKRISRYS-KLDII
RLMH_METM7       --------------MNITIISVGKIK---------EKYLSDAINEYSKRISRYS-KIDII
RLMH_METM6       --------------MNITIISVGKIK---------EKYLSGAIIEYSKRISRYS-KLDII
RLMH_METMP       --------------MNVTIISVGKIK---------EKYLSDAIIEYSKRISRYS-KLDII
RLMH_METVS       --------------MNITIISVGKIK---------EKYLEDAVLEYKKRLSRYT-KLNII
RLMH_BACVZ       --------------MNINIVTIGKLK---------EKYLKQGIEEYKKRLSAYA-KIDII
RLMH_BACSU       --------------MNINIVTIGKLK---------EKYLKQGIEEYTKRLSAYA-KIDII
RLMH_BACLD       --------------MNISIVAIGKLK---------EKYLKQGIDEYIKRLSAYA-KVDII
RLMH_BACP2       --------------MNISIITVGKLK---------EKYLKQGIAEYTKRLQAYA-KIDII
RLMH_BACHD       --------------MNISIISVGKLK---------EKYLKQGIAEYTKRLGAYA-KIELI
RLMH_BACCZ       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSAYA-KVEVI
RLMH_BACAH       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSAYA-KVEVI
RLMH_BACAN       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSAYA-KVEVI
RLMH_BACHK       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSAYA-KVEVI
RLMH_BACCR       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSAYA-KVEVI
RLMH_BACC1       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSAYA-KVEVI
RLMH_BACMK       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSSYA-KVEVI
RLMH_BACCN       --------------MNISIISIGKLK---------EKYLKQGIAEYLKRLSSYA-KVEVI
RLMH_LISMO       --------------MNIQIVTVGKLK---------EKYLVQGIAEYLKRLSAYA-KVTIV
RLMH_LISMF       --------------MNIQIVTVGKLK---------EKYLVQGIAEYLKRLSAYA-KVTIV
RLMH_LISIN       --------------MNIQIVTVGKLK---------EKYLVQGIAEYLKRLSAYA-KVSIV
RLMH_LISW6       --------------MNIQIITVGKLK---------EKYLVQGIAEYLKRLTAYA-KVTIV
RLMH_BACSK       --------------MNITILSVGKLK---------EKYIKQGIDEYKKRLSAYA-KIQEI
RLMH_LYSSC       --------------MNITIVSVGKLK---------EKYLKMGIDEYVKRLGGYA-KIDLI
RLMH_OCEIH       --------------MNITIVSVGKLK---------EKYLKQGIDEYKKRLNAYA-KVSII
RLMH_GEOKA       --------------MHISIVAVGKLK---------EKYLIAGINEYTKRLSAYA-KIDII
RLMH_GEOTN       --------------MHISIAAVGKLK---------EKYLIAGVQEYTKRLSAYA-KIEII
RLMH_EXIS2       --------------MQITIITVGKLK---------EKYLKQGIAEYTKRLGAYC-SIQEI
RLMH_LACAC       --------------MNIKIVCVGKLK---------EKYFKDAIAEYQKRLSRFA-KVTIV
RLMH_LACH4       --------------MNIKIVCVGKLK---------EKYFKDAIAEYKKRLSRFA-KVSIV
RLMH_LACGA       --------------MNIKIVCVGKLK---------EKYFKDGIAEYVKRMGRFA-KVKII
RLMH_LACJO       --------------MNIKIVCVGKLK---------EKYFKDGIAEYVKRMSRFA-KVKIV
RLMH_LACDA       --------------MNIKIVCVGKLK---------EKYFKDGIAEYQKRLSRFA-KVEIV
RLMH_LACDB       --------------MNIKIVCVGKLK---------EKYFKDGIAEYQKRLSRFA-KVEIV
RLMH_LACP3       --------------MNIKIIGVGKLK---------EKYFRDGIAEYLKRMDKFA-KVKIV
RLMH_LACCB       --------------MNIKIIGVGKLK---------EKYFRDGIAEYLKRMDKFA-KVKIV
RLMH_LACSS       --------------MNIKIITVGKLK---------EKYLKAGIAEYAKRLSKFC-KFEII
RLMH_LACBA       --------------MNIKFVVVGKLK---------EKYFKQGIAEYAKRLSRFC-KFSIV
RLMH_LACPL       --------------MNIKIICVGKLK---------EKYFKQGIAEYAKRMSKFA-KFQIV
RLMH_LACRD       --------------MNIKIIGVGKLK---------EKYFKAGIAEYAKRLGRYC-KFEIV
RLMH_LACRJ       --------------MNIKIIGVGKLK---------EKYFKAGIAEYAKRLGRYC-KFEIV
RLMH_LACF3       --------------MNIKIIGVGKVK---------EKYFKAGIAEYAKRMERYA-KFEIV
RLMH_LACS1       --------------MNIKIIGVGKLK---------EKYLKQGIAEYAKRLGTFC-KFQIV
RLMH_PEDPA       --------------MNIKIIVVGKLK---------EKYLKQGIAEYSKRLSKFC-KFQII
RLMH_ENTFA       --------------MKIKLVTVGKLK---------EKYLIQGINEYLKRLNSYA-KMEII
RLMH_STAA1       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAM       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAN       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAA8       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAE       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAT       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAA3       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAU       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAB       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAA2       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAA9       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAR       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAS       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAAW       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGPYT-KIDII
RLMH_STAHJ       --------------MKITILAVGKLK---------EKYWKQAISEYEKRLSAYS-KIEII
RLMH_STAHO       --------------MKITILAVGKLK---------EKYWKQAIAEYEKRLGAYS-KIEMI
RLMH_STAES       --------------MKITILSVGKLK---------EKYWKQAIAEYEKRLGPYT-KIELI
RLMH_STAEQ       --------------MKITILSVGKLK---------EKYWKQAIAEYEKRLGPYT-KIELI
RLMH_STAS1       --------------MKITILTVGKLK---------EKYWKQAIAEYEKRLSAYS-KIEII
RLMH_CARHZ       --------------MEITIVAVGKIK---------ERYLKEGIAEYLKRLSPYA-RLAVI
RLMH_HUNT2       --------------MRITIIAVGKIK---------EKYLKEGINEYSKRLSRYC-KLEII
RLMH_PELTS       -------------MFHITVLAVGRLK---------EKYLTEGAAEYLKRLSAYA-KISVV
RLMH_DESRM       -------------MIKISILCVGKLK---------EKYLAEGIKEYLKRLTPYA-KVDIS
RLMH_SYMTH       --------------MRIRLVTVGKVK---------EKYLQDGVQEYLKRLRPYA-RVEIV
RLMH_DESTE       --------------MHITLLCVGKLK---------EDFLLLAQKEYLKRLSPYA-RIELV
RLMH_MOOTA       -------------MLHLTIVAVGRVR---------EKYLVAGIEEYLKRLRPYA-RVRIL
RLMH_DESHY       -------------MLQIKIVAVGKIR---------ERFLMEGIKEYAKRLSAYI-RLEMT
RLMH_NATTJ       --------------MKFRVVAVGKIK---------EKYLIRGIEEYQKRLRPYT-GLEIT
RLMH_HELMI       -------------MLHIRIVAVGKLK---------EKYLKEGLREYIKRLGAYS-RLEII
RLMH_METLZ       --------------MQIQIVCVGKIK---------DAYISSGVVEFEKRLRPYG-KIFIT
RLMH_METB6       --------------MQVRIIAVGKIK---------ERFLSEGIAEYTKRLSPYL-KLSIV
RLMH_DESPS       --------------MKHEILLLGKIK---------DSFIAEGVEEYLKRLQHYT-KVELR
RLMH_BACFR       --------------MKTTLIVVGRTV---------EQHYITAINDYIERTKHFI-SFDME
RLMH_BACFN       --------------MKTTLIVVGRTV---------EQHYITAINDYIERTKHFI-SFDME
RLMH_BACTN       --------------MKTTLLVVGRTV---------EQHYITAINDYIQRTKRFI-TFDME
RLMH_BACV8       --------------MKFTLLVVGRTV---------EKHYITAINDYVERTKHFI-SFDME
RLMH_PARD8       --------------MKIGLIVIGKTD---------AGYFVEAINEYKNRLTHYI-PFEME
RLMH_FLAJ1       --------------MNIKLIAIGKTD---------NKSLQTLIDDYTKRLSFYI-KFDLE
RLMH_FLAPJ       --------------MNIKLIAIGKTD---------NKNLQTLIDDYTKRLSFYI-KFDLE
RLMH_GRAFK       --------------MTIKLVCIGKTD---------KKELEALIKIYSDRLQHYI-KFEFE
RLMH_PORGI       --------------MKIVLLVVGKTD---------SKLMVQATEEYIRRLSHYV-SFEVE
RLMH_PORG3       --------------MKIVLLVVGKTD---------SKLMAQATEEYIRRLSHYV-SFEVE
RLMH_CYTH3       --------------MKLQLWTIGKTN---------DAYLKEGCAQYTKRLPHYL-PFEYL
RLMH_BDEBA       --------------MKFILYNLATAK---------EPWADEVSELYKKKISFFI-PFDIQ
RLMH_PELCD       --------------MKICLLCVGRLS---------IGYLREGAADFEARLQRYL-PVRIV
RLMH_GEOMG       --------------MKLKILWVGKTQ---------EEWLRRGIDEYTGRIRRYT-PLEIA
RLMH_GEOSL       --------------MKLRVLWVGKTQ---------EEWVRRGIDEYAGRVRRYA-PLEIG
RLMH_GEOUR       --------------MKMRVLWVGKTQ---------EEWVRRGIDEYAGRIRRYT-PLELA
RLMH_GEOBB       --------------MRLKLLWVGKTQ---------ESWVRTGIEEYAGRIRRYL-PLEIL
RLMH_PELPD       --------------MRLRVLWVGKSR---------EEWVKQALADYATRIRRYA-PLELV
RLMH_GEOLS       --------------MKLRIIWLGKTR---------DPWIKQGVTEYSGRIERYL-PLAID
RLMH_DESVH       -------------MRTLRILAVGRIR---------TPFWQQAATHYMERIRHNC-RLTET
RLMH_DESVV       -------------MRTLRILAVGRIR---------TPFWQQAATHYMERIRHNC-RLTET
RLMH_DESAG       -------------MRSIRIIAVGRLK---------TAHWKTAAEHYLTRLTRAF-KVEET
RLMH_LAWIP       -----------MSSKSLRLIVVGRLR---------IPFWRAAAEHYYKRISCWR-AIYET
RLMH_METHJ       -------------MVRIRIRAIGKIK---------ESFIRDAIADYAKRMCSFC-QVECI
RLMH_METTP       --------------MHMRIIAVGRIR---------ERFWQDAASYYLRRLSPYT-RLDVV
RLMH_SYNFM       --------------MQIHLVFVGKTV---------FPDVETGIERYVSRLNHYL-PTRIH
RLMH_COPPD       --------------MKVHIVAVGKLK---------NGYVAEGVKDYYERIKHYI-PITMV
RLMH_SYNWW       --------------MKYRIISVGRIR---------ESFYLEGVREYLKRLGPYT-SIELI
RLMH_CALS8       ---------------MIKVICVGTIK---------ERYFKEAAEEYKKRLSRWT-KIEEI
RLMH_SHIFL       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SHIF8       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOLI       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SHIBS       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SHIDS       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SHISS       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOL6       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOL5       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECO57       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOK1       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOUT       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECO24       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOHS       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOLC       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOSE       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SHIB3       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECODH       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECO5E       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_ECOSM       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_CITK8       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALAR       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALPA       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALTY       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALPB       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALTI       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALHS       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALSV       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALNS       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALA4       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALEP       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALPK       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALDC       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALG2       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELI
RLMH_SALCH       --------------MKLQLVAVGTKM---------PDWVQTGYTEYLRRFPKDM-PFELI
RLMH_ENT38       --------------MKLQLVAVGTKM---------PDWVQTGFTEYLRRFPKDM-PFELV
RLMH_CROS8       --------------MKLQLVAVGTKM---------PDWVQTGFSEYLRRFPKDM-PFELI
RLMH_KLEP7       --------------MKLQLVAVGTKM---------PDWVQTGFSEYLRRFPKDM-PFELV
RLMH_KLEP3       --------------MKLQLVAVGTKM---------PDWVQTGFSEYLRRFPKDM-PFELV
RLMH_PHOLL       --------------MKLQLIAVGTKM---------PDWIQAGFTDYLRRFPKDM-PFDLI
RLMH_SODGM       --------------MRLQLIAIGTKM---------PDWVQTGFSDYLKRFPKDL-PFDLT
RLMH_PROMH       --------------MKLQLIAVGTKM---------PDWIQTGFMDYLNRFPKDM-PLELI
RLMH_SERP5       --------------MKLQLVAVGTKM---------PDWVQTGFMDYLHRFPKDM-PFELT
RLMH_PECAS       --------------MKLQLVAVGTKM---------PDWVQTGFTDYLRRFPKDM-PFELL
RLMH_YERPE       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERPY       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERPA       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERPN       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERPP       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERPS       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERPG       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERPB       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERP3       --------------MKLQLVAVGTKM---------PDWVQTGFIEYLRRFPKDM-PFELA
RLMH_YERE8       --------------MKLQLVAVGTKM---------PDWVQTGFIDYLRRFPKDM-PFDLV
RLMH_ERWT9       --------------MKLQLVAVGTKM---------PDWVQTGFMEYLRRFPKDM-PFELT
RLMH_ACTP2       --------------MKIQLIAVGQKM---------PDWVKVGFEEYQRRFPKDM-PFELI
RLMH_ACTP7       --------------MKIQLIAVGQKM---------PDWVKVGFEEYQRRFPKDM-PFELI
RLMH_ACTPJ       --------------MKIQLIAVGQKM---------PDWVKVGFEEYQRRFPKDM-PFELI
RLMH_MANSM       --------------MKIQLIAVGTKM---------PDWVKVGFEEYQRRFPKDM-PFELI
RLMH_HAEIN       --------------MKITLIAVGTKM---------PSWVTTGFEEYQRRFPKDM-PFELI
RLMH_HAEIG       --------------MKITLIAVGTKM---------PSWVTTGFEEYQRRFPKDM-PFELI
RLMH_HAEI8       --------------MKITLIAVGTKM---------PSWVTTGFEEYQRRFPKDM-PFELI
RLMH_HAEIE       --------------MKITLIAVGTKM---------PSWVTTGFEEYQRRFPKDM-PFELI
RLMH_HAEDU       --------------MKIQLIAVGTKM---------PVWVKNGFEEYQRRFPKDM-PFELI
RLMH_ACTSZ       --------------MKIQLIAVGTKM---------PAWVKTGFEEYQRRFPKDM-PFELI
RLMH_HAES1       --------------MKIQLIAVGTKM---------PDWVTKGFEEYQRRFPKDM-PFELI
RLMH_HISS2       --------------MKIQLIAVGTKM---------PDWVTKGFEEYQRRFPKDM-PFELI
RLMH_PASMU       --------------MKIQLIAVGTKM---------PNWVTMGFEEYQRRFPKEM-PFELI
RLMH_AERHH       --------------MKIQLIAVGTKM---------PAWVEHGFEEYRRRFPKDM-PFELV
RLMH_AERS4       --------------MKIQLIAVGTKM---------PAWVERGFEEYRRRFPKDM-PFELV
RLMH_ALIF1       --------------MKIQLVAVGTKM---------PKWVEEGYKEYSRRFPKDM-PLELV
RLMH_ALIFM       --------------MKIQLIAVGTKM---------PKWVEEGYKEYSRRFPKDM-PLELV
RLMH_ALISL       --------------MKLQLIAVGTKM---------PKWVEEGYKEYSRRFPKDM-PLELI
RLMH_PHOPR       --------------MKLQLIAVGTKM---------PKWVEEGYKEYSRRFPKDM-PLELI
RLMH_VIBCH       --------------MKIQLIAVGTKM---------PKWVEEGFQEYRRRFPHDM-PLELV
RLMH_VIBC3       --------------MKIQLIAVGTKM---------PKWVEEGFQEYRRRFPHDM-PLELV
RLMH_VIBCB       --------------MKIQLIAVGTKM---------PKWVEEGFQEYRRRFPHDM-PLELV
RLMH_VIBPA       --------------MKIQLIAVGTKM---------PKWVEEGFQEYRRRFPHDM-PLELV
RLMH_VIBVU       --------------MKIQLIAVGTKM---------PKWVEEGFQEYRRRFPHDM-PLELI
RLMH_VIBVY       --------------MKIQLIAVGTKM---------PKWVEEGFQEYRRRFPHDM-PLELI
RLMH_SHEB5       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHEB8       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHEB9       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHESA       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHESM       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHESR       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHEON       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHEPC       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHESW       --------------MKLQLIAVGTRM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHEAM       --------------MKLQLIAVGTKM---------PDWVTRGFEEYQRRFPRDM-ALELV
RLMH_SHEDO       --------------MKLQLIAVGTKM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHEFN       --------------MKLQLIAVGTKM---------PDWVTRGFEEYQRRFPRDM-ALELI
RLMH_SHESH       --------------MKLQLIAVGTRM---------PDWVTTGFQEYQRRFPRDM-ALELV
RLMH_SHEWM       --------------MKIQLVAVGTRM---------PDWVTTGFKEYQRRFPRDM-ALELV
RLMH_SHELP       --------------MKLQLVAVGTRM---------PAWVTTGFEEYQRRFPRDM-AFELI
RLMH_SHEHH       --------------MKIQLVAVGTRM---------PDWVETGFKEYQRRFPRDM-ALELV
RLMH_SHEPA       --------------MKIQLVAVGTRM---------PDWVETGFKEYQRRFPRDM-ALELV
RLMH_PSEA6       --------------MRIQLIAVGSKM---------PSWVEQGYQQYVKRFPSDM-PLSLT
RLMH_PSEHT       --------------MKIQMIAVGTKM---------PAWVETGFTEYQRRFAKDM-TLELI
RLMH_PSYIN       --------------MKIQLIAVGTKM---------PDWVEKGYQEYARRFPKEM-QLELL
RLMH_COLP3       --------------MKLTLYAVGSKM---------PAWVSQGFAEYSRRFPRDL-SFNLV
RLMH_IDILO       --------------MQIQLLAVGTKM---------PTWVTEGFNEYKKRFPADC-KLVLH
RLMH_COXBN       --------------MKINVVAVGKRL---------PAWIKAGFQSYADRLPRDF-DLNLI
RLMH_COXB1       --------------MKINVVAVGKRL---------PAWIKAGFQSYADRLPRDF-DLNLI
RLMH_METCA       --------------MQLNLVCVGERM---------PSWVNEGYEEYARRLPREC-ALMLR
RLMH_LEGPC       -------------MLKITIITLGNKM---------PDWVNSGVNEYAKRFHDGI-QIKLI
RLMH_LEGPA       -------------MLKITIITLGNKM---------PDWVNSGVNEYAKRFHDGI-QIKLI
RLMH_LEGPL       -------------MLKITIITLGNKM---------PDWVNSGVNEYAKRFHDGI-QIKLI
RLMH_LEGPH       -------------MLKITIITLGNKM---------PDWVNSGVNEYAKRFHDGI-QIKLI
RLMH_DICNV       --------------MDITIIAVGNKM---------PDWVNEGFSDYATRFNAEI-NMQLK
RLMH_XANAC       --------------MKCRLIATGERA---------PSWVAQGFAEYQKRLSHWM-PLELV
RLMH_XANC5       --------------MKCRLIATGECA---------PSWVAQGFAEYQKRLSHWM-PLELV
RLMH_XANOR       --------------MKCRLIATGERA---------PSWVAQGFAEYQKRLSHWM-PLELV
RLMH_XANOP       --------------MKCRLIATGERA---------PSWVAQGFAEYQKRLSHWM-PLELV
RLMH_XANOM       --------------MKCRLIATGERA---------PSWVAQGFAEYQKRLSHWM-PLELV
RLMH_XANCP       --------------MKCRLIATGERA---------PAWVAQGFAEYQKRLSHWM-PLELV
RLMH_XANC8       --------------MKCRLIATGERA---------PAWVAQGFAEYQKRLSHWM-PLELV
RLMH_XANCB       --------------MKCRLIATGERA---------PAWVAQGFAEYQKRLSHWM-PLELV
RLMH_STRMK       --------------MKARLIATGERA---------PSWVAQGFAEYQKRLSHWL-PFELV
RLMH_STRM5       --------------MKARLIATGERA---------PSWVAQGFAEYQKRLSHWL-PFELV
RLMH_XYLFT       -------------MMKCLLIATGQHV---------PTWVAQGFAEYHRRLSYWL-PLELV
RLMH_XYLF2       --------------MKCLLIATGQHV---------PTWVAQGFAEYHRRLSYWL-PLELV
RLMH_XYLFM       --------------MKCLLIATGERV---------PTWVAQGFAEYHRRLSYWL-PLELV
RLMH_XYLFA       -------------MMKCLLIATGERV---------PTWVAQGFAEYHKRLSYWL-PLELV
RLMH_PSEAE       --------------MRLRLIAVGSRM---------PRWVEEGWQEYVKRLPAEL-SLELV
RLMH_PSEA7       --------------MRLRLIAVGSRM---------PRWVEEGWQEYVKRLPAEL-SLELV
RLMH_PSEAB       --------------MRLRLIAVGSRM---------PRWVEEGWQEYVKRLPAEL-SLELV
RLMH_PSEMY       --------------MRIKLIAVGSRM---------PRWVEEGWQEYVKRLPAEL-PLELV
RLMH_PSEU5       --------------MRIKLVAVGSKM---------PRWVEDGWQEYVKRLPSEL-PLELH
RLMH_PSEP1       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRLPAEL-SLELV
RLMH_PSEPK       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRLPAEL-SLELV
RLMH_PSEPG       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRLPTEL-SLELV
RLMH_PSEPW       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRLPQEL-SLELV
RLMH_PSEE4       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRLPSEL-ALELV
RLMH_PSEU2       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRMPSEL-ALELV
RLMH_PSESM       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRMPSEL-ALELV
RLMH_PSE14       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRMPSEL-ALELV
RLMH_PSEF5       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRLPSEL-ALELV
RLMH_PSEPF       --------------MRLRLIAVGSRM---------PKWVEEGWHEYAKRLPSEL-AMELV
RLMH_CHRSD       --------------MKLRVLAVGTRM---------PDWVTRGVDEYLKRLPRDF-SVEIV
RLMH_HAHCH       --------------MRIKLIAVGGKM---------PGWVEQGYNEYVKRMPRDM-PLQLI
RLMH_MARHV       --------------MRLRLICVGQKM---------PDWVSAGYNDYARRMPPEL-PLELT
RLMH_SACD2       --------------MKISLIAVGTRM---------PAWVQDGYQEYAKRLPKEL-TPELV
RLMH_CELJU       --------------MRIRIIAVGTKM---------PEWVEQGYAEYAKRMPRDL-AVEMV
RLMH_MARMS       --------------MRVRLIAVGNKM---------PKWVTEGYDEYAKRLPKDF-ALELV
RLMH_ALCBS       --------------MHLVLLAIGTRM---------PAWVTEGFNEYQKRMPPDM-RLTLE
RLMH_ALKEH       --------------MRIRLISVGGRM---------PGWAAEGYREYAQRLGGGI-SLELV
RLMH_ACIAC       --------------MKLLIVAVGQRV---------PDWAQTAYEDYAKRFPPEL-KVELK
RLMH_ACISJ       --------------MKLLIVAVGQRV---------PDWAQTAYDDYAKRFPPEL-KVELK
RLMH_DELAS       --------------MKLLIVAVGQHV---------PDWAQTAYDDYAKRFPPEL-KVELK
RLMH_RHOFT       --------------MRLVIVAVGQRV---------PDWAQTAWDDYAKRFPFEL-KVELK
RLMH_POLNA       --------------MRLTIVAVGQKV---------PDWAQTAYDDYAKRFPPEL-KVELK
RLMH_POLSJ       --------------MRLTIVAVGQKV---------PDWAQTAYDDYAKRFPPEL-KVELK
RLMH_VEREI       --------------MKLLIVAVGQRV---------PDWAQTACNDYAKRLPPEL-KLELK
RLMH_METPP       --------------MKLALVAVGQRL---------PAWAETACEDYLKRFPADW-RVELK
RLMH_LEPCP       --------------MKLLLIAVGQRL---------PAWADTAYEDYAKRFPPDL-RLELK
RLMH_AZOSB       --------------MKLLVVAVGHRM---------PAWVDAGFDEFARRMPREL-PLQLI
RLMH_AROAE       --------------MKLLIVAVGTRM---------PAWVEAGFGEFARRMPREL-PLQLV
RLMH_BORBR       --------------MKLIVAAVGTRM---------PGWVETAWDDYAKRLPADC-ALELR
RLMH_BORPE       --------------MKLIVAAVGTRM---------PGWVETAWDDYAKRLPADC-ALELR
RLMH_BORPA       --------------MKLIVAAVGTRM---------PGWVETAWDDYAKRLPADC-ALELR
RLMH_BORA1       --------------MKLIVAAVGTRM---------PDWVETAWDDYAKRLPADC-ALELR
RLMH_BORPD       --------------MKLIVIAVGNRM---------PAWVETAWDDYAKRLPPDC-ALELR
RLMH_BURCA       --------------MKLFILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURCH       --------------MKLFILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURCC       --------------MKLFILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURCJ       --------------MKLFILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURL3       --------------MKLFILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURCM       --------------MKLFILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURA4       --------------MKLFILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURVG       --------------MKLYILAVGHKM---------PGWIASGFDEYTKRMPPEL-RIELR
RLMH_BURM1       --------------MKLFILAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURMA       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURM9       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURM7       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURMS       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURPS       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURP0       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURP1       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURP6       --------------MKLHIVAVGHKM---------PGWIASGFDEYAKRMPPEL-RIELR
RLMH_BURTA       --------------MKLHIVAVGHKM---------PGWIATGFDEYAKRMPPEL-RIELR
RLMH_PARXL       --------------MKLHILAVGHKM---------PDWIATGFDEYAKRMPPEL-RIELR
RLMH_PARP8       --------------MKLHILAVGHKM---------PDWIATGFDEYAKRMPPEL-RIELR
RLMH_PARPJ       --------------MKLHILAVGHKM---------PDWIATGFDEYTKRMPPEL-RIELR
RLMH_CUPNH       --------------MQLVIVAVGHKM---------PGWIETGFSEYAKRMPPEL-RIELR
RLMH_CUPTR       --------------MQLVIVAVGHKM---------PGWIETGFSEYAKRMPPEL-RIELR
RLMH_CUPPJ       --------------MQLVIVAVGHKM---------PGWIETGFNEYAKRMPPEL-RIELR
RLMH_CUPMC       --------------MQLAIVAVGHKM---------PAWIETGFNEYTKRMPPEL-RIELR
RLMH_RALSO       --------------MQLLIVAVGHKM---------PRWIEDGFAEYAKRMPPEL-RIELR
RLMH_RALPJ       --------------MQLLIVAVGHKM---------PSWIEEGFSEYAKRMPPEL-RIELR
RLMH_HERAR       --------------MQLVIAAVGHKM---------PAWIENGFGEYAKRMPPDC-RIHLK
RLMH_JANMA       --------------MQLVIAAVGHKM---------PAWIESGFGEYAKRMPADC-RVHLK
RLMH_POLAQ       --------------MRLTIVSVGHKM---------PDWVATATHDYIKRMPADC-SIEIK
RLMH_POLNS       --------------MRLTIVSVGHKM---------PDWVATAT-------------IEIK
RLMH_NEIG1       --------------MNITVLAVGTKM---------PRWVDEAVAEYAKRFGRDA-AYAFK
RLMH_NEIG2       --------------MNITVLAVGTKM---------PRWVDEAVAEYAKRFGRDA-AYALK
RLMH_NEIMA       --------------MNITVLAVGTKM---------PRWVDEAVAEYAKRFGRDV-AYALK
RLMH_NEIMB       --------------MNITVLAVGTKM---------PRWVDEAVAEYAKRFGRDV-AYALK
RLMH_NEIMF       --------------MNITVLAVGTKM---------PRWVDEAVAEYAKRFGRDV-AYVLK
RLMH_NEIM0       --------------MNITVLAVGTKM---------PRWVDEAVAEYAKRFGRDV-AYALK
RLMH_CHRVO       --------------MKITILAVGTKM---------PRWVDEAYTDYAKRFGRDI-TLELK
RLMH_NITEU       --------------MKFHILAVGNKM---------PDWVRKGYTEYCQRMPKEA-ELLLV
RLMH_NITEC       --------------MKLHILAVGNKM---------PDWIKKGYTEYSQRMPKEA-EMQLV
RLMH_NITMU       --------------MKFLVYAVGHKM---------PEWIAAGFQEYAKRMPREA-NIELL
RLMH_DECAR       --------------MKLAVLAVGHRQ---------PDWVNEGCAEYLKRMPREL-AASVT
RLMH_METFK       --------------MKLRIISVGHKM---------PDWVQSACTEYTKRMPREM-NVEIV
RLMH_THIDA       --------------MKLQLIAVGHKM---------PDWINAGYADYVRRMPGDL-QLALT
RLMH_HALHL       --------------MRIHLVAVGHKP---------PRWVRDGHETYAQRLGKGW-RLELH
RLMH_NITOC       --------------MNIYVIAVGQRL---------PRWIGEGYQEYAQRLPRQC-SLSLV
RLMH_HYDCU       --------------MNIHFIVVGQKM---------PGWVQTGYAEYAKRLPKAC-TLKLV
RLMH_ACIF5       --------------MRLWVLAIGSKM---------PAWVEAGVAEYSARMPPQL-RVEWR
RLMH_ACIBC       --------------MKIRILTIGQKM---------PAWVLTGFEDYFKRIQPFV-QTQVI
RLMH_ACIBY       --------------MKIRILTIGQKM---------PAWVLTGFEDYFKRIQPFV-QTQVI
RLMH_ACIBT       --------------MKIRILTIGQKM---------PAWVLTGFEDYFKRIQPFV-QTQVI
RLMH_ACIBS       --------------MKIRILTIGQKM---------PAWVLTGFEDYFKRIQPFV-QTQVI
RLMH_ACIAD       --------------MKIRILTIGQKM---------PAWVLTGFEDYFKRIQPFV-QTQVI
RLMH_PSYA2       --------------MKVRILTVGNKM---------PKWVQTGFDEYHKRIQPML-NTEIV
RLMH_PSYCK       --------------MKVRILTVGNKM---------PKWVQTGFDEYHKRIQPML-TTEVV
RLMH_PSYWF       --------------MKLRILSVGSKM---------PKWIDTGFNEYHKRIQPML-TTEMV
RLMH_FRAP2       --------------MKIRILSLGEKP---------PKWVSEGYDEYKKRLSKSI-PLELI
RLMH_FRATN       --------------MKIKIITLGEKP---------PKWVSDGYDEYKKRLSKSI-PLELI
RLMH_FRATH       -----------MMAFLLDIITFLQISFSTNIFRINYKWVSDGYDEYKKRLSKLI-PLELI
RLMH_FRATF       -----------MMAFLLDIITFLQISFSTNIFRINYKWVSDGYDEYKKRLSKLI-PLELI
RLMH_FRATO       -----------MMAFLLDIITFLQISFSTNIFRINYKWVSDGYDEYKKRLSKLI-PLELI
RLMH_GRABC       ------------MTAPWRIIAVGRMR---------GSEEEALFQRYAARLRP---ALTVT
RLMH_GLUDA       ----------------MRLIAVGRMK---------DRVERDLFQRYAERLSP---RLDLV
RLMH_ACICJ       ---------MTAPGARLRIIAIGRDS---------KGPEADLVARYAARLQP---RPEVV
RLMH_GLUOX       ----------------MKLVAIGRLK---------AGPERELFERYAGRIRP---ALTVT
RLMH_MAGMM       -------------MSRFRILSVGRGM---------PKHEKGLFDDYAGRMKRYG-GLELV
RLMH_SOLUE       --------------MKIYLYFIGKPK---------DPHANAIAEDFLARAGRYS-PCEMR
RLMH_RHIL3       --------------MRIGLFAVGRLK---------SGPEKDLAARYFDRFAKAG-PAVGL
RLMH_RHILW       --------------MRIGLFAVGRLK---------SGPEKDLAARYFDRFAKAG-PAVGL
RLMH_RHIEC       --------------MRIGLFAVGRLK---------SGPEKDLVARYLDRFAKAG-SAVGL
RLMH_RHIE6       --------------MRVGLFAVGRLK---------SGPEKDLAARYFDRFAKAG-PAVGL
RLMH_RHIME       --------------MRIGLFAVGRLK---------AGPEKDLAGRYLDRFAKAG-PAVGL
RLMH_SINMW       --------------MRIGLFAVGRLK---------AGPEKDLAVRYLDRFAKTG-PAVGL
RLMH_AGRFC       --------------MRISIFAVGRLK---------SGPEKDLAARYIERLAKTG-PAIGL
RLMH_BRUAB       --------------MRVSVFAVGRMK---------SGPERELVERYFDRFAKAG-PPLGL
RLMH_BRUA1       --------------MRVSVFAVGRMK---------SGPERELVERYFDRFAKAG-PPLGL
RLMH_BRUA2       --------------MRVSVFAVGRMK---------SGPERELVERYFDRFAKAG-PPLGL
RLMH_BRUO2       --------------MRVSVFAVGRMK---------SGPKRELVERYFDRFAKAG-PPLGL
RLMH_BRUME       --------------MRVSVFAVGRMK---------SGPERELVERYFDRFAKAG-PPLGL
RLMH_BRUSU       --------------MRVSVFAVGRMK---------SGPERELVERYFDRFAKAG-PPLGL
RLMH_OCHA4       --------------MRVSVFAVGRMK---------AGPERELVERYFDRFSKAG-PPLGL
RLMH_CHESB       MFRRYADTLTSEGFIRIVIHAVGRMK---------AGPERELADRYLDRAAKAG-PAIGM
RLMH_RHILO       --------------MKISVHAVGRMK---------AGPERELADRYFERFAKSG-PAVGL
RLMH_BARHE       --------------MHVSIFAVGRMK---------KGAEQALVHHYLDRFSKSC-SAVGF
RLMH_BART1       --------------MQISIFAVGRMK---------SGAEQKLVQHYLDRFSKSS-GAVGF
RLMH_BARBK       --------------MQISIFAVGRMK---------VGAEQELVHRYLDRFSKSA-GAVGL
RLMH_AZOC5       --------------MRVLLICVGRLK---------AGAERELVTRYLDRAKAGG-RALGL
RLMH_XANP2       --------------MRLVLACVGRLK---------AGAERDLVTRYVDRIRPAG-RPLGL
RLMH_METPB       --------------MRLLVVAIGRLK---------NGPERDLAARYRERAVALG-KSLGV
RLMH_METEP       --------------MRLLVVAIGRLK---------NGPERDLAARYRERAVALG-KGLGV
RLMH_METRJ       --------------MRLILAAVGRLK---------AGPERELASRYRDRAAQLG-RGLGF
RLMH_METS4       --------------MRLALVAVGRLK---------RGPERDLAEGYRARADALA-RGLGL
RLMH_BRASB       --------------MRIVVIAVGRLK---------QGPERELAERYRERFDDLG-RKLGF
RLMH_BRASO       ------------MHMRLVVIAIGRLK---------QGPERQLAERYRERFDDIG-RKLGF
RLMH_BRADU       --------------MRVAVIAVGRLK---------QGPERELADRYFERFDEAG-RKLGF
RLMH_RHOPA       --------------MRLLILAVGKLK---------QGPERELAERYRARFDDLG-RKLGF
RLMH_RHOPT       --------------MRLLILAVGKLK---------QGPERELAERYRARFDDLG-RKLGF
RLMH_RHOPS       --------------MRLTVIAIGKLK---------QGPERELAERYRGRFDDLG-RKLGF
RLMH_RHOP2       --------------MRLTVIAVGKLK---------QGPERELAERYRARFDDIG-RKLGF
RLMH_RHOP5       --------------MRLSVIAIGRLK---------QGPERELAERYRERFDETG-RKLGF
RLMH_RHOPB       --------------MRVVVIAIGRLK---------QGPERELAERYRERFDDLG-RKLGF
RLMH_NITHX       --------------MRLVVIAIGRLK---------QGPERELADRYRGRFDDIG-RKLGF
RLMH_NITWN       --------------MRLVVIAVGRLK---------QGPERELADRYRGRFADIG-RNLGF
RLMH_OLICO       --------------MRIIVIAVGRLK---------QGPERELAERYRERFESLG-RKLGF
RLMH_BEII9       --------------MRLQLIGIGRTK---------AGAERELTARYLERAGQAG-RAIGF
RLMH_CAUVC       -------------MMKITILTVGKLG---------RMVEAQLALDYASRATASG-RALAL
RLMH_CAUSK       --------------MKITLLTVGKLG---------RMVEAQLAVDYASRATASG-RALAV
RLMH_PHEZH       --------------MRISIVAIGRLA---------RSPETELVKLYVERATNAG-RALGL
RLMH_HYPNA       --------------MRLQILAVGRLK---------DGPERDLTDDYIRRASAMA-RGLGF
RLMH_RUEPO       --------------MRVSILAVGRLR---------TGPEKSLIDDYLTRFDRTG-RALGL
RLMH_RUEST       --------------MRVHICAVGRLR---------AGPEKTLIDDYLQRFDRSG-RALGL
RLMH_ROSDO       --------------MRIHIIAVGRLR---------AGPEKDLIGDYLTRFARSG-RALGL
RLMH_DINSH       --------------MKVTLCVVGRLR---------AGPERDLINDYLQRFDRTG-RGLGL
RLMH_RHOS4       --------------MKLQLCAVGRLR---------SGPERDLVEDYLARFERTG-RPLGL
RLMH_RHOS1       --------------MKLQLCAVGRLR---------SGPERDLVEDYLARFERTG-RPLGL
RLMH_RHOS5       --------------MKLQLCAVGRLR---------SGPERDLVEDYLGRFERTG-RPLGL
RLMH_PARDP       --------------MRMVIAAVGRLR---------QGPEAKLIADYLDRHAKAG-RALGL
RLMH_MARMM       --------------MRLRVAALGRIK---------SGPERTLVDDYLDRGTATG-RAIGL
RLMH_MAGSA       --------------MRLLIAAVGKAK---------AGPEQDLFRQYCRRLS---------
RLMH_RHOCS       --------------MRLWLAAVGRAR---------PGPARDLFEEYRGRLG---------
RLMH_PARL1       --------------MRVQICAVGRLK---------AAPEKHLLDDYISRLDATG-RGIGI
RLMH_RHORT       --------------MKLLVAAVGRWR---------GGPERALFDHYVGRLK---------
RLMH_NOVAD       --------------MLLHVIARGKIG---------RSPEAELVDRYARRIS---------
RLMH_SPHWW       --------------MLLHIVARGRIG---------RGPEADLVDRYIKRIG---------
RLMH_SPHAL       --------------MLLHIIARGRIG---------RGPEAELVERYMKRVT---------
RLMH_ERYLH       --------------MLLHIIARGKIA---------RSPEEELVTRYEKRLT---------
RLMH_ZYMMO       --------------MKIHIIARGRIG---------RSPEGELVERYMKRLS---------
RLMH_KORVE       --------------MKLRVVWIGKTK---------ESAIQTLTGEYLKRLSRYV-ATEGL
RLMH_DEIGD       --------------MRLHLITVGEPK---------LAYARAGWDEYEKRLRRYH-KVQVT
RLMH_DEIRA       --------------MRLHLITVGEPK---------LAYARSGWDEYEKRLRRYH-KVQVS
RLMH_THET2       --------------MRLRVVAVGRPR---------LAYARLGVEEYARRMRRYA-PLDLV
RLMH_THET8       --------------MRLRVVAVGRPR---------LAYARLGVEEYARRMRRYA-PLDLV
RLMH_AKKM8       --------------MQFLILAAGKPS---------LGYAKEGVELYLNRLRPFG-KTELK
RLMH_RUBXD       ------------MIRRATIVAVGRLR---------GW-AAEGCEDYLRRLRRYF-PVEVI
RLMH_SORC5       --------------MRLVVAAVGRVK---------DKPLRAAMDEYLGRIRRYV-ACDEI
RLMH_ANADE       --------------MKIRVVAVGRDR---------SGLYAPAVDEYAKRLGRYL-RFELV
RLMH_ANASK       --------------MKVRVVAVGRDR---------SGLYAPAVEEYAKRLGRYL-RFELV
RLMH_ANADF       --------------MRLRVVAVGRDR---------SGLYAPAIEEYAKRLGRYV-KFELV
RLMH_MYXXD       --------------MKVRLLSIGKDR---------SGLYEPAVQEYAKRLGHYT-RFELV
RLMH_GLOVI       --------------MRIKLVAVGRLR---------EEAYERACAEYARRLAAYA-RLELV
RLMH_PROMA       ----------MLNPSRFRILAIGKVR---------KSWIQNGLEVYRKRLPGLS-ITEIR
RLMH_PROM4       ----------MLNPSRYRILAIGKTR---------KAWIQNGLNLYIKRLPGLT-ITELK
RLMH_PROMM       -----------MRNCAFRIIAVGKVR---------KGWIQDGLAMYQKRLPGLI-ITEVR
RLMH_PROM3       ------MLQLFLRNCAFRIIAVGKVR---------KGWIQDGLAMYQKRLPGLM-ITEVR
RLMH_SYNS3       -----------MNPSRCRIIAIGKVR---------KSWVQDGIELYRKRLPGLT-IVELR
RLMH_SYNPW       -----------MNVSRCRIIAVGKVR---------KGWVQEGVELYLKRLPGLT-VVELK
RLMH_SYNSC       -----------MNPARCRILAVGKVR---------RGWIQDGIDLYLKRLPGLT-ISELR
RLMH_SYNS9       -----------MNPSRCRILAVGKVR---------RDWIQKGIELYLKRLPGLT-VTELR
RLMH_SYNPX       -----------MNPSRCRILAVGKVR---------RSWIQDGIELYRKRLPGLE-IIEIR
RLMH_PROM1       ----------MLNISHYKIIAIGKIR---------KKWIQEGIEMYLKRLPGLE-VKEIK
RLMH_PROMT       ----------MLNISHYKIIAIGKIK---------KKWIQEGIEMYLKRLPGLE-VKEIK
RLMH_SYNR3       --------MALLQPARIRILAIGKLK---------RAWVAEGVAFYRKRLPGLE-VVELK
RLMH_PROMS       ----------MLQSNRLTIYAIGKIK---------KHWIRDGINQYKKRMPELI-INESK
RLMH_PROM0       ----------MLQSNRLAIYAIGKIK---------KLWIRDGINQYKKRMPELI-INELK
RLMH_PROM9       ----------MLQSNRLAIYAIGKIK---------KLWIRDGINQYKKRMPELI-INELK
RLMH_PROM2       ----------MLQSNRFAIYAIGKIK---------KHWIRDGINQYKKRMPELI-INELK
RLMH_PROMP       ----------MLQTNRLSINAIGKIK---------KNWIREGINQYKKRMPDLI-INESK
RLMH_PROM5       ----------MLKANRLSIYAIGKIK---------KKWIREGINQYKKRMPDLI-INESK
RLMH_CAMC1       --------------MEISVFSIQKSSRD---------NFENEIQEYIKMSAKF-AKINDK
RLMH_CAMC5       --------------MDISVFSIQKSRAD---------SFENEIKEYIKMSAKF-ANISDK
RLMH_CAMFF       --------------MQILVHCIQKKD-D---------DFD-NIKEYIKMSSKW-ADIKDI
RLMH_CAMHC       -------------MSEIFVNSIQKNK-N---------DFAMQIAEYIKMSQKF-AALKDN
RLMH_CAMJE       ----------MENNLQVNIFCIQKSD-----------EFKTCSEKYSKLISKY-ATLKEI
RLMH_CAMJR       ----------MENNLQVNIFCIQKSD-----------EFKTWSEKYSKLISKY-ATLKEI
RLMH_CAMJJ       --------------MQVNIFCIQKSD-----------EFKTWSEKYSKLISKY-ATLKEI
RLMH_CAMJ8       --------------MQVNIFCIQKSD-----------EFKTWSEKYSKLISKY-ATLKEI
RLMH_CAMJD       --------------MQVNIFYIQKSD-----------EFKTWSEKYSKLISKY-GTLKEI
RLMH_HELPS       --------------MRCVVYSIAKSSP------------LELVKIYQKQCKQFDCELELV
RLMH_HELPG       -------------MMRCVVYSIAKSSP------------LELVKIYQKQCKQFDCELELV
RLMH_HELPY       --------------MRCVVYSIAKSSP------------LELVKIYQKQCRQFDCELELV
RLMH_HELPH       --------------MRCVVYSIAKSSP------------LELVKIYQKQCRQFDCELELV
RLMH_HELP2       --------------MRCVVYSIAKSSP------------LELVKIYQKQCKRFDCELELV
RLMH_HELPJ       --------------MRCVVYSIAKNSP------------LELVKSYQKQCKRFDCELELV
RLMH_HELAH       --------------MRCVVYSIAKSSP------------LELVKIYQKQCKQFGCELELV
RLMH_HELHP       --------------MQINIYSIAKKDAK----------YQALLEELCMQCKQFGVEIKIL
RLMH_SULDN       --------------MNIEILSIAKKERS---------IYDPLCKELSKMISRF-AKIEDI
RLMH_ARCB4       --------------MKINIYAILKPTAD---------NFDQIIKEFIKMSSKY-AKVEVH
RLMH_SULNB       --------------MKINVIIIDKKGKDQ--------LYAPLIEHYKKISKPF-AKVEVI
RLMH_NITSB       -------------MHRIAIYSIGKKDEK---------CYEAIYEDLIKNSKKF-ALIETK
RLMH_WOLSU       --------------MKIRVYCISKPEKD---------AYAELGEHFKKLARSFNVELEIL
RLMH_FERNB       --------------MKIELIVPGKL-SK---------HLQPAFDYYVEKLNRFA-KISVH
RLMH_THEM4       --------------MKIEVIVPGKI-SK---------HLKSAFDFYLDKLKRFC-DLKIS
RLMH_PSELT       --------------MKIEIVVIGKL-KE---------YIRPAVKEYIKMLSSFA-EIKLT
RLMH_DICT6       --------------MNIKIIVIGKIRNE---------FIKAGVNEYLKRLLPFI-NIKIE
RLMH_PETMO       ---------------MTRIIVVGPLKSP---------YIIDGVKQYLKWIKKFE-RIELI
RLMH_THEP1       --------------MKVRIAVVGKLDG----------FIKEGIKHYEKFLRRFC-KLEVL
RLMH_THESQ       --------------MKVRIAVVGKLDG----------FIKEGIKHYEKFLRRFC-KLEVL
RLMH_THEMA       --------------MRVRIAVIGKLDG----------FIKEGIKHYEKFLRRFC-KPEVL
RLMH_THEYD       -------------MYRFKIYYPGKTKAK---------FIKEGIDHYIKLLSPFA-KVELI
RLMH_FUSNN       --------------MNINIICIGKIKDK---------YINDGIAEFSKRMTSFV-SLNII
RLMH_MYCPE       --------------MKIKIICFGKIKDK---------NITALINEYLSKINHFT-NLTIV
RLMH_MYCCT       --------------MKIKIICFGKLDKA---------FYVDAFNDYFKRLKKYV-DLEII
RLMH_MYCMS       --------------MKIKILCFGKLDKK---------FYIDAFNDYFKRLKKYV-DLEII
RLMH_MESFL       --------------MNIKIVCFGKLDKK---------FFIDSFNEYANRISKYA-NLQVI
RLMH_MYCH2       --------------MKISIISFGSSPRE----------WLGLYKKEINKIKQFKYQIEFI
RLMH_MYCHJ       --------------MKISIISFGSSPRE----------WLGLYKKEINKIKQFKYQIEFI
RLMH_MYCH7       --------------MKISIISFGSSPRE----------WLGLYKKEINKIKQFKYQIEFI
RLMH_MYCMO       --------------MKINLIAVGKLEKE----------YLNLYLSYLKKISFFA-TINLI
RLMH_MYCA5       --------------MKLNIIAVGALTKE----------YKTLYEIYNKKVSFFS-TINLI
RLMH_MYCS5       --------------MTINLIAVGKLEKD----------FQKLFDEYAKRIFVFS-KFNLI
RLMH_MYCPU       --------------MKINIISVGTLSKE----------FQVIFDDYIKKINFYS-NVNLI
RLMH_MYCAP       -------------MTKIKIVAVGSLSPK----------FKSLDEEYAKQVGHFC-SLSLS
RLMH2_THEP3      --------------MNYKVYATGNKIEK---------FYSDAIKEYQKRLNRFC-NISFT
RLMH1_THEPX      --------------MNYKVYATGNKIEK---------FYSDAIKEYQKRLNRFC-NISFT
RLMH1_CALS4      --------------MNYKFFIIAKKIEP---------FYQEAIEEYFKRLQRFC-SISLS
RLMH_PARUW       -------------MLKLRILSVGKTKEK---------WLEDAFNEYQKRLKANL-QIECL
                                   .                                         

RLMH_UREPA       VVSDEPEPVQISNKSLEQIKSKEASKIFKNINQ--------------NDFVIALI-IESN
RLMH_UREP2       VVSDEPEPVQISNKSLEQIKSKEASKIFKNINQ--------------NDFVIALI-IESN
RLMH_UREU1       VVNDEPEPTQISTKLLEQIKDKEANRILKNINQ--------------NDFVIALI-IEGK
RLMH_ACHLI       EITDEASITGME---------KEGQKILSKIAK--------------DSYVISLA-IEGK
RLMH_LACLM       ELADEKIPDNASEKEAEALKKREGDKILSRIQT--------------GDKLAILA-IQGK
RLMH_LACLS       ELADEKIPDNASEKEAEALKKREGDKILSRIQT--------------GDKLAILA-IQGK
RLMH_LACLA       ELADEKIPDNASEKEAEALKKREGEKILSRIQA--------------GDQLAILA-IQGK
RLMH_LEUMM       ELIDEKTPENASEAQNNQIMAREGERIQAKIGS--------------RDYVIVLA-IEGK
RLMH_LEUCK       EVPDEKTPEHASQAQNQQIMAKEGERIADKIGS--------------RDYVIVLA-IEGK
RLMH_STRGC       ELADEKTPDKASPLENQQILSKEGERILSKVLD--------------REFVIVLA-IEGQ
RLMH_STRSV       ELANEKTPDKASDLENQQILEKEGNKILAKINE--------------REFVIALA-IEGN
RLMH_STRSY       ELPDEKTPDKASQAENEQILKKEADRIMSKIGE--------------RDFVIALA-IEGK
RLMH_STRPC       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRPZ       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRPM       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRPF       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRP6       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRP1       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRPB       ELTDERTPDKASFADNQLIMSKEAQRIHKKIEE--------------RDFVIALA-IEGK
RLMH_STRP8       ELTDERTPDKANFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRPG       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STRP3       ELTDERTPDKASFADNQLIMSKEAQRIHKKIGE--------------RDFVIALA-IEGK
RLMH_STREM       ELADEKTPDKASDAEKQQIMAKEADRIKKKLGQ--------------RDFVIALA-IEGK
RLMH_STRA1       ELADEKTPDKASISENQRILDIEGERILSKIGE--------------RDYVIGLA-IEGK
RLMH_STRA3       ELADEKTPDKASISENQRILDIEGERILSKIGE--------------RDYVIGLA-IEGK
RLMH_STRA5       ELADEKTPDKASISENQRILDIEGERILSKIGE--------------RDYVIGLA-IEGK
RLMH_STRT2       ELTDEKTPDNASEAENKAILDKEGQRILAKVGD--------------RDYVIALA-IEGK
RLMH_STRT1       ELTDEKTPDNASEAENKAILDKEGQRILAKVGD--------------RDYVIALA-IEGK
RLMH_STRTD       ELTDEKTPDNASESENKAILDKEGQRILAKVGD--------------RDYVIALA-IEGK
RLMH_STRMU       ELPDEKIPNNASQAQNTYILEKEGQRILNKISN--------------REFVIVLA-IEGK
RLMH_STRP4       ELSDEKTPDKASESENQKILEIEGQRILSKIAD--------------RDFVIVLA-IEGK
RLMH_STRPS       ELSDEKTPDKASESENQKILEIEGQRILSKIAD--------------RDFVIVLA-IEGK
RLMH_STRPN       ELSDEKTPDKASESENQKILEIEGQRILSKIAD--------------RDFVIVLA-IEGK
RLMH_STRR6       ELSDEKTPDKASESENQKILEIEGQRILSKIAD--------------RDFVIVLA-IEGK
RLMH_STRP2       ELSDEKTPDKASESENQKILEIEGQRILSKIAD--------------RDFVIVLA-IEGK
RLMH_OENOB       EVKDEATPEKASKSENLEILQTEGGRLLDKINN--------------RDFVIALA-IEGK
RLMH2_THEPX      EVEEEKAPQNLSEKEKEEILRKEGERILSKIKK--------------GSFVVSLA-IEGK
RLMH1_THEP3      EVEEEKAPQNLSEKEKEEILRKEGERILSKIKK--------------GSFVVSLA-IEGK
RLMH2_CALS4      EIKEEEDPGTPASREK--VLETEGERILYKIDR--------------ESFVIALA-IEGK
RLMH_ALKMQ       EVADEKAPENLSEAEEIMIKDKEGEAILKSIKD--------------GMFVIALD-LAGK
RLMH_ALKOO       EIPDEKAPENLSSAEEQIVKNKEGEGILKNIKD--------------GMYVIALD-LKGK
RLMH_LACP7       ELADEKTPDNASPAEELQIKKKEGERILKNIKD--------------NAYVIALA-IEGK
RLMH_CLOPE       ELPDEKTPDNASEKEELQIKEKEGKLILSKIKD--------------NMHVIAMD-LKGN
RLMH_CLOP1       ELPDEKTPDNASEKEELQIKEKEGKLILSKIKD--------------NMHVIAMD-LKGN
RLMH1_CLOPS      ELPDEKTPDNASEKEELQIKEKEGKLILSKIKD--------------NMHVIAMD-LKGN
RLMH_CLOTE       EVTDEKTPDNASEKEELQIKEKEGDLILKNIKD--------------NMFVIALD-LNGN
RLMH_CLOBA       ELQDEQTPDNASEKDELIIKDKEGNKILNSIKD--------------NMYVITLD-LKGK
RLMH_CLOBB       ELQDEQTPDNASEKDELIIKDKEGNKILNSIKD--------------NMYVITLD-LKGK
RLMH_CLOB8       ELVDEKTPDNASEKEEEVIKEKEGQGILNKIKD--------------NMFVIAMD-LGGK
RLMH_CLOK5       EVQDEKTPDNASSSEQDIIKEKEGRRILKYIND--------------NMYVVALD-LKGS
RLMH_CLOAB       ELQDEKTPEKASLKEEKLIKEKEGEKILSSIKD--------------NSYVVSMD-LKGK
RLMH_CLOB1       EVADEKTPDNASLKEENIIKEKEGNLILKHIKD--------------NSFVIALD-LKGK
RLMH_CLOBH       EVADEKTPDNASLKEENIIKEKEGNLILKHIKD--------------NSFVIALD-LKGK
RLMH_CLOBL       EVTDEKTPDNASLKEENIIKDKEGNLILKHIKD--------------NSFVIALD-LKGK
RLMH_CLOBK       EVTDEKTPDNASLKEENIIKEKEGNLILKHIKD--------------NSFVIALD-LKGK
RLMH_CLOBM       EVTDEKTPDNASLKEENIIREKEGSLILKHIKD--------------NNFVIAID-LKGK
RLMH_CLONN       ELNDEKTPDNASEKDELIIKQKEGSKILAHVKE--------------NMYVIALD-LNGK
RLMH_BIFLO       EVADEKTPDHASEGVDRQIKAREGERIAKHLKD--------------GAFVIALA-INGK
RLMH_BIFLD       EVADEKTPDHASEGVDRQIKAREGERIAKHLKD--------------GAFVIALA-INGK
RLMH_BIFAA       EVADEKTPEHASDGLERQIKAKEGERIAKHIRD--------------DAFVIALA-IEGK
RLMH_CLOD6       ELDDEKAPENLSVKEMEIIKDKEGKKILGKIKH--------------NSYVIALA-IDGK
RLMH_FINM2       EVDDLSAAENLSDSEKEIVKDKEAEKIISKIKD--------------SHYVITLE-IVGN
RLMH_METM5       EVADEKTPESPSDVEKSKILEKEAERILKHLKK--------------DSFVITLE-ILGK
RLMH_METM7       EVADEKTPENPSEVEKSKILEKEAERILKYLKK--------------DSFLITLE-ILGK
RLMH_METM6       EVADEKTPENPSDVEKSKLLEKEAERILKYLKK--------------DSFVITLE-ILGK
RLMH_METMP       EVADEKTPENPSDVEKSKILEKEAERILKYLKK--------------DSFLITLE-ILGK
RLMH_METVS       EISDEKTPENPSDVEKSKILDKEAEGIFKNLKG--------------DFYVVTLE-ILGK
RLMH_BACVZ       ELPDEKAPENLSDQDMKIVKDKEGERILAKISP--------------DTHVIALA-IEGK
RLMH_BACSU       ELPDEKAPENLSDQDMKIIKDKEGDRILSKISP--------------DAHVIALA-IEGK
RLMH_BACLD       ELPDEKAPENLSDQDMKIVKDKEGERILSKISP--------------DAHVIALA-IEGK
RLMH_BACP2       ELADEKAPEHLSEQDMKIIKDKEGERILSKINP--------------DAHVIALA-IEGK
RLMH_BACHD       EVPDEKAPEQLSDTEMEHVKQKEGERILAKLHP--------------DTYVIALA-IEGS
RLMH_BACCZ       ELPDEKAPENLSEAEMLIVKEKEGIRILDKISD--------------DTHVIALA-IEGK
RLMH_BACAH       ELPDEKAPENLSEAEMLIVKEKEGIRILDKISD--------------DTHVIALA-IEGK
RLMH_BACAN       ELPDEKAPENLSEAEMLIVKEKEGIRILDKISD--------------DTHVIALA-IEGK
RLMH_BACHK       ELPDEKAPENLSEAEMLIVKEKEGIRILDKISD--------------DTHVIALA-IEGK
RLMH_BACCR       ELPDEKAPENLSEAEMLIVKEKEGIRILDKISD--------------DTHVIALA-IEGK
RLMH_BACC1       ELPDEKAPENLSEAEMLIVKEKEGIRILDKISD--------------DTHVIALA-IEGK
RLMH_BACMK       ELPDEKAPENLSAAEMLIVKEKEGIRILDKISD--------------DTHVIALA-IEGK
RLMH_BACCN       ELPDEKAPENLSEAEMLIVKEKEGVRILDKISD--------------DTHVIALA-IEGK
RLMH_LISMO       EVPDEKAPEVLSDAEMKQVKDKEGARILAKIPD--------------DAYVIALA-IDGK
RLMH_LISMF       EVPDEKAPEVLSDAEMKQVKDKEGARILAKIPD--------------DAHVIALA-IDGK
RLMH_LISIN       EVPDEKAPEVLSDAEMKQVKDKEGVRILAKIPD--------------DAHVIALA-IDGK
RLMH_LISW6       EVPDEKAPEVLSDAEMKQVKDKEGVRILAKIPD--------------DTHVIALA-IDGK
RLMH_BACSK       EVPDEKAPEHLSTEDMRLVKKKEGERLLAKISA--------------DSYVIALA-IEGN
RLMH_LYSSC       EVADEKAPEQLSDAEMEIVKKKEGERILAKIST--------------DTYVIALA-INGK
RLMH_OCEIH       EVADEKAPETMSEAEMKEVKRKEGERILSSIAP--------------DAFVITLE-IEGK
RLMH_GEOKA       EVADEKTPERASELEEEQIKEREGGRLLAKIPH--------------DAHVIALA-IEGK
RLMH_GEOTN       EVADEKTPERASELEEEQIKQREGERLLAKIPH--------------DAHVIALA-IEGK
RLMH_EXIS2       EVPDEKAPEQLSDAEMQQVKKKEGERILAKIGP--------------DVHVYALA-IEGK
RLMH_LACAC       QVPDEKAPEKFSEAEDEKVKEIEGQRILSKIKD--------------KEYVYVTA-IKGK
RLMH_LACH4       QVPDEKAPEKFSAAEDERVKQIEGERILSKIKD--------------KEYVYVTA-IKGK
RLMH_LACGA       QVPDEKAPEKLSPAEMEQVKEIEGKRILDKIKD--------------KEYVYVTA-IKGK
RLMH_LACJO       QVPDEKAPEKLSPAEMEQVKEIEGKRILDKIKD--------------KEYVYVTA-IKGK
RLMH_LACDA       QVPDEKAPESLSPAQMEEVKKREGERILSKIKD--------------KEYVYVLA-IKGK
RLMH_LACDB       QVPDEKAPESLSPAQMEEVKKREGERILSKIKD--------------KEYVYVLA-IKGK
RLMH_LACP3       EVADEKAPENLSEAEMADVKAKEGDRILGKIKD--------------KEWVIALA-IEGK
RLMH_LACCB       EVADEKAPENLSEAEMADVKAKEGDRILGKIKD--------------KEWVIALA-IEGK
RLMH_LACSS       EVSDEKAPESLSEAEMTTVKDKEGERILAKVKD--------------KEHVIVLA-IHGK
RLMH_LACBA       EVPDEKAPENLSQAEMDRVMAEEGERILAKIKD--------------REYVYALA-ILGK
RLMH_LACPL       EVPDEKAPESLSNAEMENVKAKEGQRILEKIKD--------------RDYVYALA-ILGK
RLMH_LACRD       EVPDEKAPESLSQAEMDEVMAKEGERILDKIKD--------------REYVYALA-IKGK
RLMH_LACRJ       EVPDEKAPESLSQAEMDEVMAKEGERILDKIKD--------------REYVYALA-IKGK
RLMH_LACF3       EVPDEKAPETLSQAEMDAVMAKEGERILAKIKD--------------REYVYALA-IKGK
RLMH_LACS1       EVPDEKAPEKLSPAEMEGVKEKEGERILAKIKD--------------KEYVYALA-IEGK
RLMH_PEDPA       EVPDEKAPESLSDAQMNEVKVKEGERILGKIKD--------------RDYVFTLE-IKGK
RLMH_ENTFA       EVPDEKAPEKLSDAEMLQVKEKEGQRILGKIND--------------NEYVFVLA-INGK
RLMH_STAA1       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAM       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAN       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAA8       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAE       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAT       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAA3       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAU       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAB       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAA2       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAA9       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAR       EVPDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAS       EVTDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAAW       EVTDEKAPENMSDKEIEQVKEKEGQRILAKIKP--------------QSTVITLE-IQGK
RLMH_STAHJ       EVPDEKAPENMSDKEIEQVKEKEGQRLLAKIKP--------------QATVITLE-IQGK
RLMH_STAHO       EVPDEKAPETMSDKEIEKVKEKEGQRLLAQIKP--------------QATVITLE-IQGK
RLMH_STAES       EVPDEKAPENMSDKEIEQVKEKEGQRLLNKIKP--------------QSTVITLE-IKGK
RLMH_STAEQ       EVPDEKAPENMSDKEIEQVKEKEGQRLLNKIKP--------------QSTVITLE-IKGK
RLMH_STAS1       EVPDEKAPENMSDKEVEQVKEKEGQRLLAKVKQ--------------QSTVITLE-IKGN
RLMH_CARHZ       EVDDENAPENLSPAEAEKVVKKEGERILAKITP--------------SSFVIALD-LKGK
RLMH_HUNT2       EVEDEHAPDNLSSLEEQQVKKREAERVVKRLKE--------------GTLLVVLD-VRGS
RLMH_PELTS       EVEDGSLPENPAAAGGEKVKEKEGERLLGRLRP--------------GTFLIALD-VRGK
RLMH_DESRM       EVPDEPCPENAPMAIEEQVRQKEADKLAKKLRP--------------GTFLVVLD-LKGK
RLMH_SYMTH       TVPDEPIPDGASPAQEAQVMQREGERLLRALDQGG------------QEHVVVLD-GRGK
RLMH_DESTE       EVREESLPASGRAGALEAVLKKEGTRLLERIPD--------------NCVTIALD-RKGM
RLMH_MOOTA       EAPEEKVPDKPSPAGVEQILASEGRGIGRLIPP--------------SSFTVALD-REGV
RLMH_DESHY       EIADEPCPERLSAADEERVKDREGERLLKGIGP--------------QEHVILLD-LQGK
RLMH_NATTJ       EVKDSVLPNKLYQAEIEKVLIEEENRIKSKLSS--------------RDYIIALD-SEGS
RLMH_HELMI       EVPDEKVPDKPSDTEAALIKRKEGDRLLAAAGDK-------------DYIGVALD-PRGE
RLMH_METLZ       ELAEVKIPDNASASDELRVKEREGELILANVKE--------------GFFKIALD-PNGM
RLMH_METB6       EIPEEHRGTRAPAGQEELAKEKEGGRILAAIPE--------------RAYVVALD-LRGT
RLMH_DESPS       YLK------GKGKKGALLSTEQEGELLLANVPA--------------NAFVVALD-VQGK
RLMH_BACFR       VIPELKNTKSLTPEQQKE---KEGELIAKALQP--------------GDVVVLLD-EHGK
RLMH_BACFN       VIPELKNTKSLTPEQQKE---KEGELIAKALQP--------------GDVVVLLD-EHGK
RLMH_BACTN       VIPELKNTKSLSMDQQKE---KEGELILKALQP--------------GDVIVLLD-EHGK
RLMH_BACV8       VIPELKNTKNLSMEQQKE---KEGELILKALLP--------------GDVVVLLD-EHGK
RLMH_PARD8       VIPDIKNVKNLSEAQQKE---KEGELILKALQP--------------GDYLVLLD-EKGK
RLMH_FLAJ1       IIPDIKNVKNLSESQQKE---KEGELILSKLSA--------------TDQLILLD-ENGK
RLMH_FLAPJ       IIADIKNVKNLSETQQKE---KEGELILSKITP--------------TDQLILLD-ENGK
RLMH_GRAFK       IIPDLKKTKNLDENQQKS---KEGELILSGVQN--------------SDFVVLLD-ENGK
RLMH_PORGI       VIPDVRLGSKLSSEQQKD---AEGREILARLRP--------------SDSTVLLD-ERGR
RLMH_PORG3       VIPDVRLGSKLSSEQQKD---AEGREILARLRP--------------SDSTVLLD-ERGR
RLMH_CYTH3       EIPEPKNTKLSSDVLKKE---EE-KLIFDRLQD--------------SDQLILLD-EKGN
RLMH_BDEBA       SLKAKKSAREDAD-FKRN---EESELILKNINS--------------DDYVVLFD-ERGS
RLMH_PELCD       ELKEEKSGKNDAE-YIRR---QEGRRILEKIPA--------------GSFVIALD-ERGR
RLMH_GEOMG       EAREEKGAAAEA---MRT---RECERLEKLVPK--------------NARLVLLD-ERGD
RLMH_GEOSL       EARDEKGAAAEA---MRA---RECERLDKLVPR--------------TSRLILLD-ERGD
RLMH_GEOUR       EAKEEKGAAAEA---MRE---REGERLVKLLPR--------------NARLILLD-ERGE
RLMH_GEOBB       EAREEKGAQAAA---MRE---RECERLAKLIPK--------------GGRLVLLD-ERGE
RLMH_PELPD       EVRDEKGAMAEE---MRR---RECERLEKQIPP--------------GATLLLLD-ERGE
RLMH_GEOLS       ELKDEKDATLEE---GRR---REGERLLKQLSP--------------NAVLVALD-ERGQ
RLMH_DESVH       VVKDGGAALPPTARNADE-----GARLIAAMGP--------------TDIVVCLD-EHGR
RLMH_DESVV       VVKDGGAALPPTARNADE-----GARLIAAMGP--------------TDIVVCLD-EHGR
RLMH_DESAG       IIKDGNAALPPLERNAQE-----GARIVAALTP--------------ADLAVCMD-ETGR
RLMH_LAWIP       IIKDGNSSLSVSQRKAME-----GKNILAALEP--------------IDIPICLD-EKGK
RLMH_METHJ       EYPEAPVPDTHPSTIEMACV-SEGEKLCSGIDS--------------LDYVIILD-RTGK
RLMH_METTP       EVREEDPIKEGRGILA---------HLCGGV-------------------TVALD-EHGE
RLMH_SYNFM       YVKAEKIPPRGMESAVLEK--ECERILKLIGGK--------------SNQLIVWD-RTGK
RLMH_COPPD       ETKQEN--PFNMTT------------------K--------------EGFHIVLD-AQGK
RLMH_SYNWW       DGLEEKIGPRAGEKEIQAILQKEAEKIRRWLDK--------------DEILVVLD-LEGQ
RLMH_CALS8       EIKEED---ENKYRNVEMLLKKEAEKILKHIKE--------------GQYVVVFD-INGT
RLMH_SHIFL       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SHIF8       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOLI       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SHIBS       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SHIDS       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SHISS       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOL6       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOL5       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECO57       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOK1       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOUT       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECO24       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOHS       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOLC       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOSE       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SHIB3       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECODH       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECO5E       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_ECOSM       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_CITK8       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALAR       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALPA       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALTY       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALPB       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALTI       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALHS       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALSV       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALNS       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALA4       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALEP       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALPK       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALDC       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALG2       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLD-IPGK
RLMH_SALCH       EIPAGKRGKN---ADIKRILDKEGEQMLA---AAGK------------NRIVTLN-IPGK
RLMH_ENT38       EIPAGKRGKN---ADIKRILDKEGELMLA---AAGK------------NRIVTLD-IPGK
RLMH_CROS8       EIPAGKRGKN---ADIKRILDKEGEMMLA---AAGK------------NRIVTLD-IPGR
RLMH_KLEP7       EIPAGKRGKN---ADIKRILEKEGEMMLA---AAGK------------NRIVTLD-IPGK
RLMH_KLEP3       EIPAGKRGKN---ADIKRILEKEGEMMLA---AAGK------------NRIVTLD-IPGK
RLMH_PHOLL       EIPAGKRGKN---ADIKRILEKEGEQMLA---AVSKG-----------SRIVTLD-IPGS
RLMH_SODGM       EIAAGKRGKN---ADIARILDKEGEQMLA---AVAKG-----------NRIVTLD-IPGA
RLMH_PROMH       EIPAGKRGKN---ADIKRILEKEGEQMLA---AVGKG-----------NRIVTLD-IPGA
RLMH_SERP5       EIPAGKRGKN---ADIKRILEKEGEQMLA---AVGKG-----------NRIVTLD-IPGT
RLMH_PECAS       EIPAGKRGKN---ADIKRILEREGEQMLA---AVGKG-----------NRIVTLD-IPGT
RLMH_YERPE       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERPY       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERPA       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERPN       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERPP       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERPS       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERPG       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERPB       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERP3       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_YERE8       EIPAGKRGKN---ADIKRILEKEGELMLA---AVGKN-----------NRIVTLD-IPGT
RLMH_ERWT9       EVPAGKRGKN---ADIKRILEKEGEMMLA---ATGKG-----------NRIVTLD-IPGQ
RLMH_ACTP2       EIPAGKRGKN---ADIKRILEQEGKAMLA---AAGK------------GKVVTLD-IPGK
RLMH_ACTP7       EIPAGKRGKN---ADIKRILEQEGKAMLA---AAGK------------GKVVTLD-IPGK
RLMH_ACTPJ       EIPAGKRGKN---ADIKRILEQEGKAMLA---AAGK------------GKVVTLD-IPGK
RLMH_MANSM       EIPAGKRGKN---ADIKRILEQEGKAMLS---ACGR------------GKVVTLD-IPGK
RLMH_HAEIN       EIPAGKRGKN---ADIKRILEQEGKAMLA---ACGK------------GKVVTLD-IPGK
RLMH_HAEIG       EIPAGKRGKN---ADIKRILEQEGKAMLA---ACGK------------GKVVTLD-IPGK
RLMH_HAEI8       EIPAGKRGKN---ADIKRILEQEGKAMLA---ACGK------------GKVVTLD-IPGK
RLMH_HAEIE       EIPAGKRGKN---ADIKRILEQEGKAMLA---ACGK------------GKVVTLD-IPGK
RLMH_HAEDU       EIAAGKLGKN---ADIKRILEQEGKAMLA---AAGK------------AKIVSLD-IPGK
RLMH_ACTSZ       EITAGKRGKN---ADIARILEQEGKAMLT---ACGK------------NKIVTLD-IPGK
RLMH_HAES1       EIPAGKRGKN---ADIKRILEQEGKAMLS---ACQK------------SRIITLD-IPGK
RLMH_HISS2       EIPAGKRGKN---ADIKRILEQEGKAMLS---ACQK------------SRIITLD-IPGK
RLMH_PASMU       EIPAGKRGKN---ADIKRILEQEGKAMLA---ACGK------------SRIVTLD-IPGK
RLMH_AERHH       EIGAGKRGKN---ADIPRILQKEGEAMLA---AAGR------------SRIVTLD-IPGK
RLMH_AERS4       EIGAGKRGKN---ADIPRILQKEGEAMLA---AAGR------------SRLVTLD-IPGK
RLMH_ALIF1       EITAGKRGKN---ADIARILQKEGEAMLA---AVPKG-----------NRIVTLD-IPGK
RLMH_ALIFM       EITAGKRGKN---ADITRILQKEGEAMLA---AVPKG-----------NRIVTLD-IPGK
RLMH_ALISL       EITAGKRGKN---ADIARILQKEGEAMLA---AVPKG-----------NRIVTLD-IPGK
RLMH_PHOPR       EIPAGKRGKN---ADIARILQKEGEAMLA---TVAKG-----------NRIVTLD-IPGK
RLMH_VIBCH       EITAGKRGKN---ADIARILQKEGEAMLA---AVPKG-----------NRIVTLD-IPGK
RLMH_VIBC3       EITAGKRGKN---ADIARILQKEGEAMLA---AVPKG-----------NRIVTLD-IPGK
RLMH_VIBCB       EIPAGKRGKN---ADIARILQKEGEAMLS---AVPKG-----------ARIVTLD-IPGK
RLMH_VIBPA       EISAGKRGKN---ADIARILQKEGEAMLA---AVPKG-----------NRIVTLD-IPGK
RLMH_VIBVU       EITAGKRGKN---ADIARILQKEGEAMLA---AIPKG-----------NRIVTLD-IPGK
RLMH_VIBVY       EITAGKRGKN---ADIARILQKEGEAMLA---AIPKG-----------NRIVTLD-IPGK
RLMH_SHEB5       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHEB8       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHEB9       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHESA       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVTLD-LPGK
RLMH_SHESM       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVTLD-LPGK
RLMH_SHESR       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVTLD-LPGK
RLMH_SHEON       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVTLD-LPGK
RLMH_SHEPC       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHESW       EIPAGKRGKN---ADIVRILQKEGEQMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHEAM       EIPAGKRGKN---ADIARILQKEGEQMLA---AIPKG-----------NHIVTLD-LPGK
RLMH_SHEDO       EIPAGKRGKN---ADIARILQKEGDLMLA---AVAKG-----------NHIVSLD-LPGK
RLMH_SHEFN       EIPAGKRGKN---ADIARILHKEGELMLA---AVAKG-----------NHIVSLD-LPGK
RLMH_SHESH       EIPAGKRGKN---ADIARILHKEGEQMLA---AIPKS-----------NHIVSLD-LPGK
RLMH_SHEWM       EIPAGKRGKN---ADIARILHKEGEQMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHELP       EIPAGKRGKN---ADIARILQKEGEQMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHEHH       EIPAGKRGKN---ADIARILQKEGELMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_SHEPA       EIPAGKRGKN---ADIARILQKEGELMLA---AIPKG-----------NHIVSLD-LPGK
RLMH_PSEA6       EIPAGKRGKN---ADIKRILHKEGELTMA---AIPKG-----------NRIVTLE-VTGK
RLMH_PSEHT       EIPAGKRGKN---ADIKRILHIEGEKTLA---AIPKG-----------NRIVTLE-VTGK
RLMH_PSYIN       EINAGKRGKN---ADIKRILKKEGELTLA---AIPKG-----------NKIVTLE-VTGQ
RLMH_COLP3       EIPAGKRGKN---ADISRILAKEGELLLA---AIPKG-----------NRIVTLE-VEGQ
RLMH_IDILO       EIAAQKRTRK---ADLNRVMQQEGKSLLQ---AIPKG-----------NRIVTLE-VKGQ
RLMH_COXBN       EIAAFKRSKG---ADLKKIMLQESQQLID---AVPKE-----------SEIIVLD-RLGE
RLMH_COXB1       EIAAFKRSKG---ADLKKIMLQESQQLID---AVPKE-----------SEIIVLD-RLGE
RLMH_METCA       EIAPGKRTRN---CDIQRILADEGQRMLA---AVGGN-----------AHIVTLD-VGGK
RLMH_LEGPC       EIPLLRRNKS---SDLARILEKESALIKD---ALPAN-----------ARLIALD-MLGK
RLMH_LEGPA       EIPLLRRNKS---SDLARILEKESALIKD---ALPAN-----------ARLIALD-MLGK
RLMH_LEGPL       EIPLLRRNKS---SDLARILEKESALTKD---ALPAN-----------ARLIALD-MLGK
RLMH_LEGPH       EIPLLRRNKS---SDLARILEKESALTKD---ALPAN-----------ARLIALD-MLGK
RLMH_DICNV       EIPLQKRGDD---KQIAAARSKESAQILA---ALAGK-----------DYVVTLD-IAGK
RLMH_XANAC       EIEPGMRGKG---RDAQRATDDEGRRVLA---ALPKN-----------AYVVALD-VPGR
RLMH_XANC5       EIEPGLRGKG---RDAQRATDDEGRRVLA---ALPKN-----------AYVVALD-VPGR
RLMH_XANOR       EIEPGLRGKG---RDAQRATDDEGRRVLA---ALPKN-----------AYVVALD-VPGR
RLMH_XANOP       EIEPGLRGKG---RDAQRATDDEGRRVLA---ALPKN-----------AYVVALD-VPGR
RLMH_XANOM       EIEPGLRGKG---RDAQRATDDEGRRVLA---ALPKN-----------AYVVALD-VPGR
RLMH_XANCP       EIEPGLRGKG---RDAQRAIDDEGRRVLA---ALPKN-----------AHVVALD-VPGR
RLMH_XANC8       EIEPGLRGKG---RDAQRAIDDEGRRVLA---ALPKN-----------AHVVALD-VPGR
RLMH_XANCB       EIEPGLRGKG---RDAQRAIDDEGRRVLA---ALPKN-----------AHVVALD-VPGR
RLMH_STRMK       EIEPGLRGKG---RDARRATEDEGRRVIA---ALPKN-----------AYVVALD-VPGR
RLMH_STRM5       EIEPGLRGKG---RDPRRATEDEGKRVIA---ALPKN-----------AYVVALD-VPGR
RLMH_XYLFT       EIEPSMRGKN---HDPQRAIEDEGRRVMA---ALPKQ-----------PYAVTLD-VKGK
RLMH_XYLF2       EIEPSMRGKN---HDPQRAIEDEGRRVMA---ALPKQ-----------PYAVTLD-VKGK
RLMH_XYLFM       EIEPSMRGKN---HDPQRAIEDEGRRVMA---ALPKQ-----------PYAVTLD-VKGK
RLMH_XYLFA       EIEPSLRGKN---HDPQQAIEDEGRRVMA---ALPKQ-----------PYAVTLD-VKGK
RLMH_PSEAE       EIPLNTRGKN---ADVARLIRQEGEAMLA---RVQPG-----------ERVVTLE-VEGR
RLMH_PSEA7       EIPLNTRGKN---ADVARLIRQEGEAMLA---RVQPG-----------ERVVTLE-VEGR
RLMH_PSEAB       EIPLNTRGKN---ADVARLIRQEGEAMLA---RVQPG-----------ERVVTLE-VEGR
RLMH_PSEMY       EIPLNTRGKN---ADVARLIRQEGEAMLS---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEU5       EIPLNTRGKN---ADVARLIRQEGEAMLG---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEP1       EIPLNTRGKN---ADVARLIRQEGEAMLS---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEPK       EIPLNTRGKN---ADVARLIRQEGEAMLS---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEPG       EIPLNTRGKN---ADVARLIRQEGEAMLS---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEPW       EIPLNTRGKN---ADVARLIRQEGEAMLS---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEE4       EIPLNTRGKN---ADVARLIRQEGEAMLS---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEU2       EIPLNTRGKN---ADVARFIRQEGEAMLA---KVQPG-----------ERIVTLE-VQGK
RLMH_PSESM       EIPLNTRGKN---ADVARFIRQEGEAMLA---KVQPG-----------ERIVTLE-VQGK
RLMH_PSE14       EIPLNTRGKN---ADVARFIRQEGEAMLA---KVQPG-----------ERIVTLE-VHGK
RLMH_PSEF5       EIPLNTRGKN---ADVARFIRQEGEAMLA---KVGHN-----------ERIVTLE-VHGK
RLMH_PSEPF       EIPLNTRGKN---ADVARFIRQEGEAMLA---KVGQN-----------ERIVTLE-VHGK
RLMH_CHRSD       EIAPGKRGKN---ADVARAIQGEGNAMLA---KLRDQ-----------ERVIALA-VDGQ
RLMH_HAHCH       EIPMPRRQKN---ADPHKLKIQEGESILQ---SLGSG-----------DHVVALE-VEGK
RLMH_MARHV       EIPMAHRGKN---PDISRLMQRESDAILS---AAGTR-----------DRVVALE-VGGR
RLMH_SACD2       ELPLAVRSKS---TNTQNAIASEGDNMLK---HIGSN-----------TRTIALD-VLGK
RLMH_CELJU       ELPLAQRSKN---SDVAKAMEKEGEAMLA---AIGKG-----------EQVIALD-VKGK
RLMH_MARMS       EIPMSPRGKN---TDIPKAIRKEGDSMLE---AIPSG-----------DKVIAME-VLGK
RLMH_ALCBS       EIPMPKRGKGDA-GSQIRAEADALRKRLE---TIVKKSPG--------AKTVALE-VNGR
RLMH_ALKEH       EIPLGRRGKG---ADPRRALDEEGRRMLK---ALGDE------------QVVALD-VRGK
RLMH_ACIAC       AVKTEPRG-S---KTLETLYAAERERIEA---AIPRGT-----------RVVALD-ERGT
RLMH_ACISJ       AVKTEPRG-S---KTLETLYAAERERIEA---AIPRGT-----------RVVVLD-ERGT
RLMH_DELAS       AVKTEPRG-S---KTVETLYAAERKRIEA---AIPRGT-----------RIVVLD-ERGT
RLMH_RHOFT       AVKTEPRG-S---KTVEALVAAERGRIEA---ALPKGC-----------RIVALD-ERGT
RLMH_POLNA       AVKTEPRG-S---KTLENLLAAERTRIEG---AIARGC-----------RIVALD-ERGT
RLMH_POLSJ       AVKTEPRA-S---KTLENLLAAERARIES---VITRGT-----------RVVALD-ERGT
RLMH_VEREI       AVKTEPRA-G---KTLASLLAAERGRIEA---AIPRGA-----------QVVALD-ERGT
RLMH_METPP       AVKAEPRTQG---KTVDAMKAAEAQRIEA---ACARGV-----------RRVVLD-ERGT
RLMH_LEPCP       AVKTEARTTG---KPVEALMAAEKTRIEA---ALPRGC-----------RRVVLD-EHGQ
RLMH_AZOSB       EVKAEPRTSG---KPVEAMMAAEAARIEA---VLPPRC-----------RRVVLD-ERGG
RLMH_AROAE       EVKAEPRTTG---KTVEAMMAAEATRIEA---ALPARC-----------RRVILD-EHGA
RLMH_BORBR       EIKPEPRTSG---KTPAQMMAAEARRIET---ALPPGV-----------LRIALD-ERGR
RLMH_BORPE       EIKPEPRTSG---KTPAQMMAAEARRIET---ALPPGV-----------LRIALD-ERGR
RLMH_BORPA       EIKPEPRTSG---KTPAQMMAAEARRIET---AQPPGV-----------LRIALD-ERGR
RLMH_BORA1       EIKPEPRTSG---KTPAQMMAAEARRIEA---ALPAGA-----------LRIALD-ERGR
RLMH_BORPD       EIKPEPRTTG---KTPAQMMAAEARRIEA---AIPGGA-----------LRLALD-ERGR
RLMH_BURCA       EIKPELRSGG---RSAESVMAAERQKIEA---ALPKGA-----------RLVALD-ERGR
RLMH_BURCH       EIKPELRSGG---RSAESVMAAERQKIEA---ALPKGA-----------RLVALD-ERGR
RLMH_BURCC       EIKPELRSGG---RSAESVMAAERQKIEA---ALPKGA-----------RLVALD-ERGR
RLMH_BURCJ       EIKPELRSGG---RSAESVMAAERQKIEA---ALPKGA-----------RLVALD-ERGR
RLMH_BURL3       EIKPELRSGG---RSAESVMAAERQKIEA---ALPKGA-----------RLVALD-ERGR
RLMH_BURCM       EIKPELRSGG---RSADSVMAAERQKIEA---ALPKGA-----------RIVALD-ERGR
RLMH_BURA4       EIKPELRSGG---RSAESVMAAERQKIEA---ALPKGA-----------RIVALD-ERGR
RLMH_BURVG       EIKPELRSGG---RSAESVMAAERQKIEA---ALPKGA-----------RIVALD-ERGR
RLMH_BURM1       EIKPELRSGG---RSAESVMAAERQKIDA---ALPKGA-----------RIVALD-ERGR
RLMH_BURMA       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURM9       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURM7       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURMS       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURPS       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURP0       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURP1       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURP6       EVKPELRSGS---RTADSVMAAEQQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_BURTA       EVKPELRSGS---RTADSVMAAERQRIEA---ALPKNA-----------RVVALD-ERGR
RLMH_PARXL       EIKPEQRSSG---RPAESVMAAERIRIEA---ALPKNA-----------RIVALD-ERGK
RLMH_PARP8       EIKPEQRSSG---RSAESVMASERQKIEA---ALPRNA-----------RIVALD-ERGK
RLMH_PARPJ       EIKPEQRSSG---RQADSVMAAERLKIEA---ALPKNA-----------RIVALD-ERGK
RLMH_CUPNH       EVKPETRSSS---NNAATVMQREAARIEAVLGSLSKQC-----------RIVALD-ERGR
RLMH_CUPTR       EVKPETRSSS---NNAATVMQREAARIEAVLGSLSKQC-----------RIVALD-ERGR
RLMH_CUPPJ       EVKPETRSSS---NNAATVMQREAARIDAVLGSLSRQC-----------RIVALD-ERGR
RLMH_CUPMC       EVKPETRSSS---NNAATVMQREAARIEAVLGSLSKQC-----------RIVALD-ERGK
RLMH_RALSO       EIKPEQRSGS---RTAATVMQLEAARIEA---ALPKGC-----------RIVALD-ERGK
RLMH_RALPJ       EIKPEQRSGS---RTAATVMQLEAARIEA---ALPKGC-----------RMIALD-ERGK
RLMH_HERAR       EIKPVERSGS---KTAETAMALERAKIEA---AVPKGA-----------RIIALD-EHGK
RLMH_JANMA       EIKPVERSGS---KTAETAMALERAKIEA---ALPKGA-----------RIIALD-EHGK
RLMH_POLAQ       EIKPDL------------TPAKEAVKIAA---AIPKGS-----------RVIALD-ERGK
RLMH_POLNS       EIKPDL------------TLAKEAVKIAA---AIPKGS-----------RVIALD-ERGK
RLMH_NEIG1       EIKPEKRGAG---VNAVQGMAAEEKRILE---AIPQGA-----------FLVVLD-ERGK
RLMH_NEIG2       EIKPEKRGAG---VNAVQGMAAEEKRILE---AIPQGA-----------FLVVLD-ERGK
RLMH_NEIMA       EIKPEKRGAG---VNAAQGMAAEEKRILE---AIPQGA-----------FLVVLD-ERGK
RLMH_NEIMB       EIKPEKRGAG---VNAAQGMAAEEKRILE---AIPQGA-----------FLVVLD-ERGK
RLMH_NEIMF       EIKPEKRGAG---VNAAQGMAAEEKRILE---AIPQGA-----------FLVVLD-ERGK
RLMH_NEIM0       EIKPEKRGAG---VNAAQGMAAEEKRILE---AIPQGA-----------FLVVLD-ERGK
RLMH_CHRVO       EIKPEKRGGG---VTAEKGIAAEHERLIA---AIPPRA-----------RLVVMD-ERGK
RLMH_NITEU       EIKPEKRVGS---KNTRQLLQAESERIRT---VLPPGC-----------HIVVLD-ETGK
RLMH_NITEC       EIKPEKRIG----KKTEQLLQAESERIRI---ALPPGC-----------HIVVLD-ESGK
RLMH_NITMU       EIKPERRDSG---KKVEQLLAAEGARIRA---LLPSNC-----------RLVVMD-ERGS
RLMH_DECAR       EIKPEARGS----KTREQLLAAEKSRIRD---AMAAGS-----------RLVVLD-EKGD
RLMH_METFK       EIKPDKRASG---KNAEAVQEAEAKRILE----AAGRD-----------YLVALD-EHGQ
RLMH_THIDA       EIKPGHRVAG---ADGARARQLEAARILA---AITPGA-----------VRVVLD-ERGT
RLMH_HALHL       EVGAGGR--G---NDDPQAREREGERLLR---ALPSRA-----------VCVALD-EGGT
RLMH_NITOC       EIAPARRGKS---GHPTQWRQDECRRLLA---AVPPNS-----------KVIACD-ERGQ
RLMH_HYDCU       ELPMATRGKS---GSVAQYKAEEAKRILS---AVPKGA-----------KLIVLD-EKGQ
RLMH_ACIF5       GLPLARRGRS---GDPVRWRREEGERILA---ATPAGA-----------ERIALE-VNGR
RLMH_ACIBC       ELPMAKRGKNDSEADILKYCQIEGESILN---ALKPN-----------ETLIALE-VGGR
RLMH_ACIBY       ELPMAKRGKNDSEADILKYCQIEGESILN---ALKPN-----------ETLIALE-VGGR
RLMH_ACIBT       ELPMAKRGKNDSEADILKYCQIEGESILN---ALKPN-----------ETLIALE-VGGR
RLMH_ACIBS       KLPMAKRGKNDSEADILKYCQIEGESILN---ALKPN-----------ETLIALE-VGGR
RLMH_ACIAD       ELPMAKRGKNDSDADILKYCQIEGESILA---ALKPN-----------EVLIALE-VGGR
RLMH_PSYA2       EIAAAKRAKNPSDANLAQYREQEGQAILA---AHAAAGR---------EQLWVLD-VKGK
RLMH_PSYCK       EIAAAKRAKNPSDANLAQYREQEGQAILA---AHAVAGR---------EQLWVLD-VKGK
RLMH_PSYWF       DLAAAKRAKNPSEANLAQYREQEGKAILA---THQSNSR---------EKLWVLD-VKGK
RLMH_FRAP2       ELPIAKRTKTG---NPKLWMEQEAKTILT---KLSDSD-----------HLVILD-VNSK
RLMH_FRATN       ELPIAKRTKTG---NPKLWMEQEAKTILG---KLNDSD-----------HLVILD-VNSK
RLMH_FRATH       ELPIAKRTKTG---NPKLWMEQEAKTILG---KLNDSD-----------HLVILD-VNSK
RLMH_FRATF       ELPIAKRTKTG---NPKLWMEQEAKTILG---KLNDSD-----------HLVILD-VNSK
RLMH_FRATO       ELPIAKRTKTG---NPKLWMEQEAKTILG---KLNDSD-----------HLVILD-VNSK
RLMH_GRABC       EIAEARGSTA-------EIRRRETSALLA---ALP-----------PACIVVAMD-LGGR
RLMH_GLUDA       EVAEGRGAPA-------EIKRREGQALLS---ALP-----------DRAFAVALD-EGGR
RLMH_ACICJ       ALPDGTGSPA-------EIKRREADAILR---RLA-----------AEDLVIALD-LGGK
RLMH_GLUOX       ELAPSKGSVQ-------EQKRQDAAALLG---ACP-----------DNALIVALD-EGGK
RLMH_MAGMM       EIAEGQRTGK-------ESPATRSKAIAD---EGERILEKM-----DKRLWMALD-RGGK
RLMH_SOLUE       EIRPER-------------IDLWTKHPTA--------------------RKIFLD-PAGK
RLMH_RHIL3       ELTRVAEVAESRASNAETRKREEAAMLLKSLAD--------------GSILILLD-ERGK
RLMH_RHILW       ELARVAEVAESRASNAETRKREEAAMLLKSLAD--------------GSILILLD-ERGK
RLMH_RHIEC       EFTRVAEVGESRASNAETRKREEAAMLLKSLAE--------------GSVLILLD-ERGK
RLMH_RHIE6       ELARIAETAESRASNAETRKREEAAILLKSLAE--------------GSVLILLD-ERGK
RLMH_RHIME       ELARVVETAESRAANAETRKREEAGQLEKALAD--------------GSLLVLLD-ERGK
RLMH_SINMW       ELARVAEMVESRAANAETRKREEAVQLEKALVD--------------GSLLVLLD-ERGK
RLMH_AGRFC       EFSRVIEVGESRASNAETRKREEAAMLEKHLAD--------------GAVLVLLD-ERGK
RLMH_BRUAB       EFAGVSEIPESRGQTAQLRKAEEAQRIHEALDNAKSG-----GTSSGGAALILLD-ERGK
RLMH_BRUA1       EFAGVSEIPESRGQTAQLRKAEEAQRIHEALDNAKSG-----GTSSGGAALILLD-ERGK
RLMH_BRUA2       EFAGVSEIPESRGQTAQLRKAEEAQRIHEALDNAKSG-----GTSSGGAALILLD-ERGK
RLMH_BRUO2       EFAGVSEIPESRGQTAQLRKAEEAQRIHEALDNAKSG-----GTSSGGAALILLD-ERGK
RLMH_BRUME       EFAGVSEIPESRGQTAQLRKAEEAQRIHEALDNAKSGGAKSGGTSSGGAALILLD-ERGK
RLMH_BRUSU       EFAGVSEIPESRGQTAQLRKAEEAQRIHEALDNAKSGGAKSGGTSSGGAALILLD-ERGK
RLMH_OCHA4       EFAGVSEIPESRGQTAELRKAEEAQRIHEALDN--------------GAALILLD-ERGK
RLMH_CHESB       ELAGVSEIPESRARSTLERKREEG-RKLLDFAQ--------------GGALILLD-ERGK
RLMH_RHILO       EFAGITEIAEGRSQSAIERQRDEGSRLQAQLQP--------------GTALILLD-ERGK
RLMH_BARHE       HFKILQEISESRAPTACQRMEEEGRRLIEFLPE--------------KCRLIVLD-ERGK
RLMH_BART1       HLKKLQEIPESRAQTACQRMEEEGRKLIEFLPE--------------KCQLIVLD-ERGE
RLMH_BARBK       HFRKMQEVSESRAQTACQRMEEEGKRLFEALPE--------------PSRLIVCD-ERGK
RLMH_AZOC5       SGFDTIELSESAARRPEDRMAEEGQAILGALPQ--------------GADVIALD-PRGK
RLMH_XANP2       GPCDMIEIPESAARRAEDRMAEEGAALLAALPA--------------GAGLIALD-PRGR
RLMH_METPB       TACDLTEIPESRARRAADRVAEEAAAILALVPA--------------DAAVIACD-ERGR
RLMH_METEP       TACDLTEIPESRARRSADRIAEEAAAILALVPA--------------DAAVIACD-ERGR
RLMH_METRJ       PSCDNVEIPESRARRAPDRCAEEAAALATYLPS--------------GGVLVAYD-ERGR
RLMH_METS4       SAVQLTELPESRARRAPDRCAEEGAAILACLPA--------------GSAVIVMD-EGGR
RLMH_BRASB       RGLDLHELPESRARDAATRISEEAAAIAALIPG--------------RSVLVCLD-ERGQ
RLMH_BRASO       RGLDIHEIPESRARDAATRMAEEAAAIAAAIPD--------------NSMLVCLD-ERGH
RLMH_BRADU       RELSIHEIPESRARDAATRMAEEAAAIGAYIPD--------------KSILVALD-ERGQ
RLMH_RHOPA       RGLDVHEIAESRAREAPARMAEEAAAIIAQVPD--------------GAVLVTLD-ERGQ
RLMH_RHOPT       RGLDVHEIAESRAREAPARMAEEAAAIIAQVQD--------------GAVLVTLD-ERGQ
RLMH_RHOPS       RGLDIHEIAESRARDAAGRMAEEAAAIAALIAE--------------GSSLVTLD-ERGK
RLMH_RHOP2       RGLDIHEISESRARDAATRMAEEAAAIAALVPD--------------GGALVTLD-ERGK
RLMH_RHOP5       RGLEVHEIAESRARDVPTRMAEEAAAMVALVPE--------------RAMLVAMD-ERGQ
RLMH_RHOPB       RGPEIHEIGESRARDAPTRIAEEAAAIAALIPD--------------KAVLVTLD-ERGD
RLMH_NITHX       RGFDVHEIPESRARDAKQRIREEAAAILALAPE--------------GAVLVALD-EKGK
RLMH_NITWN       RGLDVHEVAESRARDAGQRIREEAAAVLALAPK--------------EMILVALD-EKGK
RLMH_OLICO       RGLDIVELPESRHADATGRIAEEANAIAAHIPE--------------HAAVVALS-ERGD
RLMH_BEII9       PSVELREIEESRARRGDERKAQEGKAIRALLQP--------------ASLIVAFD-EHGR
RLMH_CAUVC       GPVDILEVEARK-PGKAA-----EAEVLRPHL--------------EGAYVVACD-EHGK
RLMH_CAUSK       GPVEIVEVEARK-PGKAA-----EAEVLRPHL--------------EGAYVIACD-EHGK
RLMH_PHEZH       GPVEVVEVESRK-PGKAA-----EAEALRAHL--------------SDAHVIACD-ERGA
RLMH_HYPNA       KGPEEAEIASGG-GMDAE-----GARLLARIP--------------EGARIIRLD-EGGE
RLMH_RUEPO       GPARVVEVEDKKNAGMGA-----EAALLRKALP-------------AGAVLCTLD-ERGK
RLMH_RUEST       GPARVIEVEDKKNAGMGA-----EADLLRKALP-------------KGALICTLD-ERGK
RLMH_ROSDO       GPARVVEVEDRKNGGMGN-----EAALLRRAIP-------------DGALIAVLD-ERGR
RLMH_DINSH       GPASVVEVEDRKGGGKAA-----EADLLRKAVP-------------RGAVICALD-ERGK
RLMH_RHOS4       PPVQLLEFEDRKGGGMEA-----EADLIAKAVA-------------PGAALVVLD-ERGR
RLMH_RHOS1       PPVQLLELEDRKGGGMEA-----EADLIAKAVA-------------PGAALVILD-ERGR
RLMH_RHOS5       PAVQLLEVEDRKGGGMEA-----EADLLARAMA-------------PGAVLAILD-ERGR
RLMH_PARDP       PPVTLAEVEDKRGGGMVA-----EAALLARAIP-------------QGAALVVLD-ERGQ
RLMH_MARMM       GPFAESEIDTRSLKSSSD-----ESRALAAGLD-------------PGARIVLLD-ERGK
RLMH_MAGSA       PPPVLKEVEEKRPLAGPQLKAREAELLLATLPE--------------GAKVVALD-EKGR
RLMH_RHOCS       WPLTLKEVEARKRVAGEELKRLEADLLLAAVPP--------------GAILVALD-ERGQ
RLMH_PARL1       SALPVCEVEEKRRLQGSELMEREAELLLAAIPK--------------GALIIALD-ERGR
RLMH_RHORT       GGLAVIEVEERRPLPVAERKAREAELLLAQLPP--------------GAFVVALD-EHGE
RLMH_NOVAD       WGWKVTELPDRGGTVPPP----------SHTP----------------SRTVAMD-ERGR
RLMH_SPHWW       WPTRITELPDSGGRLPP-----------RDPG----------------TVLVMLD-EKGE
RLMH_SPHAL       WAQKISELPDTGGRVPA-----------AAAG----------------SRTILLD-EGGE
RLMH_ERYLH       WPVKLTELPETGGRIPD-----------PQTP----------------FKTVLLD-ERGK
RLMH_ZYMMO       WPYRITELPDRASNAPLP----------PAPPH---------------SITVAMD-EKGK
RLMH_KORVE       EIGSEEALLKLKDRPGRT-----------------------------APVLVLMD-ERGK
RLMH_DEIGD       RVGGRT--------------GAQASEAIARAAG--------------RAPLILLD-PRGE
RLMH_DEIRA       RVSGKT--------------QQAESEAILKAAG--------------KSPLILLD-PRGK
RLMH_THET2       FVRKG--------------------EELLPKAE--------------GHRKVVLD-ERGR
RLMH_THET8       FVRKG--------------------EELLPKAE--------------GHRKVVLD-ERGR
RLMH_AKKM8       LVRDGS--------------SQDVSKRLLAASE--------------GCLRIAMD-ERGE
RLMH_RUBXD       EVAEADMN----RLGRGEALREEAGRLLRRLPA--------------DAHVVALDRKTGR
RLMH_SORC5       EIQDGP--------------PAKVGPLLARASA--------------GASVIAME-VGGK
RLMH_ANADE       EVPEAR-KLAGTPGAKGE----EGAALLAKLGP--------------RERVVVLD-ERGD
RLMH_ANASK       EVPEAR-KLAGTAGAKGE----EGATLLAKIGP--------------RERVVVLD-ERGD
RLMH_ANADF       EVPEAR-KHAGTAQARDE----EAEALLAKLGP--------------RERVIALD-ERGA
RLMH_MYXXD       EMAEASGKRLKPGDAKAA----EAEAILSKRKP--------------QDWLVALD-ERGS
RLMH_GLOVI       EVRDAR--IADSRAGLLK----EGQALLDQLHP--------------GEHAVLLD-SGGK
RLMH_PROMA       DGDIKKESRAIISSIKKDE------------------------------LLIALC-EEGE
RLMH_PROM4       DSDLKKEAQSIRSSIKTNE------------------------------LLIILT-EEGE
RLMH_PROMM       DASMPREAEAIRAALNSNE------------------------------VLVPLS-EEGE
RLMH_PROM3       DASLPREAEAILAALNSNE------------------------------VLVPLS-EEGE
RLMH_SYNS3       DSNPEKEAESIRQTLRRDE------------------------------WPVMLM-EQGE
RLMH_SYNPW       DSSREKEAEAIRAALRSDE------------------------------LPVMLM-EQGT
RLMH_SYNSC       DSNPDKEADAIRAALRPDE------------------------------TLIALM-EQGD
RLMH_SYNS9       DSSPEKEADSIRAALRPDE------------------------------TLIALM-EQGE
RLMH_SYNPX       DSTPDKEADSIRASLRPNE------------------------------HVIALM-EEGD
RLMH_PROM1       DSTQLKEEHTIKEIISKNE------------------------------FLVTLN-ENGQ
RLMH_PROMT       DSTQLKEEHTIKEIISKNE------------------------------FLVTLN-ENGQ
RLMH_SYNR3       DSTPAKEAEAIRAARKPAE------------------------------RLVLLS-EEGR
RLMH_PROMS       -------TFNLDNLRSNNN------------------------------IIICLS-EEGK
RLMH_PROM0       -------TFNLNNLRSNNN------------------------------IIICLS-EEGK
RLMH_PROM9       -------TFNLNNLRSNNN------------------------------IIICLS-EEGK
RLMH_PROM2       -------TFNLNNLRSNNN------------------------------IIIVLS-EEGK
RLMH_PROMP       -------SFNIDNIRVNN-------------------------------IIICLT-EEGQ
RLMH_PROM5       -------SFNIDNIRVNN-------------------------------IIICLT-EEGK
RLMH_CAMC1       IIFNEKIARAQSSG-RSDALRAYDEIYEPNLK----------------GFCVMLD-ENGS
RLMH_CAMC5       IIFNDKIAKAQSIG-KDEALKAYDEAYEPNLK----------------GFCVMLD-ERGS
RLMH_CAMFF       NKFNSQIAKAQSAS-KEQAHKAYDLAYEHCLN----------------GYCIGLD-EKGY
RLMH_CAMHC       VFFNQKIAKAQSIG-KDEALKSYDEVYFAHKK----------------GYLIALD-ERGE
RLMH_CAMJE       NVFNKKIALAQNLN-AIEAKKSYEEAFMPYKK----------------GYCIALD-EKGK
RLMH_CAMJR       NVFNKKIALAQNLN-AIEAKKSYEEAFMPYKK----------------GYCIALD-EKGK
RLMH_CAMJJ       NVFNKKIALAQNLN-AIEAKKSYEEAFMPYKK----------------GYCIALD-EKGK
RLMH_CAMJ8       NVFNKKIALAQNLN-AIEAKKSYEEAFMPYKK----------------GYCIALD-EKGK
RLMH_CAMJD       NVFNKKIALAQNLN-AIEAKKSYEEAFMPYKK----------------GYCIALD-ERGK
RLMH_HELPS       DLFPKNTANAQKVS-KELAQKSYSLAFEPYLN--------------PKAKNIALH-PKAQ
RLMH_HELPG       DLFPKNTANAQKVS-KELAQKSYSLAFEPYLN--------------PKAKNIALH-PKAQ
RLMH_HELPY       DLFPKNTANAQKVS-KKLAQKSYSLAFEPYLN--------------PKAKNIALH-PKAQ
RLMH_HELPH       DLFPKNTANAQKIS-KEFAQKSYSLAFEPYLN--------------PKAKNIALH-PKAQ
RLMH_HELP2       DLFPKNTANAQKVS-KELAQKSYSLAFEPYLN--------------LKAKNIALH-PKAQ
RLMH_HELPJ       DLFPKNTANAQKVS-KELAQKSYSLAFEPYLS--------------PKAKNIALH-PEAQ
RLMH_HELAH       DLFPKNIANAQKIS-KELAQKSYSLAFEPYLN--------------PKAINIALH-PKAE
RLMH_HELHP       NLLPQAVLKAQKIS-SAKAQQSYTQTFLPYIAL-------------PTALNLILH-PTGH
RLMH_SULDN       ELFNKDVTKAHTIS-PEASREAYSKLFAPH-V--------------VKSFNVILH-PDGK
RLMH_ARCB4       YIFNKNIAKAQTIG-EKESQLAYSQTYEP--L--------------LKGYNIALD-VLGK
RLMH_SULNB       ELFDKEIAKAQDIS-PEAAQRSYSKALEKY-L--------------GSGINIALD-PASK
RLMH_NITSB       NVFNKKINAAQSDA-QKA-MKAYSDTFKPFIL--------------SDGFNIALD-PEGK
RLMH_WOLSU       DIFNKQIAQAQKAANEAESSLAYKEALQRY-L--------------SGAHNIALT-PEGK
RLMH_FERNB       FVELGGDLNTE----DEKTILKKEAEHIKKRLK-------------DR-KFILLD-LWGK
RLMH_THEM4       FVRLGGDINKT----SKSVILNNEEKEILNKLK-------------GR-SFVLLD-LYGK
RLMH_PSELT       QIKHAKGYKDF----DKS--LKKEAEGIISQLK-------------ESDYVILLD-QSGR
RLMH_DICT6       FLPSFSELSEK----IALLKEEE--IILKNLRN-------------GE-FIITLD-KDGE
RLMH_PETMO       QLPLSGDLNKT----PPSIYKDKDFKKFEKYFP-------------DS-FNVLLD-ERGE
RLMH_THEP1       EIKRVHRGSIE----EIVR---KETEDLANRIL-------------LGSFVMVMD-RRGE
RLMH_THESQ       EIKRVHRGSIE----EIVR---KETEDLANRIL-------------LGSFVMVMD-RRGE
RLMH_THEMA       EIKRVHRGSIE----EIVR---KETEDLTNRIL-------------PGSFVMVMD-KRGE
RLMH_THEYD       ELKEGH-GDKE----KVTE---EESKTILNS-L-------------KGDFILLH--RDGK
RLMH_FUSNN       ELKE--YNKED---NINISIEKESLEILKQISK-------------SNSYNILLD-LEGK
RLMH_MYCPE       ELSEEKINNENSIGEIEEALKKESKKLIPYL---------------ENSFNVLLD-IKGV
RLMH_MYCCT       ELKEE-INGEL----NKIKDENSNLLLKKLENY-------------KDFEKIILD-VNSK
RLMH_MYCMS       ELKEE-VNGEL----NKIKDENSNLLLKKLQNY-------------KDFEKVVLD-VNSR
RLMH_MESFL       ELKEE-YQKED----VVNKNINSDLLIDKLKAF-------------SDHEIICMD-VSSK
RLMH_MYCH2       NLSEHSQ-ENI-----ELKKMLETKDILQKIP--------------KNSSCYLFT-ERGK
RLMH_MYCHJ       NLSEHSQ-ENI-----ELKKMLETKDILQKIP--------------KNSSCYLFT-ERGK
RLMH_MYCH7       NLSEHSQ-ENI-----ELKKMLETKDILQKIP--------------KNSSCYLFT-ERGK
RLMH_MYCMO       EIKEINE-KNI-----DLKKQKETELIIEKIP--------------KNSKVYLCS-LQGQ
RLMH_MYCA5       EIKEVTE-PNI-----ELKIKKETKLILEKIP--------------KNSKVFYMS-LTGK
RLMH_MYCS5       EIKENTL-KNL-----EVKKEKETLEILSKIP--------------KNSTVFLLS-IKGK
RLMH_MYCPU       KIKEFKS-NNK-----DLIIKNETMAILEKIP--------------KNSKVFLCS-LNAE
RLMH_MYCAP       ELKEFSEEKNI-----EVKKEKETKLILDALM--------------PNSKVILLS-LKGK
RLMH2_THEP3      NYKNPQQ--------------------LPKQQI-------------DKYYKIGIL-PSGK
RLMH1_THEPX      NYKNPQQ--------------------LPKQQI-------------DKYYKIGIL-PSGK
RLMH1_CALS4      ICKNSKK--------------------LPVKDL-------------EKSYKILIT-PQGK
RLMH_PARUW       WAKDSYQ--------------------LLEWTQ-------------KESLIICLD-PTGR
                                                                           . 

RLMH_UREPA       I-ISSETLAKKIQQWLNTFS-HDICFIIGGSNGLHESIYERAN---YHLSMSKMTFAHGL
RLMH_UREP2       I-ISSETLAKKIQQWLNTFS-HDICFIIGGSNGLHESIYERAN---YHLSMSKMTFAHGL
RLMH_UREU1       I-ISSEMLAENLQNWLNASY-PNICFVIGGSNGLHEKIYERAN---YHLSLSKMTFAHGL
RLMH_ACHLI       M-LDSVEFADTLDHVTTNFG-PSITFIIGGSFGLSHAVKEKSN---LLLSFSKMTFPHQL
RLMH_LACLM       L-MSSEELADFVKKAEVYGT-GNLVFVIGGSLGLSEEVYKRSD---LQISFGRMTLPHQL
RLMH_LACLS       L-MSSEELADFVKKAEVYGT-GNLVFVIGGSLGLSDEVYKRSD---LQISFGRMTLPHQL
RLMH_LACLA       L-MSSEEVADFVKKAEVYGT-GNLVFVIGGSLGLSKEVYQRSD---LQISFGRMTLPHQL
RLMH_LEUMM       Q-FPSEEFSQKLEAIAVNGY-SDITFIIGGSLGLSKAIKQRAN---LKMSFGLLTLPHQL
RLMH_LEUCK       Q-LPSETFSKKMSDITLSGY-STITFIIGGSLGLDERIKQRAD---MAISFGLLTLPHQL
RLMH_STRGC       Q-FPSEKFSKVIEDASVRGF-SDITFIIGGSLGLSAKVKERAN---LLMSFGQLTLPHQL
RLMH_STRSV       Q-FPSEKFSQLMMDTTVHGF-SDITFVIGGSLGLYPAVKKRAN---LLMSFGKLTLPHQL
RLMH_STRSY       Q-FPSEEFSQRISDIAVNGY-SDITFIIGGSLGLDSCIKKRAN---LLMSFGQLTLPHQL
RLMH_STRPC       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STRPZ       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STRPM       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STRPF       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STRP6       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STRP1       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STRPB       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STRP8       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAD---MLMSFGLLTLPHQL
RLMH_STRPG       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAD---MLMSFGLLTLPHQL
RLMH_STRP3       Q-FPSETFSELISGVTVKGY-STITFIIGGSLGLDSIIKKRAN---MLMSFGLLTLPHQL
RLMH_STREM       Q-LASEQFSHLLSEVTVKGY-SDIAFVIGGSLGLDQSIKNRAN---LLMSFGLLTLPHQL
RLMH_STRA1       Q-LPSESFSHLIDQKMISGY-STITFVIGGSLGLSQKVKKRAD---YLMSFGLLTLPHQL
RLMH_STRA3       Q-LPSESFSHLIDQKMISGY-STITFVIGGSLGLSQKVKKRAD---YLMSFGLLTLPHQL
RLMH_STRA5       Q-LPSESFSHLIDQKMISGY-STITFVIGGSLGLSQKVKKRAD---YLMSFGLLTLPHQL
RLMH_STRT2       Q-FPSEQFAKELEQATLRGY-SDITFIIGGSLGLSPKVKKRAN---QLMSFGLLTFPHQL
RLMH_STRT1       Q-FPSEQFAKELEQATLRGY-SDITFIIGGSLGLSPKVKKRAN---QLMSFGLLTFPHQL
RLMH_STRTD       Q-FPSEQFAKELEQATLRGY-SDITFIIGGSLGLSPKVKKRAN---QLMSFGLLTFPHQL
RLMH_STRMU       Q-FSSEKFSQLLSATMLKGY-SDLTFVIGGSLGLSQEVKKRAS---ILMSFGLLTLPHQL
RLMH_STRP4       T-FFSEEFSKQLEETSIKGF-STLTFIIGGSLGLSSSVKNRAN---LSVSFGRLTLPHQL
RLMH_STRPS       T-FFSEEFSKQLEETSIKGF-STLTFIIGGSLGLSSSVKNRAN---LSVSFGRLTLPHQL
RLMH_STRPN       T-FFSEEFSKQLEETSIKGF-STLTFIIGGSLGLSSSVKNRAN---LSVSFGRLTLPHQL
RLMH_STRR6       T-FFSEEFSKQLEETSIKGF-STLTFIIGGSLGLSSSVKNRAN---LSVSFGRLTLPHQL
RLMH_STRP2       T-FFSEEFSKQLEETSIKGF-STLTFIIGGSLGLSSSVKNRAN---LSVSFGRLTLPHQL
RLMH_OENOB       L-ITSPDLADMIREIPLDGY-STIDFVIGGSLGLSNEIKNRAN---AKISFGRITLPHQL
RLMH2_THEPX      E-IDSYKFSQFIKATFQSGY-REMTFVIGGSLGLWENIKKQSH---LNLSFSKMTFPHQL
RLMH1_THEP3      E-IDSYKFSQFIKATFQSGY-REMTFVIGGSLGLWENIKKQSH---LNLSFSKMTFPHQL
RLMH2_CALS4      E-VSTEEFASLVKKAFGMGY-KKVVFVIGGSLGIWGKVKERAD---VNISFSKMTFPHQL
RLMH_ALKMQ       M-LSSEALSEKIDKLALQGN-SHITFVIGGSLGLSQGVLKRAD---FKLCFSPMTFPHQL
RLMH_ALKOO       M-LSSEELADKLQSLGVAGN-SNIAFIIGGSLGLSEDVLKRAD---YKLCFSPMTFPHQL
RLMH_LACP7       M-LSSEELADKMQLLGVNGE-SHLAFVIGGSLGLDSEVLDRAD---FKLSFSKMTFPHQV
RLMH_CLOPE       E-ITSEKFSKYIENCGVMGN-SNITFVIGGSLGLSQEVIKRAD---YKLCFSKMTFPHQL
RLMH_CLOP1       E-ITSEKFSKYIENCGVMGN-SNITFVIGGSLGLSQEVIKRAD---YKLCFSKMTFPHQL
RLMH1_CLOPS      E-ITSEKFSKYIENCGVMGN-SNITFVIGGSLGLSQEVIKRAD---YKLCFSKMTFPHQL
RLMH_CLOTE       E-LTSIDFSNFINDLGIKGE-SNLTFVIGGSLGLSSKVLSRSN---YKLCFSKMTFPHQL
RLMH_CLOBA       M-ISSEELSKFIDNCGVRGN-SNLCFIIGGSLGLSEAVLKRSN---YSLCFSKMTFPHQL
RLMH_CLOBB       M-MSSEELSKFIDNCGVRGN-SNLCFVIGGSLGLSEAVLKRSN---HSLCFSKMTFPHQL
RLMH_CLOB8       Q-LTSEEFAGYIDNLGVTGN-PNIAFIIGGSLGISKSVLARAN---YKLCFSKMTFPHQL
RLMH_CLOK5       M-MGSEEFSKFVGNLGLSGK-SNIAFIIGGSLGISSEILKRAD---YKLCFSKMTFPHQL
RLMH_CLOAB       M-FSSEEFSAFIDDLGVRGN-SSIDFVIGGSLGLSDAVLARAN---YKLCFSKMTFPHQL
RLMH_CLOB1       S-ITSEEFSDLIENCRLTGN-STIAFVIGGSLGLSQQVLSRAN---YKLSFSKMTFPHQL
RLMH_CLOBH       S-ITSEEFSDLIENCRLTGN-STIAFVIGGSLGLSQQVLSRAN---YKLSFSKMTFPHQL
RLMH_CLOBL       S-ITSEEFSGLIENCRLTGN-STIAFVIGGSLGLSEQVLSRAN---YKLSFSKMTFPHQL
RLMH_CLOBK       A-ITSEEFSDLIENCRLTGN-STIAFVIGGSLGLSEQVLSRAN---YKLSFSKMTFPHQL
RLMH_CLOBM       S-IASEEFSDLIENCRLTGN-STIAFVIGGSLGLSQQVLSRAN---YKLSFSKMTFPHQL
RLMH_CLONN       M-ASSEELAELIGDLGLKGK-SNIALVIGGSLGLSKEVLNRAN---YKLSFSKMTFPHQL
RLMH_BIFLO       Q-LSSEELAAKINDLGLRGT-SHIQLVIGGSIGLDDAILRRAD---FLLSFSKMTFPHQL
RLMH_BIFLD       Q-LSSEELAAKINDLGLRGT-SHIQLVIGGSIGLDDAILRRAD---FLLSFSKMTFPHQL
RLMH_BIFAA       Q-LTSEQLAAKINDLGLHGT-SHIQLIIGGSLGLDPAILKRAD---YLLSFSKMTFPHQL
RLMH_CLOD6       G-LSSEELAKTMSDLAVRGN-SSLCFIIGGSLGLSDEVLGRAD---YRLSFSRMTFPHQM
RLMH_FINM2       Q-LTSEKLAAKIENLTIQGH-SNICFVIGGSLGLGKSVLDRSD---YALSFSKFTFPHQL
RLMH_METM5       E-VTSESLAKKINDLSISGK-SDITFIIGGSLGLSKNISEISD---FKLSFSKMTFPHQL
RLMH_METM7       E-LTSESLAKKINDLSISGK-SDITFIIGGSLGLSKNISEISD---FKLSFSKMTFPHQL
RLMH_METM6       E-LTSESLAKKINDLSISGK-SDITFIIGGSLGLSRNISEISD---FKLSFSKMTFPHQL
RLMH_METMP       E-LTSEDLAKKINDLSISGK-SDITFVIGGSLGLSKNISEISD---FKLSFSKMTFPHQL
RLMH_METVS       E-LDSKELAKNINDLSISGK-KNIVFVIGGSLGLSQKVSEKSN---FKLSFSKMTFPHQL
RLMH_BACVZ       M-KTSEELADTIDKLATYGK-SKITFVIGGSLGLSDAVMKRAD---EKLSFSKMTFPHQL
RLMH_BACSU       M-KTSEELADTIDKLATYGK-SKVTFVIGGSLGLSDTVMKRAD---EKLSFSKMTFPHQL
RLMH_BACLD       M-KSSEELADNMDRLATYGK-SKATFVIGGSLGLSDAVLKRAD---EKLSFSRMTFPHQL
RLMH_BACP2       M-KTSEELADTIDKLATYGK-SKVCFVIGGSLGLSDAVMQRAN---EKLSFSRMTFPHQL
RLMH_BACHD       M-KSSEELADTMDRLATYGK-SKVAFVIGGSLGLSDAVLKRAD---EKLSFSKMTFPHRL
RLMH_BACCZ       Q-KSSEEFAVSLDRLATYGK-SKVAFVIGGSLGLSSEVMKRSN---ESLSFSKMTLPHQL
RLMH_BACAH       Q-KSSEEFAVSLDRLATYGK-SKVAFVIGGSLGLSSEVMKRSN---ESLSFSKMTLPHQL
RLMH_BACAN       Q-KSSEEFAVSLDRLATYGK-SKVAFVIGGSLGLSSEVMKRSN---ESLSFSKMTLPHQL
RLMH_BACHK       Q-KSSEEFAVSLDRLATYGK-SKVAFVIGGSLGLSSEVMKRSN---ESLSFSKMTLPHQL
RLMH_BACCR       Q-KSSEEFAISLDRLATYGK-SKVAFVIGGSLGLSSEVMKRSN---ESLSFSKMTLPHQL
RLMH_BACC1       Q-KSSEEFAVSLDRLATYGK-SKVAFVIGGSLGLSSEVIKRSN---ESLSFSKMTLPHQL
RLMH_BACMK       Q-KSSEEFAVSIDRLATYGK-SKITFVIGGSLGLSSEVMKRSN---ESLSFSKMTLPHQL
RLMH_BACCN       Q-KSSEQFAESLDCLATYGK-SKIAFVIGGSLGLSTEVMKRSN---ESLSFSKMTLPHQL
RLMH_LISMO       M-KSSEEFAADLDKLATYGK-SKVTFVIGGSLGLSEAVLKRSN---ERISFGRLTLPHQL
RLMH_LISMF       M-KSSEEFAADLDKLATYGK-SKVTFVIGGSLGLSEAVLKRSN---ERISFGRLTLPHQL
RLMH_LISIN       M-KSSEEFAADLDKLATYGK-SKVAFVIGGSLGLSEAVLKRSN---EQISFGRLTLPHQL
RLMH_LISW6       M-KSSEEFAADLDKLATYGK-SKVAFVIGGSLGLSESVLKRSD---EQISFGRLTLPHQL
RLMH_BACSK       M-KTSEQLAKNIEQLGTYGK-SKIAFIIGGSLGLSNDVYARAD---ELLSFSKMTFPHQL
RLMH_LYSSC       M-KTSEQMAADLESLMTYGK-SKIAFVIGGSLGLHEDVLKRAD---EQQSFGKMTLPHQL
RLMH_OCEIH       M-LGSEQLAKKLDELATYGK-SKVVFVIGGSLGISQDVQRRSD---LALSFSKMTFPHQL
RLMH_GEOKA       M-QSSEQFAARLDELATYGK-SKVVFVIGGSLGLSKQVMARAD---ETLSFSKMTFPHQL
RLMH_GEOTN       M-KSSEQFAARLDELATYGK-SKVVFVIGGSLGLSKQVMARAD---EALSFSKMTFPHQL
RLMH_EXIS2       Q-RTSEQFATELDRLATYGK-SKIAFVIGGSLGLAPEVMQRAN---DTISFSKMTFPHQL
RLMH_LACAC       Q-RSSEEFAKEIQDLGTYGH-SDITFVIGGSLGTSDAVNKRAD---DLISFGKLTMPHQL
RLMH_LACH4       Q-RSSEEFAKEIQNLATYGH-SDITFVIGGSLGTSNAVNKRGD---DLISFGKLTMPHQL
RLMH_LACGA       E-RTSEDFAKELADLTTYGH-SDITFVIGGSLGTSNAVNKRAD---DLISFGKFTMPHQL
RLMH_LACJO       E-RTSEAFAKELSDLTTYGH-SDITFVIGGSLGTSDAVNKRAD---DLISFGKFTMPHQL
RLMH_LACDA       E-RASEEFAKELKNLGTYGH-SDITFVIGGSLGTSDAVNKRAN---DLFSFGKLTMPHQL
RLMH_LACDB       E-RASEEFAKELKNLGTYGH-SDITFVIGGSLGTSDAVNKRAN---DLFSFGKLTMPHQL
RLMH_LACP3       Q-RPSEVFAKEIADLGTYGH-SDITFVIGGSLGLSPAVMKRAN---DTLSFGKLTMPHQL
RLMH_LACCB       Q-RPSEVFAKEIADLGTYGY-SDITFVIGGSLGLSPAVMKRAN---DTLSFGKLTMPHQL
RLMH_LACSS       Q-RASEEFAKEIQDLATYGT-SDITFIIGGSLGTSDAVNKRAN---DALSFGKLTLPHQL
RLMH_LACBA       E-RSSEAFAKEIKDLTTYGH-SDITFVIGGSLGLTPAVLKRAD---TQISFGKFTLPHQL
RLMH_LACPL       E-RSSEEFAAEIDKLTTYGH-SDIDFVIGGSLGLSPEVLKRAD---TQISFGRFTLPHQL
RLMH_LACRD       E-RSSEEFAKEINKLTTYGH-SDITFVIGGSLGLSPAVLKRAD---AQISFGRFTLPHQL
RLMH_LACRJ       E-RSSEEFAKEINKLTTYGH-SDITFVIGGSLGLSPAVLKRAD---AQISFGRFTLPHQL
RLMH_LACF3       E-RSSEEFAKEINQLATYGH-SDITFVIGGSLGLSPAVLKRAN---TQISFGRFTLPHKL
RLMH_LACS1       E-RSSEEFAKELEDLGTYGT-SDITFVIGGSLGLSPEVLKRAN---TKISFGRFTLPHQL
RLMH_PEDPA       E-RSSEELSAEMAKLATYGN-SDITFVIGGSLGLSDAVMKRSN---SAISFGRFTLPHQL
RLMH_ENTFA       Q-LSSEEFSKEIEQLGISGK-SNLTFVIGGSLGLSDSVLQRSN---QQISFGRLTYPHQL
RLMH_STAA1       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAM       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAN       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAA8       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAE       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAT       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAA3       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAU       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAB       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAA2       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAA9       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAR       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAS       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAAW       M-LSSEGLAQELNQRMTQGQ-SDFVFVIGGSNGLHKDVLQRSN---YALSFSKMTFPHQM
RLMH_STAHJ       M-LSSEGLAEEMQRRMTQGQ-SDFVFVIGGSNGLHENVLQRSN---YALSFSKMTFPHQM
RLMH_STAHO       M-LSSEGLAKELQQRMTQGQ-SDFVFVIGGSNGLHQDVLNRSN---YALSFSKMTFPHQM
RLMH_STAES       M-LSSEGLAKELQTRMTQGQ-SDFTFVIGGSNGLHQDVLQRSN---YALSFSNMTFPHQM
RLMH_STAEQ       M-LSSEGLAKELQTRMTQGQ-SDFTFVIGGSNGLHQDVLQRSN---YALSFSNMTFPHQM
RLMH_STAS1       M-LTSEGLAKEIESRMTRGQ-SDFTFIIGGSNGLHKDVLDRSD---YALSFSKMTFPHQM
RLMH_CARHZ       N-LSSEEFAHFISEKNLYGQ-SKLTFIIGGSLGLSREVLERAD---FKLSFGRMTYPHQL
RLMH_HUNT2       K-MSSEELARKLESFFISGK-SHVTFVIGGSLGIDKELLNMAD---FSLSLSDMTFPHQL
RLMH_PELTS       M-HSSEEMAEILNRLALSGR-SDITFAIGGALGLSEKVLERAA---MRLSFSRMTFPHQL
RLMH_DESRM       M-LSSEDMAGKIQDLALSGK-SDLTFIIGGSIGLAPSLVERAN---LLLALSNLTFPHQL
RLMH_SYMTH       N-FSSEELAAFLAERALHGD-ANLAFVIGGSLGLDPAVLARAG---TTLSLGRMTFLHQM
RLMH_DESTE       M-LSSKEFAGYLAELGLRGQ-NKLCFIIGGSAGLAGDVLARAS---LRLSFSKFTFPHQL
RLMH_MOOTA       M-LSSEELAGRLADLALAGK-NEVALIIGGTLGLATFILQQAD---LRLSFSRFTFPHQL
RLMH_DESHY       E-FTSPDFSEYMDDLALMGK-SSVTFIIGGSLGVSGEVRKRAD---YRWSFSRLTFPHPL
RLMH_NATTJ       Q-FTSENFAQQIENLTLEGI-NQFTFIIGGTLGLSNSLKKEAN---MLLSFSKFTFPHQL
RLMH_HELMI       M-WSTEDLADKMRRWELYGP-NLVVFFIGGTLGLSKEVHAVCK---AKWSLSRLTFPHQL
RLMH_METLZ       S-LSSEEFSDVFRDAKLSGK-N-LCFIIGGPLGLSPKLLQSVE---KKLSLSRMTFTHPM
RLMH_METB6       E-ISSIELAARMHDWQLAGT-NTIAFVIGGDLGLSDAVINRAA---FRLSLSPLTFTHPM
RLMH_DESPS       N-LSSEGLAEQVINWENTGT-RSVCYLIGGPLGLSPSLLARAD---LRLSFSKMTFTHDM
RLMH_BACFR       E-MRSVEFARWMEKKLVNVN-KRLVFIIGGPYGFSQKVYDAAH---EKISMSKMTFSHQM
RLMH_BACFN       E-MRSVEFARWMEKKLVNVN-KRLVFIIGGPYGFSQKVYDAAH---EKISMSKMTFSHQM
RLMH_BACTN       E-MRSLEFADYMKRKMNTVN-KRLVFVIGGPYGFSEKVYQVAN---EKISMSKMTFSHQM
RLMH_BACV8       E-FRSVEFANWIERKMHTVN-KRLVFIIGGPYGFAPKIYDAAQ---EKISLSKMTFSHQM
RLMH_PARD8       E-FTSMQFSTYLEKKMHTVP-KRLVFVVGGPYGFSEAVYKAAS---EKISLSKMTFSHQM
RLMH_FLAJ1       T-FSSVGFSEELQKKMNSGV-KTLVFVIGGPYGFSETIYKKAQ---GKVSLSLMTFSHQM
RLMH_FLAPJ       T-FSSVAFSDQLQKKMNSGI-KTLVFVIGGPYGFSDDVYKKTF---GKISLSQMTFSHQM
RLMH_GRAFK       Q-FSSESFSEYIQKRMNTGL-KRLIFVIGGPYGFSEEVYKRAD---SKISLSKMTFSHQM
RLMH_PORGI       E-YSSMEFSAFLQKKMLIGT-RRMVFVIGGPYGFSPAVQEAVT---DRISLSRMTFSHQM
RLMH_PORG3       E-YSSMEFSAFLQKKMLTGT-RRMVFVIGGPYGFSPAVQEAVA---DRISLSRMTFSHQM
RLMH_CYTH3       E-FTSTEFGQYIQKKMNSVA-GNLIFLIGGPYGFSDAVYKRAN---GKIALSKMTFSHQM
RLMH_BDEBA       V-LDSIQFSKKVENILGSSK-KRAIFIIGGAFGVNEEVRKRAD---LKVALSPMVMNHLM
RLMH_PELCD       S-VSSEKLAALLERHMMEST-PELTLIIGGAYGLCDEVKQRAD---MLMSLSEMTLTHQM
RLMH_GEOMG       Q-LTSPELAAFMGKCRDSAV-PEMVFAIGGAYGFADSFRARAD---RVLALSRLTFTHQM
RLMH_GEOSL       Q-LTSPEFAAYISRCRDTAV-PELAFAIGGAYGFADEFRRRAD---RVIALSRMTFTHQM
RLMH_GEOUR       Q-LSSPDLAGFIAANRDGGV-QELAFAIGGAYGFSDSFRSMAY---KTIALSRMTFTHQM
RLMH_GEOBB       A-MTSPELASFLSKNRDQGT-QDLVFAIGGAYGFTDQFRSQAF---KSISLSRMTLTHQM
RLMH_PELPD       Q-MDSPGLAAYIGKQRDSGT-ADLVLVIGGAYGFSDAFRRRG----RLLSLSPMTFTHQM
RLMH_GEOLS       Q-LDSVKFAEFIGKHRDSGT-TELVFAIGGSYGFSDEVRSRAG---KVLALSAMTFTHQM
RLMH_DESVH       N-MTSRDFAGFIERLTENAT-RTPCFVIGGAFGLDKSVLQRAE---HKLALGPMTFPHEM
RLMH_DESVV       N-MTSRDFAGFIERLTENAT-RTPCFVIGGAFGLDKSVLQRAE---HKLALGPMTFPHEM
RLMH_DESAG       Q-FTSQQFSAFLTPMWENAN-LRPCFIIGGAYGLSDEVRGKAR---HTMALSAMTFPHEM
RLMH_LAWIP       S-ISSQEFANFLRNYFENTT-KRPCFIIGGAFGLDSSVCNIAN---DCLSLGNITFPHEL
RLMH_METHJ       Q-VSSEGLAEVIRRCEIEGP-YQLVFIIGGPHGLSKDCLQKGN---IILSLSAMTFPHQI
RLMH_METTP       S-MSSQELALWLQNRIVEGC-GSINWIIGGPEGLSQDVLNRSD---LQLSLSKMTFPYQM
RLMH_SYNFM       H-LDSLEFARVLERLSNGGT-GAVWMIIGGPLGISRELRDRAN---LVLALSEMTFPHDL
RLMH_COPPD       L-MTSEEFASFIEDLLTTQS-NDVYFYIGGPEGFSEAFKNNAQ---MRISLSLMTFPHEL
RLMH_SYNWW       V-RSSEEMARQLEKWNASGK-SRVTFLLGAAHGLANEIKQQAQ---ETISLSRLTFPHQM
RLMH_CALS8       Q-LSSEEFAELLDRKVSKGE-E-IVFVIGGSNGLADAIKKRAN---LLISFSKLTFPHQL
RLMH_SHIFL       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SHIF8       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOLI       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SHIBS       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SHIDS       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SHISS       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOL6       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOL5       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECO57       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOK1       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOUT       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECO24       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOHS       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOLC       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOSE       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SHIB3       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECODH       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECO5E       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ECOSM       P-WDTPQLAAELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_CITK8       P-WDTPQLATELERWKLDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALAR       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALPA       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALTY       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALPB       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALTI       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALHS       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALSV       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALNS       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALA4       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALEP       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALPK       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALDC       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALG2       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_SALCH       P-WDTPQLANELERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ENT38       P-WDTPQLAQELERWKLDG--RDVSLLIGGPEGLSSACKAAAE---QSWSLSALTLPHPL
RLMH_CROS8       P-WDTPQLARELERWKQDG--RDVSLLIGGPEGLSDACKAAAE---QSWSLSALTLPHPL
RLMH_KLEP7       P-WDTPQLARELERWKQDG--RDVSLLVGGPEGLSPACKAAAE---QSWSLSTLTLPHPL
RLMH_KLEP3       P-WDTPQLARELERWKQDG--RDVSLLVGGPEGLSPACKAAAE---QSWSLSTLTLPHPL
RLMH_PHOLL       R-WETPQLAQQLEHWKRDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_SODGM       R-WETPRLAQQLERWKQDG--RDVSFLIGGPEGLAPACKAGAE---QSWSLSPLTLPHPL
RLMH_PROMH       R-WDTPKLAEQLDRWKLDG--RNVSLLIGGPEGLAPACKAAAE---QSWSLSPLTMPHPL
RLMH_SERP5       P-WETPQLAQQLERWKQDG--RNVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_PECAS       R-WETPHLAQQLERWKQDG--RDVSLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_YERPE       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERPY       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERPA       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERPN       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERPP       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERPS       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERPG       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERPB       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERP3       P-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAPACKAAAE---QSWSLSPLTLPHPL
RLMH_YERE8       L-WETPQLAQQLERWKQDG--RDVSLLIGGPEGLAQACKAAAE---QSWSLSPLTLPHPL
RLMH_ERWT9       P-WETPQLASQLERWKQDG--RDVSLLIGGPEGLSPACKAAAE---QSWSLSALTLPHPL
RLMH_ACTP2       P-WTTEQLASQLEAWKNDG--RDVCLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPM
RLMH_ACTP7       P-WTTEQLASQLEAWKNDG--RDVCLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPM
RLMH_ACTPJ       P-WTTEQLASQLEAWKNDG--RDVCLLIGGPEGLSPECKAAAE---KSWSLSPLTLPHPM
RLMH_MANSM       P-WTTDQLARQLESWKNDG--RDICLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_HAEIN       P-WTTPQLAEQLEAWKNDG--RDVCLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_HAEIG       P-WTTPQLAEQLEAWKNDG--RDVCLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_HAEI8       P-WTTPQLAEQLEAWKNDG--CDVCLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_HAEIE       P-WTTPQLAEQLEAWKNDG--RDVCLLIGGPEGLSPECKAVAE---QSWSLSPLTLPHPL
RLMH_HAEDU       P-WTTEQLATQLESWKSDG--RDICLLIGGPEGLSTECKQAAE---QSWSLSPLTLPHPL
RLMH_ACTSZ       S-WTTHQLAQQLESWKNDG--RDVSLLIGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_HAES1       P-WTTEQLAQQLEAWKHDG--RNVALLIGGPEGLSPECKAATE---QSWSLSPLTLPHPL
RLMH_HISS2       P-WTTEQLAQQLEAWKHDG--RNVALLIGGPEGLSPECKAATE---QSWSLSPLTLPHPL
RLMH_PASMU       P-WTTEQLATQLEVWKNDG--RDLSLLIGGPEGLSAECKAAAE---QSWSLSPLTLPHPL
RLMH_AERHH       P-WTTEQLAVQLEAWKLDG--RDVALLVGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_AERS4       P-WTTEQLAVQLEAWKLDG--RDVALLVGGPEGLSPECKAAAE---QSWSLSPLTLPHPL
RLMH_ALIF1       R-WDTEQLAEQLEAWKLDA--RDVSILIGGPEGLAPACKAAAD---QSWSLSPLTLPHPL
RLMH_ALIFM       R-WDTEQLAEQLEAWKLDA--RDVSILIGGPEGLAPACKAAAD---QSWSLSPLTLPHPL
RLMH_ALISL       P-WNTEQLAEQLEVWKLDA--RDVSILIGGPEGLSPACKTAAE---QSWSLSPLTLPHPL
RLMH_PHOPR       R-WDTGQLAQQLDSWKLDG--RDVSILIGGPEGLSPACKAAAE---QSWSLSPLTLPHPL
RLMH_VIBCH       R-WDTEELAVQLESWKLDG--RDVSILIGGPEGLAPACKAAAD---QSWSLSPLTLPHPL
RLMH_VIBC3       R-WDTEELAVQLESWKLDG--RDVSILIGGPEGLAPACKAAAD---QSWSLSPLTLPHPL
RLMH_VIBCB       K-WDTPQLAEQLEAWKLDG--RDVSILIGGPEGLAPACKAAAD---QSWSLSALTLPHPL
RLMH_VIBPA       K-WDTPQLAEQLEAWKLDG--RDVSILIGGPEGLAPACKAAAD---QSWSLSALTLPHPL
RLMH_VIBVU       K-WDTPELAQQLEAWKLDG--RDVSILIGGPEGLAPACKAAAE---QSWSLSALTLPHPL
RLMH_VIBVY       K-WDTPELAQQLEAWKLDG--RDVSILIGGPEGLAPACKAAAE---QSWSLSALTLPHPL
RLMH_SHEB5       N-WTTPELATALTKWQLDG--RDVSLLIGGPEGLAPACKEAAN---QSWCLSALTLPHPL
RLMH_SHEB8       N-WTTPELATALTKWQLDG--RDVSLLIGGPEGLAPACKEAAN---QSWCLSALTLPHPL
RLMH_SHEB9       N-WTTPELATALTKWQLDG--RDVSLLIGGPEGLAPACKEAAN---QSWCLSALTLPHPL
RLMH_SHESA       N-WTTPELATAMNKWQLDG--RDVSLLVGGPEGLAPACKEAAH---QSWCLSALTLPHPL
RLMH_SHESM       N-WTTPELATAMNKWQLDG--RDVSLLVGGPEGLAPACKEAAH---QSWCLSALTLPHPL
RLMH_SHESR       N-WTTPELATAMNKWQLDG--RDVSLLVGGPEGLAPACKEAAH---QSWCLSALTLPHPL
RLMH_SHEON       N-WTTPELASAMNKWQLDG--RDVSLLVGGPEGLAPACKEAAH---QSWCLSALTLPHPL
RLMH_SHEPC       N-WTTPELATALSKWQLDG--RDVSLLVGGPEGLAPACKDAAH---QSWCLSALTLPHPL
RLMH_SHESW       N-WTTPELATALSKWQLDG--RDVSLLVGGPEGLAPACKDAAH---QSWCLSALTLPHPL
RLMH_SHEAM       N-WTTPELASALSKWQLDG--RDVSLLIGGPEGLAPACKQAAA---QSWCLSALTLPHPL
RLMH_SHEDO       N-WTTPELAEQLSKWQLDG--RDVSLLIGGPEGLSPACKEAAS---QSWCLSALTLPHPL
RLMH_SHEFN       N-WTTPELAEQMTKWQLDG--RDVSLLIGGPEGLSPACKEAAN---QSWCLSALTLPHPL
RLMH_SHESH       T-WTTPDLATQLGKWQLDG--RDVSLLIGGPEGLAPACKQAAS---QSWCLSALTLPHPL
RLMH_SHEWM       T-WTTPQLATQLSRWQLDG--RDVSLLIGGPEGLAPSCKQAAS---QSWCLSALTLPHPL
RLMH_SHELP       N-WTTPELATQLNRWQLDG--RDVSLLIGGPEGLAPACKQAAN---QSWCLSALTLPHPL
RLMH_SHEHH       N-LTTPQLAEQMNKWLLDG--RDVSLLIGGPEGLSPECKKAAA---QSWCLSALTLPHPL
RLMH_SHEPA       N-LTTPQLAEQMNKWLLDG--RDVSLLIGGPEGLSPECKKAAA---QSWCLSALTLPHPL
RLMH_PSEA6       P-WDTPMLASNMQKWQMDG--RDVSLLIGGPEGLAPECIAASE---QKWSLSPLTLPHPL
RLMH_PSEHT       P-LDTHELAKNMEKWQLDG--RDVSLLIGGPEGLAPECIAASE---QKWSLSNLTLPHPL
RLMH_PSYIN       A-WTTEQLADEMGKWQLDA--RNISLLIGGPEGLAPECITKSE---QRWSLSALTLPHPL
RLMH_COLP3       S-WTTPKLAKQLEQWQLDG--RDVALLVGGPEGLAPACIKASE---QKWSLSALTLPHPM
RLMH_IDILO       A-WDTPKLAQQLEKWQMDG--RDVTLLIGGPEGLSDECLAAAE---QRWSLSKLTLPHPV
RLMH_COXBN       E-VDTPTLAQKLSQWRHEN--RSISLLIGGPEGLSATCIDKAR---WVWSLSALTLPHAL
RLMH_COXB1       E-VDTPTLAQKLSQWRHEN--RSISLLIGGPEGLSATCIDKAR---WVWSLSALTLPHAL
RLMH_METCA       D-WSTRELAEVLARWLREG--RDIALLVGGPDGLSDACRQRAA---ESWSLSRMTFPHPL
RLMH_LEGPC       S-FSSEELALKLTQLQQIS--SHLCFIIGGPEGLSNEILSLCD---ERWSLSKLTLPHPL
RLMH_LEGPA       S-FSSEELALKLTQLQQIS--SHLCFIIGGPEGLSNEILTLCD---ERWSLSKLTLPHPL
RLMH_LEGPL       S-FSSEELALKLTQLQQIS--SHLCFIIGGPEGLSNEILTLCD---ERWSLSKLTLPHPL
RLMH_LEGPH       S-FSSEELALRLTQLQQIS--SHLCFIIGGPEGLSNEILTLCD---ERWSLSKLTLPHPL
RLMH_DICNV       N-YRSEQLAARLQFWQENA--RSLALIIGGPEGLSAEVKNRAQ---ESWSLGALTLPHPL
RLMH_XANAC       P-LSSEQLAQRMEHWRGQG--RDLAFLIGGPEGHAAEVLKSAS---ESWSIGPLTLPHML
RLMH_XANC5       P-LSSEQLAQRMEHWRGQG--RDLAFLIGGPEGHAAEVLKSAS---ESWSIGPLTLPHML
RLMH_XANOR       P-LSSEQLAQRMEHWRGQG--RDLALLIGGPEGHSAEVLKSAS---ESWSIGPLTLPHML
RLMH_XANOP       P-LSSEQLAQRMEHWRGQG--RDLALLIGGPEGHSAEVLKSAS---ESWSIGPLTLPHML
RLMH_XANOM       P-LSSEQLAQRMEHWRGQG--RDLALLIGGPEGHSAEVLKSAS---ESWSIGPLTLPHML
RLMH_XANCP       P-LSSEQLAQRMEHWRGQG--RDLAFLIGGPEGHAADVVKSAN---ESWSIGPLTLPHML
RLMH_XANC8       P-LSSEQLAQRMEHWRGQG--RDLAFLIGGPEGHAADVVKSAN---ESWSIGPLTLPHML
RLMH_XANCB       P-LSSEQLAQRMEHWRGQG--RDLAFLIGGPEGHAADVVKSAN---ESWSIGPLTLPHML
RLMH_STRMK       Q-LSSEQLAQRLEHWRGQG--RDLAFLIGGPEGHSPEVSALAD---EKWSIGPLTLPHML
RLMH_STRM5       Q-LSSEQLAQRLEHWRGQG--RDLAFLIGGPEGHSPEVSALAD---EKWSIGPLTLPHML
RLMH_XYLFT       P-LNSEQLAQRMEHWRGLG--RNLVFLIGGPEGHSQEVLNISN---ERWSLGPLTLPHML
RLMH_XYLF2       P-LNSEQLAQRMEHWRGLG--RNLVFLIGGPEGHSQEVLNISN---ERWSLGPLTLPHML
RLMH_XYLFM       P-LNSEQLAQRMEHWRGLG--RNLVFLIGGPEGHSQEVLNISN---ERWSLGPLTLPHML
RLMH_XYLFA       S-LNSEQLAKRMEHWRGLG--RNLVFLIGGPEGHSQEVLNISN---ERWSLGPLTLPHML
RLMH_PSEAE       P-WSTEQLARELDRWRLDA--RTVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSEA7       P-WSTEQLARELDRWRLDA--RTVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSEAB       L-WSTEQLARELDRWRLDA--RTVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSEMY       P-WSTEQLAAELERWRLDA--RNVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSEU5       P-WSTEQLAAELERWRLDA--RNVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSEP1       P-WSTEQLATELDRWRLDA--RTVNLMVGGPEGLAPEVCARAE---QRWSLSPLTLPHPL
RLMH_PSEPK       P-WSTEQLATELDRWRLDA--RTVNLMVGGPEGLAPEVCARAE---QRWSLSPLTLPHPL
RLMH_PSEPG       P-WSTEQLATELDRWRLDA--RTVNLMVGGPEGLAPEVCARAE---QRWSLSPLTLPHPL
RLMH_PSEPW       P-WSTEQLATELDRWRLDS--RTVNLMVGGPEGLAPEVCARAE---QRWSLSPLTLPHPL
RLMH_PSEE4       P-WSTEQLAGELDRWRLDA--RTVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSEU2       P-WSTEQLAVELDRWRLDA--RTVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSESM       P-WSTEQLAVELDRWRLDA--RTVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSE14       P-WSTEQLAVELDRWRLDA--RTVNLMVGGPEGLAPEVCARSE---QRWSLSPLTLPHPL
RLMH_PSEF5       P-WSTEQLAVELDRWRLDS--RTVNFMVGGPEGLAPEVCARAD---QRWSLSPLTLPHPL
RLMH_PSEPF       P-WSTEQLAVELDRWRLDS--RTVNFMVGGPEGLAPEVCARAD---QRWSLSPLTLPHPL
RLMH_CHRSD       H-WSTERLAANADHWRQDG--RDVALLVGGPDGLDPRLLSRVE---QRWSLSALTLPHPL
RLMH_HAHCH       S-WSTPQLSQQMERWRMSG--QDVALLVGGPDGLSDACRARAN---QQWSLSPLTLPHPL
RLMH_MARHV       P-WSTEKLASQLENWQQDG--RDVAFLVGGPDGLADACRQRAD---QQWSLSPLTLPHPL
RLMH_SACD2       S-FSTEVLSQKLADWQMDG--RNVNILIGGPDGLDSRCLAQAD---EKWSLSALTLPHPL
RLMH_CELJU       P-WSTEQLAEQLASWKMSG--SNFCLLIGGPDGLAPAALAQAT---IKWSLSPLTLPHPL
RLMH_MARMS       E-WSTDQLADQTEQWRMDG--YNVSLLVGGPDGLDPRCTARAD---QTWSLSRLTLPHPM
RLMH_ALCBS       A-LDTHALSRKLGELKDVG--QDLVLLVGGPDGLCPELSASAH---ERWSLSNLTLPHPL
RLMH_ALKEH       A-WDTPALARELDGWLHDG--RDLALLVGGPDGLHPDCLARAE---RRWSLSPLTFPHML
RLMH_ACIAC       S-LTTKALAARLKDWQLGG--DDVALVIGGPDGLDPAFRQAAH---ERIRLSDLTLPHAM
RLMH_ACISJ       G-LTTKALAQRLKDWQLGG--DDVALVIGGPDGLDPAFRQAAH---ERIRLSDLTLPHAM
RLMH_DELAS       N-LTTKALAQRLQGWQLEG--DDVALIIGGPDGLDPAFRQAAH---ERIRLSDLTLPHAM
RLMH_RHOFT       P-LTTLALAAKLQNWQLES--DDVALVIGGPDGLDPAFKQAAH---ERIRLSDLTLPHAM
RLMH_POLNA       A-VTTMALAEHLKNWQLSG--DDVAIVIGGPDGLDAGFKQSAH---QRIRLSDLTLPHAM
RLMH_POLSJ       A-VTTVALAEKLKAWQLSG--DDVAIVIGGPDGLDPAFKQSAH---ERLRLSDLTLPHAM
RLMH_VEREI       R-LTTLALAERLRGWQLVG--DTVALLVGGPDGLDPALRQAAH---ERIRLSDLTLPHAL
RLMH_METPP       R-LTTQQLAQRLQAWQLDG--RDVALLIGGPDGLADTLKDGAD---ETLRLSDLTLPHAF
RLMH_LEPCP       R-VTTAQLAERLAVWQRDG--RDVALLVGGPDGLDQTLRDGAD---EKLRLSDLTLPHAF
RLMH_AZOSB       D-RTTAALARRLEAWQGEG--EDVAFIVGGPDGLAPSLKASAA---ESLRLSSLTLPHAL
RLMH_AROAE       D-LTTMALARRLEAWQAGG--EDVTLIVGGPDGLSPALKATAH---ERLRLSSLTLPHAL
RLMH_BORBR       D-LTTVALSQQLEKWRAGG--RDVAFLVGGPDGLDAALKASCE---GLLRLSSLTLPHPM
RLMH_BORPE       D-LTTVALSQQLEKWRAGG--RDVAFLVGGPDGLDAALKASCE---GLLRLSSLTLPHPM
RLMH_BORPA       D-LTTVALSQQLEKWRAGG--RDVAFLVGGPDGLDAALKASCE---GLLRLSSLTLPHPM
RLMH_BORA1       D-LTTVGLSQQLEKWRGEG--RDVAFLVGGPDGLDAQLKASCG---GLIRLSSLTLPHPM
RLMH_BORPD       D-LTTMALSQRLEQWRAGG--RDVVFLVGGPDGLDDALKSACD---GQIRLSSLTLPHPM
RLMH_BURCA       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPDLKARAD---VLLRISSMTLPHGM
RLMH_BURCH       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPDLKARAD---VLLRISSMTLPHGM
RLMH_BURCC       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPDLKARAD---VLLRISSMTLPHGM
RLMH_BURCJ       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPELKARAD---VLLRISSMTLPHGM
RLMH_BURL3       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPELKARAD---TLLRISSMTLPHGM
RLMH_BURCM       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPELKARAD---VLLRISSMTLPHGM
RLMH_BURA4       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLDPELKARAD---VLLRISSMTLPHGM
RLMH_BURVG       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPELKARAD---LLLRISSMTLPHGM
RLMH_BURM1       D-WTTMQLAQALPGWQQDG--RDVAFVIGGADGLDPELKARAD---LLLRISSMTLPHGM
RLMH_BURMA       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURM9       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURM7       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURMS       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURPS       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURP0       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURP1       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURP6       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLAPALKSRAE---LLLRVSSLTLPHGM
RLMH_BURTA       D-WTTMQLAQALPAWQQDG--RDVAFVIGGADGLDPQLKSRAE---LLLRVSSLTLPHGM
RLMH_PARXL       D-WTTMQLAGALPSWQQDG--RDVAFLIGGADGLDPDLKARAD---MLLRVSSLTLPHAM
RLMH_PARP8       D-WTTMQLANALPTWQQDG--RDVAFLIGGADGLDPDLKARAD---MLLRVSSLTLPHAM
RLMH_PARPJ       D-WTTMQLAGALPGWQQDG--RDVAFLIGGADGLDPQLKARSD---MLLRVSSLTLPHAM
RLMH_CUPNH       D-FTTVQLAAQLTDWQREG--GDVAFLIGGADGLDPALKARAS---TLIRLSSLTLPHGM
RLMH_CUPTR       D-FTTVQLAAQLTDWQREG--GDVAFLIGGADGLDPALKARAS---TLIRLSSLTLPHGM
RLMH_CUPPJ       D-FTTVQLAGQLTDWQREG--GDVAFLIGGADGLDPALKARAQ---TLLRLSSLTLPHGM
RLMH_CUPMC       D-WTTVQLAEQLTGWQREG--GDVAFLIGGADGLDPALKARAH---TLLRISSLTLPHGM
RLMH_RALSO       D-LTTAALADALTGWQREG--GDVALIIGGADGLDPALKARAH---MLMRLSSLTLPHGM
RLMH_RALPJ       D-LTTVALAESLTGWQQEG--GDIAFVIGGADGLDPALKAKAR---TLIRLSSLTLPHGM
RLMH_HERAR       D-VTSVQLAQLLTQWQQDG--RDVTFVIGGADGLDPDFKKKAD---MLIRISSLTLPHGM
RLMH_JANMA       D-LTSVQLAQLLTQWQQDG--RDVAFIIGGADGLDAEFKKNAD---MLIRISSMTLPHGM
RLMH_POLAQ       D-QTTQHLATQLAGWRQEG--FDITFLIGGADGLDPSLKTNAQ---AMWRLSSLTLPHAM
RLMH_POLNS       D-QTTQNLATQLASWRQEG--FDITFLIGGADGLDPSLKTTAQ---AIWRLSSLTLPHAM
RLMH_NEIG1       A-PTSVELAEHLKSWRQNG--EHVCFVIGGADGMTDRLKQQAR---MMMRLSSLTLPHGM
RLMH_NEIG2       A-PTSVELAEHLKSWRQNG--EHVCFVIGGADGMTDRLKQQAR---MMMRLSSLTLPHGM
RLMH_NEIMA       A-PTSVELAEHLKSWRQNG--EHVCFVIGGADGMTDRLKQQAR---MMMRLSSLTLPHGM
RLMH_NEIMB       A-PTSVELAEHLKSWRQNG--EHVCFVIGGADGMTDRLKQQAR---MMMRLSSLTLPHGM
RLMH_NEIMF       A-PTSVELAEHLKTWQQNG--EHVCFVIGGADGMTDRLKQQAR---MMMRLSSLTLPHGM
RLMH_NEIM0       A-PTSVELAEHLKTWQQNG--EHVCFVIGGADGMTDRLKQQAR---IMMRLSSLTLPHGM
RLMH_CHRVO       N-WTSVKLAEGLKEWMAGG--GDVVFVIGGADGLSAELKQRAD---VLLQLSAMTLPHGM
RLMH_NITEU       Q-ATTMKLAEMMDRWMGSG--QDVAFIIGGADGLHQDIKQMAH---EKLALSAMTLPHGL
RLMH_NITEC       Q-ATTVRLAELMTNWRESG--RDVTFIIGGADGLHRDIKQIAH---EKLALSTMTLPHGL
RLMH_NITMU       Q-WTTAGLAHAIGSWMKDG--GDTAFLIGGADGLDPALRNAAD---EVLALSALTLPHGL
RLMH_DECAR       D-LTTLKLAKRLETWMQDG--RDVALLIGGADGLDEEFKQQAD---DRLRLSSLTLPHGM
RLMH_METFK       E-VTTLQLADKMRGWMESG--RDVSLVIGGADGLHDSLKHKAD---WLWSLSKLTMPHGM
RLMH_THIDA       Q-ATTRELAGWLENWMGEG--LTPAFVIGGADGLDDSVKAGAG---KLFGLSRLTLPHAL
RLMH_HALHL       P-RDTRQWARSLERWSHEG--GEVAFIIGGADGLSDAVRQRAD---ACWSLSPLTLPHML
RLMH_NITOC       S-WSTEEVARRLQIWMNEG--QDVVLLIGGPDGLAPLCLEQAT---GLWSLSSLTLPHGL
RLMH_HYDCU       E-LTTVQFSQKLDDWLGSG--QDVALIVGGPDGLDSSLIQQAE---WKWGLSKLTLPHPL
RLMH_ACIF5       N-LDSEALAQRIDTWFHSG--RDVALWVGGPDGLDPAL--QPD---WRWSLSPLTLAHPV
RLMH_ACIBC       E-LSTEKLADTMKQWMLEG--NDVALAIGGPDGLSDQVRKAAA---WHWSLSKLTMPHPL
RLMH_ACIBY       E-LSTEKLADTMKQWMLEG--NDVALAIGGPDGLSDQVRKAAA---WHWSLSKLTMPHPL
RLMH_ACIBT       E-LSTEKLADTMKQWMLEG--NDVALAIGGPDGLSDQVRKAAA---WHWSLSKLTMPHPL
RLMH_ACIBS       E-LSTEKLADTMKQWMLEG--NDVALAIGGPDGLSDQVRKAAA---WHWSLSKLTMPHPL
RLMH_ACIAD       E-LSTEKLADTMKSWMLEG--HDIALAIGGPDGLSDQVRKAAA---WHWSLSKLTMPHPM
RLMH_PSYA2       M-LSTENLADKLADGMQQG--DDIALVIGGADGVSPEVLAKAD---VKWSLSALTLPHPL
RLMH_PSYCK       M-LSTENLADKLSDGMQQG--DDIALVIGGADGVSPEVLAKAD---VKWSLSALTLPHPL
RLMH_PSYWF       M-LSTEQLADKLSEAMQVG--DDVALVIGGADGVSPEVLAAAD---FKWSLSPLTLPHPL
RLMH_FRAP2       I-ISTEELAEKMQNWKFNN--PNVVILIGGPDGIDQSIKNIAK---EKISISKMTFPHPL
RLMH_FRATN       I-ISTEELADKMQNWKFNN--PNVVILIGGPDGIDQSIKDIAK---EKISISKMTFPHPL
RLMH_FRATH       I-ISTEELADKMQNWKFNN--PNVVILIGGPDGIDQSIKDIAK---EKISISKMTFPHPL
RLMH_FRATF       I-ISTEELADKMQNWKFNN--PNVVILIGGPDGIDQSIKDIAK---EKISISKMTFPHPL
RLMH_FRATO       I-ISTEELADKMQNWKFNN--PNVVILIGGPDGIDQSIKDIAK---EKISISKMTFPHPL
RLMH_GRABC       A-HDSEALATLARRWREQP--LPVCFMIGGAEGLEQPVLDRAD---HVLSLGPMTWPHLL
RLMH_GLUDA       A-HDSLAFARVLERWLGLS--RPVCFLVGGAEGLDGPVLARAD---DTLSLGPMTWPHML
RLMH_ACICJ       A-PDSAAFAAMLASWRETS--RPLAFVIGGAEGLERRIIERAD---AVLSLGNLTLPHLL
RLMH_GLUOX       T-PDSLRLAEMLSRWQESG--RPIHFLIGGAEGLDSSVIQRAD---SVISLGKLTWPHML
RLMH_MAGMM       L-LDSETLAAQLLRWQEAGD-RDVGLIIGGPDGLHERVLQGVA---FKLAFGPMTFPHML
RLMH_SOLUE       P-MDSAAFAAMISKGEMEG--RDLVFLIGGHDGLPPAWRARAD---LLVSLSAMTFPHEL
RLMH_RHIL3       A-LDSEAFANLLGSYRDQGK-RELTIAIGGADGLDPSLYDRAD---ATLCLGKMTWPHQL
RLMH_RHILW       A-LDSEAFASLLGSYRDQGK-RDLTIAIGGADGLDPSLYDRAD---ATLCLGKMTWPHQL
RLMH_RHIEC       A-LDSEAFAKLLGGYRDQGK-RELTIAIGGADGLDPSLYDRAD---ATLCLGKMTWPHQL
RLMH_RHIE6       A-LDSEAFANLLGAYRDQGK-RDLMIAIGGADGLDPALYDRAD---VTLCLGKMTWPHQL
RLMH_RHIME       A-LDSEAFARLLGTLRDSGK-RDLMIAIGGADGLDPALHARAD---AVLNLGKMTWPHQL
RLMH_SINMW       A-LDSEAFANLLATFRDSGK-RDLMIAIGGADGLDPALHARAD---AVLCLGKMTWPHQL
RLMH_AGRFC       A-LDSPAFASLFGDLRDSGK-RDLVIAIGGADGLDSALYDKAT---AVLNLGKLTWPHQI
RLMH_BRUAB       T-LGSEAFAAIVGRMRDDGK-RQLIVAIGGPDGHDPALRSRAD---LVLALGELTWPHQI
RLMH_BRUA1       T-LGSEAFAAIVGRMRDDGK-RQLIVAIGGPDGHDPALRSRAD---LVLALGELTWPHQI
RLMH_BRUA2       T-LGSEAFAAIVGRMRDDGK-RQLIVAIGGPDGHDPALRSRAD---LVLALGELTWPHQI
RLMH_BRUO2       A-LGSEAFAAIVGRMRDDGK-RQLIVAIGGPDGHDPALRSRAD---LVLALGELTWPHQI
RLMH_BRUME       T-LGSEAFAAIVGRMRDDGK-RQLIVAIGGPDGHDPALRSRAD---LVLALGELTWPHQI
RLMH_BRUSU       T-LGSEAFAAIVGRMRDDGK-RQLIVAIGGPDGHDPALRSRAD---LVLALGELTWPHQI
RLMH_OCHA4       A-LGSEAFADRIGRMRDDGK-RQLIVAIGGPDGHDPALRTRAD---LVLALGELTWPHQI
RLMH_CHESB       N-LSSRELGDRFASFRDSGF-RQIVMAIGGPDGHDDAVRAAAD---LSISFGAQTWPHQL
RLMH_RHILO       S-LSSQDLANRIGQLRDGGR-KVLVLAIGGADGHDPPLRDQAD---LVLSFGALTWPHQL
RLMH_BARHE       T-VSSFAFAEQLGFYRDEGV-RDVIIALGGPDGHNEQIRNRAD---FLLSFGFMTWPHQI
RLMH_BART1       S-ISSAAFAEKLGCYRDEGI-RDVIIALGGPDGHNEQIRNRAD---FLLSFGFMTWPHQI
RLMH_BARBK       S-VSSIAFAEKLAFYRDEGV-RDLVIALGGPDGHSEQVRDRAD---FLLSFGLMTWPHQI
RLMH_AZOC5       N-LTSEAFAERVRTGRDGGR-PAAAFLIGGADGLSEAVRARCD---LMLAFGAATFPHQI
RLMH_XANP2       Q-LSSEDFATRMAAQRDGGL-PALAFIIGGADGLADAVRDKAA---LMVAYGTATFPHQL
RLMH_METPB       SDWPSERIAEKIGGWRDAGR-GSLVLVIGGADGLHESVRGRAD---HILAFGAATLPHGL
RLMH_METEP       SDWPSERIADKIGAWRDAGR-STLVLVVGGADGLHETVRGRAD---HILAFGAATLPHGL
RLMH_METRJ       ADLGSEALAERVAGWRDAAR-PALVVTIGGPDGLDASIRTRAE---LILSFGAATLPHGL
RLMH_METS4       A-VTSAGLAEQVAAWRDGGR-PGLTIVIGGADGLCESVRHRAD---LVFAFGAATLPHGL
RLMH_BRASB       N-IDSASLAAQIGRWRDEGV-PAAVFVIGGADGLSPELRRRAK---LGVAFGAATWPHQI
RLMH_BRASO       N-IDSATFAGHIGRWRDEGV-AATAFVIGGADGLSPELRRKAK---LGVAFGAATWPHQI
RLMH_BRADU       N-LDSTVFARHLGRWRDEGA-GHTIFVIGGADGLSPELRRKAK---LAIAFGSATWPHQM
RLMH_RHOPA       S-LGSTAFAAQLGRWRDEQV-PGTIFVIGGADGLLPELRRKAK---LSMSFGGATWPHQM
RLMH_RHOPT       S-LGSTAFAAQLGRWRDEQV-PGTIFVIGGADGLLPELRRKAK---LSMSFGGATWPHQM
RLMH_RHOPS       S-VDSAAFAAQLGRWRDESV-PGTIFVIGGADGLLPELRRKAK---LCLSFGAATWPHQM
RLMH_RHOP2       S-VDSAAFAAQLGRWRDESV-PGTIFVIGGADGLLPELRRKAK---LCLSFGAATWPHQM
RLMH_RHOP5       N-LDSIGFAQKLAGWRDQSV-PQTIFLIGGADGLSPELRRKAK---LSVSFGAATWPHQM
RLMH_RHOPB       S-LDSAGFARKLGGWRDQST-AQAIFVIGGADGLSPELRRKAK---LSVSFGAATWPHQM
RLMH_NITHX       N-IDSAAFADHLGRWRDESV-TSTVFAVGGADGLSPELRRKAR---LSVAFGAATWPHQI
RLMH_NITWN       S-IDSAAFAEHLGRWRDESV-ADAVFMIGGADGLSPELRRRAR---LSVAFGAATWPHQM
RLMH_OLICO       N-LDSATLARHLGRWRDDSV-PCAVFLIGGADGLSAELSRVAK---IRLAFGKATWPHQI
RLMH_BEII9       S-IDSEGFADCLGQARDSGK-AMMHFLIGGADGLEPALTESAA---FVFAFGKMTWPHQL
RLMH_CAUVC       A-WKSRAFADHLARLRDDGN-RRVVFLIGGADGLDPSILAAAN---ETMAFGVQTWPHAL
RLMH_CAUSK       V-RPSRAFAEHVGRLRDDGH-RRLVFLIGGADGLDPSILSTAN---ETLAFGPQTWPHAL
RLMH_PHEZH       A-RPSRAFAEEIGRLRDQGV-RRLVFLIGGADGLDPALVAQAN---GKLAFGPQTWPHAL
RLMH_HYPNA       N-LTSEAFASRLSRWRDDGE-RDTCFLIGGAEGYAPDVRAAAP---QTLAFGVQTWPHRL
RLMH_RUEPO       Q-LSSPDFADRMAGWRDTGR-QDLALVIGGADGIDPSLRAEAD---FSISFGAMVWPHML
RLMH_RUEST       V-ISSPDFAEKLAGWRDMGR-QDLAFVIGGADGIDPSLRAEAD---FSISFGKMVWPHMM
RLMH_ROSDO       V-ESSPDFAQRLAGWRDQGR-GDLALVIGGADGIDPALRAEAD---FALSLGKMVWPHML
RLMH_DINSH       T-MSSPQFADSLAGWRDAGR-SDLAFLIGGADGLDKALRAQAE---ARLSFGAMVWPHML
RLMH_RHOS4       T-LSSPEFADHLAHWRDSGR--DVALAIGGADGLAPRLRDRAD---LAMSFGRMVWPHML
RLMH_RHOS1       T-LSSPEFADHLAHWRDSGR--DVALAIGGADGLAPRLRDRAD---LAMSLGRMVWPHML
RLMH_RHOS5       T-LSSPEFAEQLARWRDAGR--DVALAIGGADGLAPRLRDRAD---LALSFGRMVWPHML
RLMH_PARDP       M-LSSPEFAARIAGWRDQAR--DVAFVIGGADGIDPGLRDGAD---LAISFGRMVWPHML
RLMH_MARMM       A-LNSRQLARQIGQWRDEGC-REAVFCIGGADGHDRSQLPQPD---LMLSFGPAVFPHKL
RLMH_MAGSA       D-IGSVDFAHRLRDWRDSGC-QDVAFLIGGADGHGDAVRERAD---LLLSFGRMTWPHML
RLMH_RHOCS       M-LASEAFARRLGTWRDQDS-ADIAFVIGGADGLAEEVRRRAD---LLLAFGPMTWPHML
RLMH_PARL1       I-ETSEAFAKRIGTLRDSGA-ADLAFLIGGANGLAPALRERAS---HVMAFGAMTWPHML
RLMH_RHORT       A-WGSERLARELDQRRLEAR-PAAVFAIGGADGHGEALLARAD---RKLALGVMTWPHML
RLMH_NOVAD       Q-LTSSEFAAILGRWRDDGV-RETRFLIGAADGHDEALRESAD---LLIAFGNATWPHML
RLMH_SPHWW       Q-LGSMAFAEKLGRWRDDGR-REVRFLIGAADGFDEAQRREAD---LLFAFGKATWPHLL
RLMH_SPHAL       Q-MSSLEFANLLENWRDGGV-REARFCIGAADGFTPDERKGAD---KVIAFGRATWPHLM
RLMH_ERYLH       D-LSSHRLARQLERWRDDGM-RETRFVLGAADGHAQEERAEAD---LLLAFGSATWPHLL
RLMH_ZYMMO       T-WRSMEFAQKIGNWQDEGR-SEIRFLIGAADGLREEERAAAD---MYFAFGAATWPHML
RLMH_KORVE       Q-VGSEELANFLGYHRDQGV-QDLIFAIGPSDGWQKETLKSAT---QVLSMGKMTLPHEL
RLMH_DEIGD       QFTSESLSAY-LDAQALDGR-GELAFAVGGPEGHTDDLRARAH---RLWSLSLLTLPHDL
RLMH_DEIRA       QFSSEKLSEY-LDAEALGGH-GELAFAIGGPDGHTDALRGQAK---LLWSLGELTLPHDL
RLMH_THET2       LLTTEELYRR-LLVWEGE----RVAFLVGGAEGHPEAVREEAD---LLLSLSPLTLQHEL
RLMH_THET8       LLTTEELYRR-LLAWEGE----RVAFLVGGAEGHPEAVREEAD---LLLSLSPLTLQHEL
RLMH_AKKM8       LWTTRKLVDL-AKDWQMHSV-RRIAFLIGASDGHTEELRSRCN---HILSLSKFTLQHEL
RLMH_RUBXD       RYGSEELARRRLEPLAVSGR-GHVAFVIGGPLGLAPEVLERAD---ERWSFGEITLPHAL
RLMH_SORC5       ALGSEAFAAG-VERWGSRGK-GVVAFLIGGADGLPPDVSAAAD---DRWSLSPLTFPHRL
RLMH_ANADE       E-LTSVAFAERVRRWMERG--QDVALLIGGSDGLAPEVLARAE---ERLAVSRFTLAHRL
RLMH_ANASK       E-LTSVAFAERVRRWMERG--QDVALLIGGSDGLAPEVLARAD---ERLAVSRFTLAHRL
RLMH_ANADF       E-WTSVAFAERVRRWTEGG--RDVALVIGGSDGLSRAVLDRAE---ETLALSRMTLAHRL
RLMH_MYXXD       L-LDSVELSRYVGKAQTGA--KDLLFIIGGDEGLDARVRDAAN---LTLSLSKMTLPHRL
RLMH_GLOVI       Q-FTSVELADWLENHTV----QEPVFIVGSSHGVAPMVRERAQ---MVWSLSKLTFPHEL
RLMH_PROMA       K-FTSMDFSHWLQNLGSSR----IVFAIGGTNGLSQEVKTSAD---LCISLSALTFPHEM
RLMH_PROM4       S-LTSLGFANRLKSLGSSR----LLFVIGSANGLDSEIKAMAN---WSISLSPLTFPHEI
RLMH_PROMM       A-LTSVSFAKRLEKYGSQR----LAFVIGGADGLSAELKNSTQ---WQLSLSAMTLPHEL
RLMH_PROM3       A-LTSVSFAKRLEKYGSQR----LAFVIGGADGLSAELKNSTQ---WQLSLSAMTLPHEL
RLMH_SYNS3       T-LTSINFSERLRSLGSQR----LAFVIGGADGLTAELKALAH---WKLSLSPMTFPHEL
RLMH_SYNPW       P-LASIPFAQRLERLGNER----LAFVIGGADGLTDELKAAAR---WQLSLSPMTFPHEL
RLMH_SYNSC       T-LASVPFAQRLEQFGNQR----LAFVIGGADGLTAELKAQAQ---WRLSLSPMTFPHEL
RLMH_SYNS9       C-LGSIPFARRLKQFENER----LVFVIGGADGLTAELKLQAQ---WQLSLSPLTFPHEL
RLMH_SYNPX       A-VGSIPFARRLDQLGNQR----LAFVIGGADGLTNELKGRAH---WQLSLSPMTFPHEL
RLMH_PROM1       S-FTSKQLATKLLNSHNQN----ITFVIGGASGLTSSLNNLAS---WQLSLSPLTFPHEI
RLMH_PROMT       S-FTSKQLATKLLNSHNQN----ITFVIGGASGLSSSLNNLAS---WQLSLSPLTFPHEI
RLMH_SYNR3       Q-LSSVGLAELLGGWASER----LALVIGGADGHDPTLKQQAD---VLLSLSELTFPHEL
RLMH_PROMS       Q-FNSVELCSLLLNFKNKK----INFLIGDTDGVSSDIKEKSD---LVLSLSPLTFPHEL
RLMH_PROM0       Q-FNSVELCSLLLNFKNKK----INFLIGDTDGVSSDIKEKSD---LVLSLSPLTFPHEL
RLMH_PROM9       Q-FNSVELCSLLLNFKNKK----INFLIGDTDGISSDIKKNSD---LILSLSPLTFPHEL
RLMH_PROM2       Q-FNSIELCSLLLNFKNKK----INFLIGDTDGISSDIKENSD---LILSLSPLTFPHEL
RLMH_PROMP       S-FNSIELTSLLLNFKNKK----INFLIGDADGIPSDIKDKSN---LLLSLSPLTFPHEL
RLMH_PROM5       S-FSSTELTSLLLNFKNKK----INFLIGDADGIPSDIKDKSH---LLLSLSPLTFPHEL
RLMH_CAMC1       Q-LDSQEFAQILNSN------SQINFFIGGAYGLSQNLKDKAQ---KVVSLSKMTMAHKV
RLMH_CAMC5       E-LNSSEFAKIFEQN------MQLSFFIGGAYGLSKNLKDKAQ---KVISLSKMTMAHKI
RLMH_CAMFF       H-LDSVEFADLLKNS------SQISFFIGGAYGLSPQFKTKMN---RLISLSKMTLAHKI
RLMH_CAMHC       M-IDSLQFAEILSKN------SQISFFIGGAYGLSENFKQKMD---KIISLTKLTLAHKI
RLMH_CAMJE       D-LTSIEFAKLIQDK------NELSFFIGGAYGLREEFNQSLD---FRLSLSKLTLAHQF
RLMH_CAMJR       D-LTSIEFAKLIQDK------NELSFFIGGAYGLREEFNQSLD---FRLSLSKLTLAHQF
RLMH_CAMJJ       D-LTSIEFAKLIQDK------NELSFFIGGAYGLREEFNQSLD---FRLSLSKLTLAHQF
RLMH_CAMJ8       D-LTSIEFAKLIQDK------NELSFFIGGAYGLREEFNQSLD---FRLSLSKLTLAHQF
RLMH_CAMJD       D-LTSIEFAKLIQDK------NELSFFIGGAYGLREEFNQSLD---FRLSLSKLTLAHQF
RLMH_HELPS       R-GDSFAFSKMLENH------LNINFFIAGAYGFEENFLKDC----QAWSLSEMTFSHEV
RLMH_HELPG       R-GDSFAFSKMLENH------LNINFFIAGAYGFEENFLKGC----QAWSLSEMTFSHEV
RLMH_HELPY       R-GDSFAFSKMLENH------LNINFFIAGAYGFEENFLKDC----QAWSLSEMTFSHEV
RLMH_HELPH       R-GDSFAFSKMLENH------LNINFFIAGAYGFEENFLKGC----QAWSLSEMTFSHEV
RLMH_HELP2       R-GDSFAFSKMLENH------LNINFFIAGAYGFEENFLKDC----QAWSLSEMTFSHEV
RLMH_HELPJ       R-GDSFAFSKMLENH------LNINFFIAGAYGFEEKFLKDC----QAWSLSEMTFSHEV
RLMH_HELAH       R-GDSFAFSKMLENY------LNINFFIAGAYGFEEKFLKDC----QAWSLSEMTFSHEV
RLMH_HELHP       N-YDSQSFAKLIESQ------HIVQFFIGGAFGFEESFVRLG----KSVSLSAMTFNHKI
RLMH_SULDN       L-IDSYEFSKLLDGK------IAVKFFIGGAYGFEDEFLKKGD---SIISLGNITMSHKI
RLMH_ARCB4       R-VDTYAFSSLIDNK------NEVNFFIGGAYGFQREFLNKCD---SVISLSDLTMAHKV
RLMH_SULNB       E-VDSFEFAKLLKDS------VTVNFYIGGAYGFERDFLSKCN---NAVSFGKITLSHKL
RLMH_NITSB       C-LDSFAFANLLKEH------TKLAFFIGGAYGLERSFVQSCD---MALSLSPLTMSHKI
RLMH_WOLSU       L-YDSHAFSQIFHHK------QEVNFFIGGAYGFEPGFLKSCH---QSLSLSPLTLGHKV
RLMH_FERNB       E-LTSIEYARFLEN--TINKLSEIVFVIGGPLGIDDSLRENALA---KISLSKMTFTHEM
RLMH_THEM4       Q-IDSLEFSSLLKN--KLLE-GNLCFVIGGPLGISENLRRMSEK---RISLSKLTFTHEM
RLMH_PSELT       S-CDSISFANHFHQ--LIQINSSIVFVIGGPFGVDESLKKRANE---LLSLSDLTFTHQL
RLMH_DICT6       K-ISSEEFSKKLFKLPIS-QNSQITFIIGGIYGVSEKIKQSSNF---ILSLSSMTFTHEF
RLMH_PETMO       Q-MDSVKFSEFYDRTKTSSQGKHINFIVGGPLGHSDKIYNKADY---ILSLSKMTFTHEF
RLMH_THEP1       E-VSSEEFADFLKD--LEMKGKDITILIGGPHGLNEEIFAKAHR---VFSLSKMTFTHGM
RLMH_THESQ       E-VSSEEFADFLKD--LEMKGKDITILIGGPHGLNEEIFAKAHR---VFSLSKMTFTHGM
RLMH_THEMA       E-VSSEEFADFLKD--LEMKGKDITILIGGPYGLNEEIFAKAHR---VFSLSKMTFTHGM
RLMH_THEYD       S-LSSTEFADFIKD--KSLT----QFVIGGVYGVNEAVFKAASF---RLSLSSLTFTHEI
RLMH_FUSNN       E-INSENMSKYIENLKNIGI-SSINFIIGGSNGVSKNVKNSVDM---KLKFSHFTFPHQL
RLMH_MYCPE       Q-MDSIKFANSI-NQNLIIS-KDINFYIGSSHGISESIKNKFNL---KLSFSELTFNHQI
RLMH_MYCCT       L-ISTENLVEIIKTNLNYKT-AKILFVIGPSDGYSKSFLNSFTN---KFSLAKITLPHQL
RLMH_MYCMS       L-ISTENLVEIIKTNLNYKS-AKILFIIGPSDGYSKSFLNSFTN---KFSLAKITLPHQL
RLMH_MESFL       N-YSTEEFMSIIENNKNLKQ-AKIVFVIGPSDGFSDKFLQQNYK---KVSFGNITLPHQL
RLMH_MYCH2       T-VTSKEFSQLLNFS-------NICFIIGGSYGVDEKLIAKSRPDIGFLSFGKLTFAHKI
RLMH_MYCHJ       T-VTSKEFSQLLNFS-------NICFIIGGSYGVDEKLIAKSRPDIGFLSFGKLTFAHKI
RLMH_MYCH7       T-VTSKEFSQLLNFP-------NICFIIGGSYGVDEKLIAKSRPDIGFLSFGKLTFAHKI
RLMH_MYCMO       E-KTSEDFSLLFNED-------NLTFVIGGSNGVDESTFLH------KISFSKNTFPHQL
RLMH_MYCA5       K-MKSEEFASLLCED-------NLTFIIGGSNGVEEKYFDN------KICFSDLTFPHQL
RLMH_MYCS5       N-YSSEEFSKLITNDA------NITFVIGGSNGVIESYFEN------KISFSKLTFPHQL
RLMH_MYCPU       Q-YSSEKFALFLQED-------NISFVIGGSHGVDEKMFKGAW----KINFSKMTFPHQL
RLMH_MYCAP       Q-IDSIAFSKLIEMNTN----QSFTFIIGGSDGVCEEHFESAQ----KLSFSQMTFPHQL
RLMH2_THEP3      S-LSSEELAEKIKELELSAK-TDILIVIGN------EEIPLNES----ISISPMEMSLGL
RLMH1_THEPX      S-LSSEELAEKIKELELSAK-TDILIVIGN------EEIPLNES----ISISPMEMSLGL
RLMH1_CALS4      T-ISSEKFALKIKDLEMKSI-TDITFLIGE------GIEIFDEI----FTISQMKMSKGL
RLMH_PARUW       L-LTSEAFATFFSKCWEQGG-SRLTIVIGGAEGLPLELKQHSIL----ISLSLLTFTHQI
                                            :.                              .

RLMH_UREPA       AKVMLCEQIYRALSILNNGKYHK------
RLMH_UREP2       AKVMLCEQIYRALSILNNGKYHK------
RLMH_UREU1       AKVMVCEQIYRALSILNNGKYHK------
RLMH_ACHLI       MKLFLVEQIFRAQAILNNHPYHK------
RLMH_LACLM       MRLVLVEQIYRAQMINRGSVYHK------
RLMH_LACLS       MRLVLVEQIYRAQMINRGSAYHK------
RLMH_LACLA       MRLVLVEQIYRAQMINRGSAYHK------
RLMH_LEUMM       MRLVLIEQIYRAFMIQQGSPYHK------
RLMH_LEUCK       MRLVLIEQIYRAFMIQQGSPYHK------
RLMH_STRGC       MRLVLMEQIYRAFMIQQGSPYHK------
RLMH_STRSV       MRLVLIEQIYRAFMIQQGSPYHK------
RLMH_STRSY       MKLVLIEQIYRAFMIQQGSPYHK------
RLMH_STRPC       MRLVLTEQIYRAFMITQGSPYHK------
RLMH_STRPZ       MRLVLTEQIYRAFMITQGSPYHK------
RLMH_STRPM       MRLVLTEQIYRAFMITQGSPYHK------
RLMH_STRPF       MRLVLTEQIYRAFMITQGSPYHK------
RLMH_STRP6       MRLVLTEQIYRAFMITQGSPYHK------
RLMH_STRP1       MRLVLTEQIYRAFMITQGSPYHK------
RLMH_STRPB       MRLVLTEQIYRAFMITQGSPYHK------
RLMH_STRP8       MRLVLTEQIYRAFMITKGSPYHK------
RLMH_STRPG       MRLVLTEQIYRAFMITKGSPYHK------
RLMH_STRP3       MRLVLTEQIYRAFMITKGSPYHK------
RLMH_STREM       MRLVLIEQVYRAFMIQQGSPYHK------
RLMH_STRA1       MKLVLMEQIYRAFMIRQGTPYHK------
RLMH_STRA3       MKLVLMEQIYRAFMIRQGTPYHK------
RLMH_STRA5       MKLVLMEQIYRAFMIRQGTPYHK------
RLMH_STRT2       MRLILVEQIYRAFMIQQGSPYHK------
RLMH_STRT1       MRLILVEQIYRAFMIQQGSPYHK------
RLMH_STRTD       MRLVLVEQIYRAFMIQQGSPYHK------
RLMH_STRMU       MRLVFVEQIYRAFMIQEGSPYHK------
RLMH_STRP4       MRLVLVEQIYRAFTIQQGFPYHK------
RLMH_STRPS       MRLVLVEQIYRAFTIQQGFPYHK------
RLMH_STRPN       MRLVLVEQIYRAFTIQQGFPYHK------
RLMH_STRR6       MRLVLVEQIYRAFTIQQGFPYHK------
RLMH_STRP2       MRLVLVEQIYRAFTIQQGFPYHK------
RLMH_OENOB       ARVLLTEQIYRSFMINEGSPYHK------
RLMH2_THEPX      MRLILLEQLYLAFDGKNHL----------
RLMH1_THEP3      MRLILLEQLYLAFDGKNHL----------
RLMH2_CALS4      TRLLLLEQIYYALL---------------
RLMH_ALKMQ       MKLILLEQVYRAFRISKNEPYHK------
RLMH_ALKOO       MKLILLEQIYRGLRIIKGEPYHK------
RLMH_LACP7       MRTILLEQVYRGFRIMSGEPYHK------
RLMH_CLOPE       FRVMLLEQVYRAFRIMKNEPYHK------
RLMH_CLOP1       FRVMLLEQVYRAFRIMKNEPYHK------
RLMH1_CLOPS      FRVMLLEQVYRAFRIMKNEPYHK------
RLMH_CLOTE       FRVMLLEQIYRGYRIMNGEPYHK------
RLMH_CLOBA       FRVMLLEQIYRAFRISNGEPYHK------
RLMH_CLOBB       FRVMLLEQIYRAFRISNGEPYHK------
RLMH_CLOB8       FRVMLLEQIYRGFRIIKGEPYHK------
RLMH_CLOK5       FRIMLLEQIYRGFRIMKGEPYHK------
RLMH_CLOAB       FRVMLLEQVYRAFRISRGEPYHK------
RLMH_CLOB1       FRVMLLEQVYRAFRILCREPYHK------
RLMH_CLOBH       FRVMLLEQVYRAFRILCREPYHK------
RLMH_CLOBL       FRVMLLEQVYRAFRILCGEPYHK------
RLMH_CLOBK       FRVMLLEQVYRAFRILCGEPYHK------
RLMH_CLOBM       FRVMLLEQVYRAFRILCGEPYHK------
RLMH_CLONN       MRVILLEQIYRAYKINAGEPYHK------
RLMH_BIFLO       MRVILLEQIYRAYKINAGEPYHK------
RLMH_BIFLD       MRVILLEQIYRAYKINAGEPYHK------
RLMH_BIFAA       MRVILLEQIYRAYKINAGEPYHK------
RLMH_CLOD6       MRLILLEQIYRAYRINNGEPYHK------
RLMH_FINM2       MRLILLEQIYRSFRIINNLPYHK------
RLMH_METM5       MRVILLEQIYRSFRIINGEPYHK------
RLMH_METM7       MRVILLEQVYRSFRIINGEPYHK------
RLMH_METM6       MRVILLEQIYRSFRIINGEPYHK------
RLMH_METMP       MRVILLEQIYRSFRIISGEPYHK------
RLMH_METVS       MRVILLEQIYRSFRIINGEPYHK------
RLMH_BACVZ       MRLILVEQIYRAFRINRGEPYHK------
RLMH_BACSU       MRLILVEQIYRAFRINRGEPYHK------
RLMH_BACLD       MRLILLEQVYRAFRINRGEPYHK------
RLMH_BACP2       MRLVLVEQVYRAFRIVRGEPYHK------
RLMH_BACHD       MRLILLEQVYRAFRINRGEPYHK------
RLMH_BACCZ       MRLVLLEQVYRAFRINRGEPYHK------
RLMH_BACAH       MRLVLLEQVYRAFRINRGEPYHK------
RLMH_BACAN       MRLVLLEQVYRAFRINRGEPYHK------
RLMH_BACHK       MRLVLLEQVYRSFRINRGEPYHK------
RLMH_BACCR       MRLVLLEQVYRAFRINRGEPYHK------
RLMH_BACC1       MRLVLLEQVYRAFRINRGEPYHK------
RLMH_BACMK       MRLVLLEQVYRAFRINRGEPYHK------
RLMH_BACCN       MRLVLLEQIYRAFRINRGEPYHK------
RLMH_LISMO       MRLVLVEQVYRAFRIVRGEPYHK------
RLMH_LISMF       MRLVLVEQVYRAFRIVRGEPYHK------
RLMH_LISIN       MRLVLVEQVYRAFRIVRGEPYHK------
RLMH_LISW6       MRLVLVEQVYRAFRIVRGEPYHK------
RLMH_BACSK       MKLVLFEQLYRSFRIMRGEPYHK------
RLMH_LYSSC       MKLVLVEQVYRSFRIMKGEPYHK------
RLMH_OCEIH       MRLVLIEQVYRSFRINRGEPYHK------
RLMH_GEOKA       MRLILLEQIYRAFRINRGEPYHK------
RLMH_GEOTN       MRLILLEQIYRAFRINRGEPYHK------
RLMH_EXIS2       MKMILCEQIYRAYRINRNEPYHK------
RLMH_LACAC       MRVVLIEQIYRAFMINSGSPYHK------
RLMH_LACH4       MRVVLIEQIYRAFMINSGSPYHK------
RLMH_LACGA       MRLVLVEQIYRAFMINSGSPYHK------
RLMH_LACJO       MRLVLIEQIYRAFMINSGSPYHK------
RLMH_LACDA       MRLVLIEQIYRAFMINSGSPYHK------
RLMH_LACDB       MRLVLIEQIYRAFMINSGSPYHK------
RLMH_LACP3       MRLVLMEQIYRAFMINIGSPYHK------
RLMH_LACCB       MRLVLMEQIYRAFMINIGSPYHK------
RLMH_LACSS       MRLVLTEQIYRAFMINQGSPYHK------
RLMH_LACBA       MRLVLTEQVYRAFMINEGSPYHK------
RLMH_LACPL       MRLVLSEQVYRAFMINVGSPYHK------
RLMH_LACRD       MRLVLSEQIYRAFTIINGLPYHK------
RLMH_LACRJ       MRLVLSEQIYRAFTIINGLPYHK------
RLMH_LACF3       MRLVLAEQIYRAFTIINGLPYHK------
RLMH_LACS1       MRMVLAEQIYRGFMINAGRPYHK------
RLMH_PEDPA       MRLVLTEQIYRSFMIQAGSPYHK------
RLMH_ENTFA       MRLVLVEQIYRGFRIMKGEPYHK------
RLMH_STAA1       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAM       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAN       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAA8       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAE       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAT       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAA3       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAU       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAB       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAA2       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAA9       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAR       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAS       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAAW       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAHJ       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAHO       MRVVLIEQVYRAFKIMRGEAYHK------
RLMH_STAES       MRVILIEQIYRAFKIMRGEAYHK------
RLMH_STAEQ       MRVILIEQIYRAFKIMRGEAYHK------
RLMH_STAS1       MRVILIEQVYRAFKIMRGEAYHK------
RLMH_CARHZ       MRLILLEQIYRAFKIIRGEPYHK------
RLMH_HUNT2       TRLILLEQLYRSFKIINGEPYHR------
RLMH_PELTS       VRLILLEQLYRWFKIARGEPYHY------
RLMH_DESRM       VRLLLMEQIYRWFKIIHNEPYHK------
RLMH_SYMTH       VPLILLEQIYRAFKINRGEKYHK------
RLMH_DESTE       MRIILLEQIYRAFKIIRGEKYHL------
RLMH_MOOTA       MRLILLEQLYRAFKIQRGETYHR------
RLMH_DESHY       MRLMLLEQIYRAMRISKGEPYHK------
RLMH_NATTJ       MRLILTEQLYRAIKIIHNEPYHY------
RLMH_HELMI       VRLILLEQVYRGCKVNRGETYHR------
RLMH_METLZ       TRLILLEQVYRAFRILNGEPYHK------
RLMH_METB6       ARLILVEQLYRACRINSGEPYHK------
RLMH_DESPS       VRLLLVEQLYRAYTIKAGEKYHK------
RLMH_BACFR       IRLIFVEQIYRAMTILNGGPYHHE-----
RLMH_BACFN       IRLIFVEQIYRAMTILNGGPYHHE-----
RLMH_BACTN       IRLIFVEQIYRAMTILNGGPYHHE-----
RLMH_BACV8       IRLIFVEQLYRAMTILNNGPYHHE-----
RLMH_PARD8       IRLIFIEQIYRAMTILNNEPYHHE-----
RLMH_FLAJ1       VRLFFIEQLYRGFTILRNEPYHHQ-----
RLMH_FLAPJ       VRLFFIEQLYRGFTILKNEPYHHQ-----
RLMH_GRAFK       VRLFFTEQLYRAFTILKNEPYHHR-----
RLMH_PORGI       IRLFFTEQVYRAMTILNHEPYHHE-----
RLMH_PORG3       IRLFFTEQVYRAMTILNHEPYHHE-----
RLMH_CYTH3       VRLFALEQLYRACTIIKGEKYHH------
RLMH_BDEBA       AQAMSLEQIYRAFTIIKKIPYHNI-----
RLMH_PELCD       ARLVLLEQLYRGFTIVRNEPYHNR-----
RLMH_GEOMG       VRVILLEQIYRAHTILNGEPYHHS-----
RLMH_GEOSL       VRVVLLEQIYRAFTIIGNEPYHH------
RLMH_GEOUR       VRIFLLEQIYRGFTIINGEPYHH------
RLMH_GEOBB       VRVFLLEQIYRGFTIINCEPYHHE-----
RLMH_PELPD       VRVFLLEQLYRSFTILNNEPYHH------
RLMH_GEOLS       VRPFLLEQIYRACTILNNEPYHH------
RLMH_DESVH       ARVVLLEQLYRADAILRGAPYHHD-----
RLMH_DESVV       ARVVLLEQLYRADAILRGAPYHHD-----
RLMH_DESAG       ARVVLYEQLYRADAILRGTPYHH------
RLMH_LAWIP       ARVIFLEQVYRAETLLRNIPYHH------
RLMH_METHJ       ARLLLYEQLYRAFTIIRGLPYHR------
RLMH_METTP       ARILLLEQLYRAFKIIKNEPYHR------
RLMH_SYNFM       ARLIVAEQLYRAFTIIRGEPYHK------
RLMH_COPPD       ARLFFLEQLYRALTIIKGEKYHK------
RLMH_SYNWW       AVLILAEQIYRGFKILKGEPYHR------
RLMH_CALS8       FRILVYEQIYRGFTIIKGIKYHK------
RLMH_SHIFL       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SHIF8       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOLI       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SHIBS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SHIDS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SHISS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOL6       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOL5       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECO57       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOK1       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOUT       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECO24       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOHS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOLC       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOSE       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SHIB3       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECODH       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECO5E       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ECOSM       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_CITK8       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALAR       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALPA       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALTY       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALPB       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALTI       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALHS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALSV       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALNS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALA4       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALEP       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALPK       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALDC       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALG2       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SALCH       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ENT38       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_CROS8       VRVIVAESLYRAWSITTNHPYHRE-----
RLMH_KLEP7       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_KLEP3       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_PHOLL       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_SODGM       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_PROMH       VRVVVAESLYRAWSITTNHPYHRE-----
RLMH_SERP5       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_PECAS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPE       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPY       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPA       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPN       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPP       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPS       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPG       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERPB       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERP3       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_YERE8       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_ERWT9       VRVLVAESLYRAWSITANHPYHRE-----
RLMH_ACTP2       VRVIVAESLYRAWSLTTNHPYHRE-----
RLMH_ACTP7       VRVIVAESLYRAWSLTTNHPYHRE-----
RLMH_ACTPJ       VRVIVAESLYRAWSLTTNHPYHRE-----
RLMH_MANSM       VRVVVAESVYRAWSLTTNHPYHRE-----
RLMH_HAEIN       VRVVVAESLYRAWSLTTNHPYHRE-----
RLMH_HAEIG       VRVVVAESLYRAWSLTTNHPYHRE-----
RLMH_HAEI8       VRVVVAESLYRAWSLTTNHPYHRE-----
RLMH_HAEIE       VRVVVAESLYRAWSLTTNHPYHRE-----
RLMH_HAEDU       VRVIVAESLYRAWSLTTNHPYHRE-----
RLMH_ACTSZ       VRVVVAESLYRAWSLTANHPYHRE-----
RLMH_HAES1       VRIIVAESLYRAWSLSTNHPYHRE-----
RLMH_HISS2       VRIVVAESLYRAWSLSTNHPYHRE-----
RLMH_PASMU       VRVVVAESLYRAWSVTMNHPYHRE-----
RLMH_AERHH       VRVLVAESLYRAWSITTNHPYHRE-----
RLMH_AERS4       VRVLVAESLYRACSITTNHPYHRE-----
RLMH_ALIF1       VRVVMAESLYRAWSITANHPYHRE-----
RLMH_ALIFM       VRVVMAESLYRAWSITANHPYHRE-----
RLMH_ALISL       VRVVMAESLYRAWSITANHPYHRE-----
RLMH_PHOPR       VRVVMAESLYRAWSVTANHPYHRE-----
RLMH_VIBCH       VRVVMAESLYRAWSITTNHPYHRE-----
RLMH_VIBC3       VRVVMAESLYRAWSITTNHPYHRE-----
RLMH_VIBCB       VRIVMAESLYRAWSITANHPYHRE-----
RLMH_VIBPA       VRIVMAESLYRAWSITANHPYHRE-----
RLMH_VIBVU       VRIVMAESLYRAWSITTNHPYHRE-----
RLMH_VIBVY       VRIVMAESLYRAWSITTNHPYHRE-----
RLMH_SHEB5       VRVVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHEB8       VRVVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHEB9       VRVVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHESA       VRIVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHESM       VRIVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHESR       VRIVVAESLYRAWSVNNNHPYHRE-----
RLMH_SHEON       VRIVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHEPC       VRIVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHESW       VRIVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHEAM       VRVVVAESLYRAWSINNNHPYHRE-----
RLMH_SHEDO       VRVLVAESLYRAWSINNNHPYHRE-----
RLMH_SHEFN       VRVIVAESLYRAWSVNTNHPYHRE-----
RLMH_SHESH       VRVVVAESLYRAWSVNNNHPYHRE-----
RLMH_SHEWM       VRVVVAESLYRAWSVNTNHPYHRE-----
RLMH_SHELP       VRVLVAESLYRAWSINNNHPYHRE-----
RLMH_SHEHH       VRVIVAESLYRGWSINNNHPYHRE-----
RLMH_SHEPA       VRVIVAESLYRGWSINNNHPYHRE-----
RLMH_PSEA6       VRIIVAESLYRAWSVNTNHPYHRE-----
RLMH_PSEHT       VRIIVAESLYRGWSLNNNHPYHRE-----
RLMH_PSYIN       VRVIVAESLYRAFTLTINHPYHRE-----
RLMH_COLP3       VRILIAESLYRAWSVNTNHPYHRE-----
RLMH_IDILO       VRLIVAESLYRAWSLNNNHPYHRE-----
RLMH_COXBN       ARVIVAEQIYRAWSIITNHPYHR------
RLMH_COXB1       ARVIVAEQIYRAWSIITNHPYHR------
RLMH_METCA       VRVIVAEQLYRAWTLLNNHPYHR------
RLMH_LEGPC       VRIILLESLYRAWSIINNHPYHK------
RLMH_LEGPA       VRIILLESLYRAWSIINNHPYHK------
RLMH_LEGPL       VRIILLESLYRAWSIINNHPYHK------
RLMH_LEGPH       VRIILLESLYRAWSIINNHPYHK------
RLMH_DICNV       VRIIVAEALYRAWSINHHHPYHRA-----
RLMH_XANAC       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_XANC5       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_XANOR       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_XANOP       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_XANOM       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_XANCP       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_XANC8       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_XANCB       VRLIVAEQLYRAAAMLANHPYHRA-----
RLMH_STRMK       VRLVVAEQLYRAAAMIANHPYHRA-----
RLMH_STRM5       VRLVVAEQLYRAAAMLANHPYHRA-----
RLMH_XYLFT       VRLIVVEQLYRAATILTNHPYHRGK----
RLMH_XYLF2       VRLIVVEQLYRAATILTNHPYHRGK----
RLMH_XYLFM       VRLIVVEQLYRAATILTNHPYHRGK----
RLMH_XYLFA       VRLIVVEQLYRAATILTNHPYHRGK----
RLMH_PSEAE       VRILVGEQIYRAWTVLSGHPYHK------
RLMH_PSEA7       VRILVGEQIYRAWTVLSGHPYHK------
RLMH_PSEAB       VRILVGEQIYRAWTVLSGHPYHK------
RLMH_PSEMY       VRILLGEQIYRAWTVLSGHPYHK------
RLMH_PSEU5       VRILIGEQIYRAWTLLSGHPYHK------
RLMH_PSEP1       VRILIGEQIYRAWTVLSGHPYHK------
RLMH_PSEPK       VRILIGEQIYRAWTVLSGHPYHK------
RLMH_PSEPG       VRILIGEQIYRAWTVLSGHPYHK------
RLMH_PSEPW       VRILIGEQIYRAWTVLSGHPYHK------
RLMH_PSEE4       VRILIGEQIYRAWTVLSGHPYHK------
RLMH_PSEU2       VRILIGEQMYRAWTVLSGHPYHK------
RLMH_PSESM       VRILIGEQMYRAWTVLSGHPYHK------
RLMH_PSE14       VRILIGEQMYRAWTVLSGHPYHK------
RLMH_PSEF5       VRILIGEQLYRAWTVLSGHPYHK------
RLMH_PSEPF       VRILIGEQLYRAWTVLSGHPYHK------
RLMH_CHRSD       VRILLAEQLYRAWTLLAGHPYHR------
RLMH_HAHCH       VRVLLAEQLYRAWTILQGHPYHRE-----
RLMH_MARHV       VRILLAEQLYRAWTITRNHPYHRA-----
RLMH_SACD2       VRVLLIEQLYRAWTILQNHPYHK------
RLMH_CELJU       VRILLIEQLYRACTILQNHPYHK------
RLMH_MARMS       VRVILAEQIYRAWTLMNNHPYHR------
RLMH_ALCBS       VRVLLAEQLYRGWTLLTGHPYHR------
RLMH_ALKEH       VRVLLAEQLYRAWSLLQGHPYHRA-----
RLMH_ACIAC       VRVLLIEQLYRAWSVNAGHPYHRE-----
RLMH_ACISJ       VRVLLIEQLYRAWSVNAGHPYHRE-----
RLMH_DELAS       VRVLLIEQLYRAWSVNAGHPYHRE-----
RLMH_RHOFT       VRVLLIEQLYRAWSINANHPYHRE-----
RLMH_POLNA       VRVLLIEQLYRAWSITINHPYHRE-----
RLMH_POLSJ       VRVLLIEQLYRAWSITINHPYHRE-----
RLMH_VEREI       VRVLLIEQLYRAWSLHAGHPYHRE-----
RLMH_METPP       ARVLLAEALYRAWSVNAGHPYHRE-----
RLMH_LEPCP       VRVMLAEALYRAWTLSIGHPYHRE-----
RLMH_AZOSB       VRPLLAEALYRAWTVTRNHPYHRE-----
RLMH_AROAE       VRPLLAEALYRAWSVLKNHPYHRE-----
RLMH_BORBR       VRVLLAEQLYRAWAIMTNHPYHRA-----
RLMH_BORPE       VRVLLAEQLYRAWAIMTNHPYHRA-----
RLMH_BORPA       VRVLLAEQLYRAWAIMTNHPYHRA-----
RLMH_BORA1       VRVLLSEQLYRAWAILTNHPYHRA-----
RLMH_BORPD       VRVVLAEQLYRAWAILANHPYHRA-----
RLMH_BURCA       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURCH       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURCC       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURCJ       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURL3       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURCM       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURA4       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURVG       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURM1       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURMA       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURM9       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURM7       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURMS       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURPS       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURP0       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURP1       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURP6       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_BURTA       VRVLLAEQLYRAWSITQNHPYHRA-----
RLMH_PARXL       VRVLLAEQLYRAWTITQNHPYHRV-----
RLMH_PARP8       VRVLLAEQLYRAWTITQNHPYHRV-----
RLMH_PARPJ       VRVLLAEQLYRAWTITQNHPYHRV-----
RLMH_CUPNH       VRVLLAEQLYRAWSVTQNHPYHRA-----
RLMH_CUPTR       VRVLLAEQLYRAWSVTQNHPYHRA-----
RLMH_CUPPJ       VRVLLAEQLYRAWSVTQNHPYHRA-----
RLMH_CUPMC       VRVLLAEQLYRAWSVTQNHPYHRA-----
RLMH_RALSO       VRVLLAEQLYRAWSITQNHPYHRV-----
RLMH_RALPJ       VRVLLAEQLYRAWSITQNHPYHRV-----
RLMH_HERAR       VRVMLAEQLYRAWSITQNHPYHRV-----
RLMH_JANMA       VRVLLAEQLYRAWSITQNHPYHRV-----
RLMH_POLAQ       ARVLLVEQLYRAWTILQGHPYHRE-----
RLMH_POLNS       ARVLLVEQLYRAWTILQGHPYHRE-----
RLMH_NEIG1       VRVLLTEQLYRAVSILHNHPYHRE-----
RLMH_NEIG2       VRVLLTEQLYRAVSILHNHPYHRE-----
RLMH_NEIMA       VRVFLTEQLYRAVSILHNHPYHRE-----
RLMH_NEIMB       VRVFLTEQLYRAVSILHNHPYHRE-----
RLMH_NEIMF       VRVLLTEQLYRAASILHNHPYHRE-----
RLMH_NEIM0       VRVLLTEQLYRAASILHNHPYHRE-----
RLMH_CHRVO       VRVMLAEQIYRAYSILNNHPYHRE-----
RLMH_NITEU       ARVLLAEQLYRAFSINRNHPYHRA-----
RLMH_NITEC       ARVLLAEQLYRAFSITRNHPYHRA-----
RLMH_NITMU       VRILLAEQLYRAISLIKGHPYHRA-----
RLMH_DECAR       ARLLLCEQLYRAVSVLKNHPYHREG----
RLMH_METFK       VRVMLSEQLYRGLSVINNHPYHRE-----
RLMH_THIDA       ARVILAEQLYRAACIIKGHPYHRD-----
RLMH_HALHL       VRVLVAEQVYRAWTLLSGHPYHRS-----
RLMH_NITOC       VRVILAEQIYRAFSLLNRHPYHRAS----
RLMH_HYDCU       VRVMVAEQIYRAWSVLQNHPYHRE-----
RLMH_ACIF5       VRVVLAEQLYRAWSIQAGLPYHRGGEE--
RLMH_ACIBC       VRILLIEQLYRAMSINHNHPYHRA-----
RLMH_ACIBY       VRILLIEQLYRAMSINHNHPYHRA-----
RLMH_ACIBT       VRILLIEQLYRAMSINHNHPYHRA-----
RLMH_ACIBS       VRILLIEQLYRAMSINHNHPYHRA-----
RLMH_ACIAD       VRILLIEQLYRAMSINHNHPYHRA-----
RLMH_PSYA2       VRVVLMEQLYRAMSINHNHPYHRGN----
RLMH_PSYCK       VRVVLMEQLYRAMSINHNHPYHRGN----
RLMH_PSYWF       VRVVLMEQLYRAMSINNNHPYHRGN----
RLMH_FRAP2       VRIIIAEQLYRAYTILEGHPYHK------
RLMH_FRATN       VRIIIAEQLYRAYTILEGHPYHK------
RLMH_FRATH       VRII-AEQLYRAYTILEGHPYHK------
RLMH_FRATF       VRII-AEQLYRAYTILEGHPYHK------
RLMH_FRATO       VRII-AEQLYRAYTILEGHPYHK------
RLMH_GRABC       VRPLLAEQLYRAQAIATNHPYHRTGRPSG
RLMH_GLUDA       IRGLLAEQLYRARAIASGHPYHRAGRPA-
RLMH_ACICJ       ARAVLAEQLYRAQCILAGHPYHRAGRP--
RLMH_GLUOX       VRVLIAEQVFRAQAINTGHPYHRESRPD-
RLMH_MAGMM       VRVMLAEQLYRAMTLQHGVPYHR------
RLMH_SOLUE       ARAMLAEQIYRGFCTLRNHPYIR------
RLMH_RHIL3       VRTLIAEQLYRAVTILSGHPYHRV-----
RLMH_RHILW       VRILIAEQLYRAVTILSGHPYHRV-----
RLMH_RHIEC       VRTLIAEQLYRAVTILSGHPYHRV-----
RLMH_RHIE6       VRTLIAEQLYRAVTILSGHPYHRV-----
RLMH_RHIME       VRILIAEQLYRAVTILSGHPYHRA-----
RLMH_SINMW       VRILIAEQLYRAVTILSGHPYHRA-----
RLMH_AGRFC       VRILIAEQLYRAVTILSGHPYHRV-----
RLMH_BRUAB       ARILIAEQLYRAATILAGHPYHRS-----
RLMH_BRUA1       ARILIAEQLYRAATILAGHPYHRS-----
RLMH_BRUA2       ARILIAEQLYRAATILAGHPYHRS-----
RLMH_BRUO2       ARILIAEQLYRAATILAGHPYHRS-----
RLMH_BRUME       ARILIAEQLYRAATILAGHPYHRS-----
RLMH_BRUSU       ARILIAEQLYRAATILAGHPYHRS-----
RLMH_OCHA4       ARILIAEQLYRAATILAGHPYHRS-----
RLMH_CHESB       VRVMLAEQLYRLITILSGHPYHRD-----
RLMH_RHILO       VRVMLGEQLYRVATILSGHPYHRA-----
RLMH_BARHE       ARILLTEQLYRAVTIASNHPYHRF-----
RLMH_BART1       ARILLTEQLYRAVTIANHHPYHRF-----
RLMH_BARBK       ARILLTEQLYRTVTIANNHPYHRF-----
RLMH_AZOC5       VRAMLAEQVYRATTILAGHPYHRA-----
RLMH_XANP2       VRVMLAEQIYRAVTILAGHPYHRA-----
RLMH_METPB       VRVLALEQVYRALTILAGHPYHRGDPEA-
RLMH_METEP       VRVLALEQVYRALTILAGHPYHRGDPEA-
RLMH_METRJ       VRVLALEQLYRSLTILAGHPYHRGEAG--
RLMH_METS4       VRVLVLEQLYRVMTILAGHPYHRGAP---
RLMH_BRASB       VRVLLFEQIYRTATILAGHPYHRA-----
RLMH_BRASO       VRVLLLEQIYRTATILAGHPYHRA-----
RLMH_BRADU       VRVMLLEQLYRAATILAGHPYHRA-----
RLMH_RHOPA       VRVMLLEQIYRAATILAGHPYHRA-----
RLMH_RHOPT       VRVMLLEQIYRAATILAGHPYHRA-----
RLMH_RHOPS       VRVMLLEQIYRAATILAGHPYHRA-----
RLMH_RHOP2       VRVMLLEQIYRAATILAGHPYHRA-----
RLMH_RHOP5       LRVMLLEQIYRAATILAGHPYHRA-----
RLMH_RHOPB       VRVMLLEQLYRAATILSGHPYHRA-----
RLMH_NITHX       VRVMLLEQIYRAATILAGHPYHRG-----
RLMH_NITWN       VRVMLLEQIYRAATILAGHPYHRG-----
RLMH_OLICO       VRILLLEQIYRAGTILAGHPYHRA-----
RLMH_BEII9       VRIMAAEQIYRAMTILGHHPYHRA-----
RLMH_CAUVC       ARAMLAEQIYRAATILSGSPYHRD-----
RLMH_CAUSK       ARAMLAEQVYRAVTILAGSPYHRD-----
RLMH_PHEZH       ARAMLAEQVYRAVSILAGSPYHRD-----
RLMH_HYPNA       VRAMLAEQLYRAMTILAGTPYHKA-----
RLMH_RUEPO       VRVMLAEQLYRAATILAGSPYHRV-----
RLMH_RUEST       VRLMLAEQVYRSATILSGSPYHRV-----
RLMH_ROSDO       VRVMLAEQLYRAASILAGAPYHRN-----
RLMH_DINSH       ARVMLAEQLYRAAAILAGTPYHRV-----
RLMH_RHOS4       VRVMLAEQLYRAATILAGSPYHRV-----
RLMH_RHOS1       VRVMLAEQLYRAATILAGSPYHRV-----
RLMH_RHOS5       VRVMLAEQLYRAATILAGSPYHRV-----
RLMH_PARDP       VRVMLAEQIYRATTILAGNPYHRE-----
RLMH_MARMM       VRVMLAEQLYRAVSILAGTPYHRD-----
RLMH_MAGSA       VRALLAEQLWRAHSILTGHPYHRP-----
RLMH_RHOCS       VRGMLAEQIYRAQQILAGHPYHRA-----
RLMH_PARL1       VRVMLAEQLYRAVTILSGHPYHRA-----
RLMH_RHORT       VRGLIAEQLYRAQCISGGHPYHRS-----
RLMH_NOVAD       ARAMLAEQLWRATSILAGHPYHREG----
RLMH_SPHWW       ARAMLAEQLWRATSILAGHPYHREG----
RLMH_SPHAL       ARAMLAEQLWRATSIIAGHPYHREGRQ--
RLMH_ERYLH       ARAMLMEQLYRATSILAGHPYHRAG----
RLMH_ZYMMO       ARAMLAEQLWRASAILSGHPYHREG----
RLMH_KORVE       ARVVLLEQLYRGYTILTGHPYHGGH----
RLMH_DEIGD       AMILLLEALYRAATISAGEPYHRGST---
RLMH_DEIRA       AMLVLVEALYRAATISAGEPYHRG-----
RLMH_THET2       ALLVLMEQLYRVLTLRAGHPYHRP-----
RLMH_THET8       ALLVLMEQLYRVLTLRAGHPYHRP-----
RLMH_AKKM8       ALVVLLEQLYRCHTILAGTPYHR------
RLMH_RUBXD       ARVVLLEQLYRAVKILRGERYHW------
RLMH_SORC5       ARLVLIEQLYRAMTLLRGEPYAH------
RLMH_ANADE       ARLVLVEQLYRAMTILRGEPYHK------
RLMH_ANASK       ARLVLVEQLYRAMTILRGEPYHK------
RLMH_ANADF       ARLVLVEQLYRAMTILRGEPYHK------
RLMH_MYXXD       ARVVLIEQLYRAFTILKGEPYHK------
RLMH_GLOVI       ARVIVLEQLYRAVTILAGHPYHHG-----
RLMH_PROMA       ARLILAEQLYRAISIAKGSPYHRE-----
RLMH_PROM4       ARLLLIEQLYRAKNICEGGSYHRN-----
RLMH_PROMM       ARLLLVEQLYRAQTITQGGKYHRS-----
RLMH_PROM3       ARLLLVEQLYRAQTILQGGKYHRGS----
RLMH_SYNS3       ARLLLIEQLFRAQAILQGSPYHRA-----
RLMH_SYNPW       ARLLLLEQLFRAQAILQGSPYHRA-----
RLMH_SYNSC       ARLMLVEQLFRAQAIVQGSPYHRA-----
RLMH_SYNS9       ARLMLVEQLFRAQSIVQGRPYHRA-----
RLMH_SYNPX       ARLMLIEQLFRAQAILQGSPYHRA-----
RLMH_PROM1       ARLLLIEQLYRAKTITQGGPYHKE-----
RLMH_PROMT       ARLLLIEQLYRAKAITQGGPYHKE-----
RLMH_SYNR3       ARLMLVEQLYRASTILQGGPYHRS-----
RLMH_PROMS       ARLILIEQIYRAISISNNSPYHRS-----
RLMH_PROM0       ARLILIEQIYRAISISNNSPYHRS-----
RLMH_PROM9       ARLILIEQIYRAISISNNSPYHRS-----
RLMH_PROM2       ARLILIEQIYRAVSISSNSPYHRS-----
RLMH_PROMP       ARLILIEQIYRAISISNNSPYHRA-----
RLMH_PROM5       ARLILVEQIYRVISISNGSPYHRA-----
RLMH_CAMC1       AKLVLFEQIFRGLCINANHPYHK------
RLMH_CAMC5       AKLVLFEQIFRGLCINANHPYHK------
RLMH_CAMFF       AKLMLFEQIFRGLCINANHPYHK------
RLMH_CAMHC       AKLMLFEQIFRGLCINAGHPYHK------
RLMH_CAMJE       VKTLLLEQIYRAFCINNNHPYHK------
RLMH_CAMJR       VKTLLLEQIYRAFCINNNHPYHK------
RLMH_CAMJJ       VKTLLLEQIYRAFCINNNHPYHK------
RLMH_CAMJ8       VKTLLLEQIYRAFCINNNHPYHK------
RLMH_CAMJD       VKTLLLEQIYRAFCINNNHPYHK------
RLMH_HELPS       AKIVLCEQIYRALSIIFKHPYHK------
RLMH_HELPG       AKIVLCEQIYRALSIIFKHPYHK------
RLMH_HELPY       AKIVLCEQIYRALSIIFKHPYHK------
RLMH_HELPH       AKIVLCEQIYRALSIIFKHPYHK------
RLMH_HELP2       AKIVLCEQIYRALSIIFKHPYHK------
RLMH_HELPJ       AKIVLCEQIYRALSIIFKHPYHK------
RLMH_HELAH       AKIVLCEQIYRALSIIFRHPYHK------
RLMH_HELHP       AKLVLCEQIYRALSILHSHPYHK------
RLMH_SULDN       AKVVLLEQIYRGFSILSNHPYHK------
RLMH_ARCB4       ANVVLTEQIFRSLCIQNNHPYHK------
RLMH_SULNB       VKVVLMEQIFRGLTINHNHPYHK------
RLMH_NITSB       AKMVLLEQLFRGLSIIHNHPYHK------
RLMH_WOLSU       AKVVLCEQIYRGLTIMHNHPYHK------
RLMH_FERNB       CVILFLEQTFRAFKILKNEKYHY------
RLMH_THEM4       ALILLLEQLFRGFKIINNEKYHY------
RLMH_PSELT       AVVILLEQLFRAFKIINNQKYHY------
RLMH_DICT6       ALLILLEQIYRALKIQRNEPYHY------
RLMH_PETMO       AVLILLEQLFRVNKILHNETYHY------
RLMH_THEP1       TVLIVLEQIFRAFKIIHGENYHY------
RLMH_THESQ       TVLIVLEQIFRAFKIIHGENYHY------
RLMH_THEMA       TVLIVLEQIFRAFKIIHGENYHY------
RLMH_THEYD       SRLLLLEQLYRAITIIHGKSYHY------
RLMH_FUSNN       MRLILLEQVYRWFAISNNIKYHK------
RLMH_MYCPE       FRLILLEQIYRAFSILNNTKYHK------
RLMH_MYCCT       CRIVLIEQIYRVFKIINNEKYHK------
RLMH_MYCMS       CRIVLIEQIYRVFKIINNEKYHK------
RLMH_MESFL       FRIILAEQIYRAFKIMNNEKYHK------
RLMH_MYCH2       FKLIVLEQIYRGFSIKFNRKYHHAD----
RLMH_MYCHJ       FKLIVLEQIYRGFSIKFNRKYHHAD----
RLMH_MYCH7       FKLIVLEQIYRGFSIKFNRKYHHAD----
RLMH_MYCMO       FRILLVEQIYRSFTILKGIKYHK------
RLMH_MYCA5       FRVILIEQIYRGFAINNNIKYHK------
RLMH_MYCS5       FRVILIEQIYRAFTIKNNLKYHK------
RLMH_MYCPU       FHLMLIEQIYRGFSILNNKIYHK------
RLMH_MYCAP       FRIMLIEQIYRAFMILNNSKYHK------
RLMH2_THEP3      ASTILFEQLYRAYKILNNEPYHK------
RLMH1_THEPX      ASTILFEQLYRAYKILNNEPYHK------
RLMH1_CALS4      IATLLAEQLYRAYKILRNEPYHK------
RLMH_PARUW       TRLILIEQIYRATEILKNSQYHK------
                    .  *  :