CLUSTAL format seed alignment for MF_00659

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y488_BUCAI       --------MKTKLREMLRFPCF-FTYKIIGLAQPELIDQIIKVIQIQIPGDYTP--QVKS
Y472_BUCAP       --------MKTKLREMLKFPCF-FTYKIIGLAQPELVDQIIKVIQIQIPGDYTP--QVKS
Y432_BUCBP       -------MRKNKLEKMLKFPCL-FTYKVIGLAQPELVDKIVKIIQCKLPGDYVP--QIKS
YBED_ECOLI       --------MKTKLNELLEFPTP-FTYKVMGQALPELVDQVVEVVQRHAPGDYTP--TVKP
YBED_SALTY       --------MKTKLNELLEFPTP-FTYKVMGQALPELVDQVVEVVQRHAPGDYSP--TVKP
Y2600_YERPE      --------MKTKLNELLEFPCS-FTYKVMGIAEPQLVDQVVEVVQRHAPGEYTP--QVKP
Y945_VIBCH       ---MLNINSDAKLKDLLEFPCS-FTYKVMGHAKPELPERVLEVIQRHAPGDYSP--RVKP
Y718_VIBPA       ---MLTINSDAKLKDLLEFPCS-FTYKVMGHAKPELPELVLEVIQRHAPGDYSP--KVKP
Y282_VIBVU       ---MLTINSDAKLKDLLEFPCS-FTYKVMGYAKPELPEKVLEVIQRHAPGDYSP--AVKP
Y1380_NEIMA      -----MTEQKNK-TSLIEFPCT-FPLKVMGAVHPEFEQAVLDTVRLHAPDTQAHHITTRP
Y326_RALSO       MTDANDTPATPPRESLIEYPSD-FPIKVMGKMQDDFAETIVQLVQQFDPEFHTGRMEMRP
Y3998_PSEAE      -----MTDTPDVQPPKIEFPCERYPIKVIGDAGEGFSDLVVEIIQRHAPDLDVETLVVRD
Y4802_PSEPK      ------MSEPDVKSHKIEFPCDDYPIKVIGDTVVGFKDMVIEVLSKHAKVDLS-TLAERQ
Y4820_PSESM      -----MTDTDIK-SHKIEFPCVDYPIKVIGDTSAGFTAAVMEVLEKHAQVD-AKTLAERQ
Y028_HAEIN       ---MTIENDYAKLKELMEFPAK-MTFKVAGINREGLAQDLIQVVQKYIKGDYIP--KEKR
Y1928_PASMU      -------MPQAKLKDLLEFPCA-FTFKVVGANRADLIDDVVVVVQKYAKGDYNP--RQQL
Y1163_SHEON      -------MLNTKFDELMEFPCA-FPFKVVGDAHETLTDRVVAVVQKHAPGDYSP--TVKA
Y666_XANAC       MDISTDNPDHG-----FQFPGT-FELSAMGTAERGLETELPRLLAATGVELLQESVSWKH
Y3453_XANCP      MEISSDNPDHG-----FQFPGT-FELSAMGTAERGLETELPRLLAATGVELLEESISWKH
Y1271_XYLFA      MEIKSDHSEHG-----FQFPGT-FELSAVGTAGKALETELPRLLARCGVELVQERISWKH
Y532_XYLFT       MEIKSDHSEHG-----FQFPGT-FELSVVGTAGKALETELPRLLALCGVELVQERISWKH
                                 :.:*      .  *     :   :   :              : 

Y488_BUCAI       SNRGNYLSVSITICAKNFEQIECLYHEISKINIVRMVL
Y472_BUCAP       SNRGNYLSVSITICAKNFEQIETLYHDISKINMVRMVL
Y432_BUCBP       SNKGNYLSISITICANTFEEIESLYYELSNINIVRMVL
YBED_ECOLI       SSKGNYHSVSITINATHIEQVETLYEELGKIDIVRMVL
YBED_SALTY       SSKGNYHSVSITINATHIEQVETLYEELGNIDIVRMVL
Y2600_YERPE      SSKGNYHSVSITITATHIDQVETLYEELGNLELVKMVL
Y945_VIBCH       SAKGNYHSVSVTIHATSIEQVEILYKELGEIDIVRMVL
Y718_VIBPA       SAKGNYHSVSINITATSIEQVETLYKELGEIDIVRMVL
Y282_VIBVU       SAKGNYHSVSINITATSIEQVETLYKELGEIDIVRMVL
Y1380_NEIMA      SSKGNYTGATVQVKVENQEQLDNIYRALTSHELVKVVL
Y326_RALSO       SSGGNYLGLTVIVRATSREQLDALYRALTAHPMVKVVL
Y3998_PSEAE      SSKGRFLSVQVLITATDVDQLQAIHNDLRATGRVHMVL
Y4802_PSEPK      SKEGKYTTVQLHIVAESENQLHDINSALRATGIVKMVL
Y4820_PSESM      SSNGKYTTVQLHIIATSEDQLRDINSALRATGFVHMVL
Y028_HAEIN       SSKGTYNSVSIDIIAENFDQVETLYKELAKVEGVKMVI
Y1928_PASMU      SSKGTYNSVSIDIIAEHIEQVEVLYVELAKIDGVRMVL
Y1163_SHEON      SSKGSYYSVTIRVTVTSKDHIETLYTELANIEGVRRVL
Y666_XANAC       SSSGKYVSVKIGFRAQSREQFEAAHQALRDHPEVKWTL
Y3453_XANCP      SSSGKYVSVRIGFRADTREQFDSAHQALREHPEVKWTL
Y1271_XYLFA      SSTGKYVSVRISFRALDREQYDAAHQVLRDHPEVKWTL
Y532_XYLFT       SSTGKYVSVRIGFRALDREQYDAAHQVLRDHPEVKWTL
                 *  * :    : . .   :.       :     *: .: