CLUSTAL format seed alignment for MF_00661

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RHLB_HAMD5        ------------------------------------------------------------
RHLB_ECOLI        ------------------------------------------------------------
X2H190_9GAMM      ------------------------------------------------------------
RHLB_PHOPR        ------------------------------------------------------------
RHLB_AERHH        ------------------------------------------------------------
RHLB_HAEIN        ------------------------------------------------------------
F4HAT0_GALAU      ------------------------------------------------------------
RHLB_PSYIN        ------------------------------------------------------------
RHLB_SHEAM        ------------------------------------------------------------
RHLB_PSEA6        ------------------------------------------------------------
Q48AH1_COLP3      ------------------------------------------------------------
Q3IDI9_PSET1      ------------------------------------------------------------
RHLB_IDILO        ------------------------------------------------------------
C7R9Y4_KANKD      ------------------------------------------------------------
W8KEA6_9GAMM      ------------------------------------------------------------
D3SEQ2_THISK      ------------------------------------------------------------
L0GXY7_9GAMM      ------------------------------------------------------------
I3YBS6_THIV6      ------------------------------------------------------------
S6BG71_9GAMM      ------------------------------------------------------------
V4JG62_9GAMM      ------------------------------------------------------------
RHLB_XANAC        ------------------------------------------------------------
RHLB_XYLFT        ------------------------------------------------------------
H8KZW2_FRAAD      ------------------------------------------------------------
M4NKJ1_9GAMM      ------------------------------------------------------------
K0C868_CYCSP      ------------------------------------------------------------
I1YHJ7_METFJ      ------------------------------------------------------------
Q3J811_NITOC      ------------------------------------------------------------
H8GKI6_METAL      ------------------------------------------------------------
R4V3K2_9GAMM      ------------------------------------------------------------
Q0A6X5_ALKEH      ------------------------------------------------------------
A1WYL7_HALHL      ------------------------------------------------------------
A5EYB1_DICNV      ------------------------------------------------------------
B3E4Q8_GEOLS      ------------------------------------------------------------
Q3A6L3_PELCD      ------------------------------------------------------------
D5MJD9_9BACT      ------------------------------------------------------------
E1QG61_DESB2      ------------------------------------------------------------
B8FIL9_DESAL      ------------------------------------------------------------
K4KN61_SIMAS      -------MIVKFIKNLVSNDSSAGTKPAAGSAKRPKKTANKHQAQSSPQAGGANAAGGER
A4A5A5_9GAMM      ------------------------------------MTSSKRSQHSS-------------
C5BSZ2_TERTT      ------------------------------------MCLLLRMCTKPPLI----------
Q21N47_SACD2      ------------------------------------------------------------
RHLB_PSESM        ------------------------------------------------------------
Q1QX32_CHRSD      ------------------------------------MSESDKTSAPAQNR----------
K0CCW2_ALCDB      ------------------------------------------------------------
Q6FCM5_ACIAD      ------------------------------------------------------------
M5DS63_9GAMM      -------------MLKKLLKAVSGKSKAPTNTPPKQQSKSTADTKKPAVAKTSTANKGSK
A6VX62_MARMS      -------------MENQTQEAPSETTAKPKRTRRPNKRPRSNDDSSASVRENAQ------
A8ZRU7_DESOH      --------------------------------------------------MQTDPNTQTK
A0LLL9_SYNFM      MAYTLVTNLFGCTRRLRSKEERKEREETAPTVSEPEPAASSDTAATAPVADDTAPGERPK
E6W520_DESIS      MLRYILNKIRKLPLRKLKGQSSQSSSVAENTTDTTSPKPLYKSQRKKSAKTAPKPKETPN
D6Z2Z3_DESAT      ----MISKLIQRIRRRLRTGSDATAQTDHKPADDTLQTADFGAIATGAATSGETDESRPQ
I5B4L5_9DELT      -------------MKKLINFIKKLFAGK---------QKKQNAG--TTISEPRKPEP--T
C0QD57_DESAH      ------------MIRFFSSLIKRLFRQEPPKPTEPVIRKKQPPGDDTSIPTRKKTETSQP
Q6APU7_DESPS      ----MLKKLGRSIRRKFQSVFPQSGAGKDSLQEREVKQVQEVVAVPASSSASTSSPALSP
M1PCR9_DESSD      ----------------MTSVKPVS--------------VVEKVEIPVVAKAAPAPKPQR-
D5VC57_MORCB      ------------------------------------MTETTV------------------
A5WDI1_PSYWF      --------------------------------------MDEF------------------
M1FKF3_9ALTE      ------------------------------------MTIDNNPTDSNPTSAADNNISSA-
Q2SJR0_HAHCH      ------------------------------------MTVSDQTTDN--------------
                                                                              

RHLB_HAMD5        -----------------------------------------------MNKTHLTDQKFSD
RHLB_ECOLI        -----------------------------------------------MSKTHLTEQKFSD
X2H190_9GAMM      -----------------------------------------------MIPSYLTKTTFSQ
RHLB_PHOPR        -----------------------------------------------MKTTHITEQKFAD
RHLB_AERHH        -----------------------------------------------MSKTHLTTDKFAQ
RHLB_HAEIN        -----------------------------------------------MQQDYLSQQRFSA
F4HAT0_GALAU      -----------------------------------------------MEHQYLTSTKFSD
RHLB_PSYIN        -----------------------------------------------MNKTHLTQTKFAD
RHLB_SHEAM        -----------------------------------------------MSETHLTQQKFAD
RHLB_PSEA6        -----------------------------------------------MQTTHLTETHFAD
Q48AH1_COLP3      -----------------------------------------------MKKTHLTETKFAD
Q3IDI9_PSET1      ----------------------------------------------------MTDKKFSD
RHLB_IDILO        -----------------------------------------------MTKKHLTETRFAD
C7R9Y4_KANKD      -----------------------------------------------MDTSHLSTIRFSD
W8KEA6_9GAMM      -----------------------------------------------MTDQHVSDTHFAS
D3SEQ2_THISK      -----------------------------------------------MTDPAQETPRFDQ
L0GXY7_9GAMM      -----------------------------------------------MTETHLTDTRFDS
I3YBS6_THIV6      -----------------------------------------------MTDKHLTQVRFDG
S6BG71_9GAMM      -----------------------------------------------MSDKHLTKTRFDS
V4JG62_9GAMM      ------------------------------MLFDRSGQQQSFGNTPSMPQTHLTDTRFDS
RHLB_XANAC        -----------------------------------------------MSDKPLTDVTFSS
RHLB_XYLFT        -----------------------------------------------MSDKPLTNLNFSS
H8KZW2_FRAAD      -----------------------------------------------MSQTVLTDTTFSE
M4NKJ1_9GAMM      --------------------------------MQRITPPSGKVNHPHMSQTVLTDTFFAN
K0C868_CYCSP      -----------------------------------------------MSDTHLTDTQFSS
I1YHJ7_METFJ      ----------------------MYEAAILADHQYKTFFLISSGNASIYMSAHLTDTAFST
Q3J811_NITOC      -----------------------------------------------MTNPDFSEISFDS
H8GKI6_METAL      -----------------------------------------------MSKTHLTETRFSN
R4V3K2_9GAMM      -----------------------------------------------MEQNHLSDTRFES
Q0A6X5_ALKEH      -----------------------------------------------MKNEHLSNTRFDT
A1WYL7_HALHL      -----------------------------------------------MSETHLTDQRFTD
A5EYB1_DICNV      -----------------------------------------------MTNENKNTAHFTD
B3E4Q8_GEOLS      -------------------------------------------------------MKFSD
Q3A6L3_PELCD      -------------------------------------------------------MKFTE
D5MJD9_9BACT      ------------------------------------------------------MTTFDT
E1QG61_DESB2      --------------------------------MDDTHITPQDDTTQKSGAPLAQGAPFAD
B8FIL9_DESAL      -------------------------------MTQDSEIDQTEERA--AGPRFLTNTKFAD
K4KN61_SIMAS      KGRGKRRSGKRRDSQDSRPDNKLAQATKKA-------DQAPWDPSQFKVAPMPGKTRFHD
A4A5A5_9GAMM      ------RSGSSKD----------GKAANGK-------AASSWSVDEFDVAPEEGKTRFHD
C5BSZ2_TERTT      ----------------------LNFSGTTN-------AMSDDTHSAVPSDKPAPKIAFST
Q21N47_SACD2      --------------------------------------------------MHKNNLSFEE
RHLB_PSESM        ------------------------------------------------MEPQEGKTRFHD
Q1QX32_CHRSD      -------------------KPKRRRRKPRR-------SQSQWDIKQFQVPPVAGKWRFHD
K0CCW2_ALCDB      ----------------------MRQDK-----------TSDWDLDQFQVPEKEGEVRFHD
Q6FCM5_ACIAD      -----------------------------------------------------MASGFGT
M5DS63_9GAMM      PANTTAKTNGPQHAAGREKHEHKRTKANAV-------VEAPWDISQFKVEPEEGKTRFHD
A6VX62_MARMS      -------------------SNNETKLAGNA-------NSKIWSIEDFPVAEVEGKMRFHD
A8ZRU7_DESOH      KRASRRRRSRADK----PETPDTPTPAVK--------DAEPWESSQFDVPPDKNRTRFHD
A0LLL9_SYNFM      KRRPRRRQGRRSGRKPLPETPLEAGPVETPEESREPEAAEPWDIDQFQVDPEEGKTRFHD
E6W520_DESIS      TEPERVPRSGGKKR---RASAEKTEQTVRP-------ESTPWTPEVFQVDPQEGRVRFHD
D6Z2Z3_DESAT      KRRRRRKRKPKADQ---PATADQAATTPE---------AANWSLEDFQVPPAEGKTRFHD
I5B4L5_9DELT      TAPHNRDAGTVEK---------PRQKIR----------KPSWTLENFQVEPQEGKTRFHD
C0QD57_DESAH      QSPETRHSPPIETG--------PGEKVRPGDGVRPHKKREPWTLDHFQVPTQEGKTRFHD
Q6APU7_DESPS      SPAPVAPVEEVVRK--------KPQPKRKP----------PWTLDKFVVPELEEKKRFHD
M1PCR9_DESSD      QPAGKAAASTPLDR--------NQQGKRKPR---------KWTVSQFPVETEEGKTRFHD
D5VC57_MORCB      -------------------------------------------------------KNFDD
A5WDI1_PSYWF      -------------------------------------------------------ITFAD
M1FKF3_9ALTE      -------------------------------------SDSPVIDSPTVDRSHTSDLRFSD
Q2SJR0_HAHCH      ------------------------------------------------------AVLFSS
                                                                           *  

RHLB_HAMD5        FALHPLVIKAIENQGFYHCTPIQALSFPITLAGRDVAAQAQTGTGKTLAFLASVFNYLLT
RHLB_ECOLI        FALHPKVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKTMAFLTSTFHYLLS
X2H190_9GAMM      FPLHPLVIKALDKKGFTYCTPIQEQTLPLTTNGIDIAGQGQTGTGKTIAFLASTFNHLLN
RHLB_PHOPR        LGLEPTVLEGLDAQGFHYCTPIQALALPVVLTGQDIAGQAQTGTGKTLAFLTATFNYLLL
RHLB_AERHH        MGLEPEVLAGLESKGFHYCTPIQALSLPLLVEGHDLAGQAQTGTGKTLAFLAATFNYLLT
RHLB_HAEIN        LPLHPIVRGALAKKGFDFCTPIQALSLPISLNGRDVAGQAQTGTGKTMAFLTATFHHLLT
F4HAT0_GALAU      FNLHPNILSALQKMGMTYCTPIQADSLPYSLAGKDIAGQAQTGTGKTVAFLTALFQKLIQ
RHLB_PSYIN        LPLEKSLISGLTSQGYEYCTPIQALSLPITLTGKDIAGQAQTGTGKTLAFLPAVFHHLLT
RHLB_SHEAM        LPLCDEVKQALNENGFEHCTPIQALSLPVLLEKKDIAGQAQTGTGKTLAFLVATFNHLLT
RHLB_PSEA6        LPINEQVVKALSAANFSHCTPIQALSLPPLLEGNDIAGQAQTGTGKTIAFLVATFHYLLS
Q48AH1_COLP3      LNLAPQVVTGLEAMGFDYCTSIQAKSLPVLLQGTDLAGQAQTGEGKTIAFLAATFHHLLQ
Q3IDI9_PSET1      FAIAPEVVAGLTESGFEYCTPIQAKCLPFICEGRDIAGQAQTGTGKTLAFLTATCHRLLQ
RHLB_IDILO        LALHPKIQQAISSAGFEYCTPIQALSLPVALSNRDVAGQAQTGTGKTLAFLLATFNRLMQ
C7R9Y4_KANKD      LGLDPKLLKAVADLGFEYCTPIQAKSLPLLLKGQNVAGQAQTGTGKTIAFLLAIMNDILT
W8KEA6_9GAMM      FDLPDPVRQGLTDAGFTHCTPIQGLALPPALEGKDVAGQAQTGTGKTAAFLITVFTHLLR
D3SEQ2_THISK      LDLPEAVQAGIRATGFETCTPIQALTLPIALAGRDVAGQAQTGTGKTAAFLIATFNRLLR
L0GXY7_9GAMM      FDLDTRILKALDEAGFTHCTPIQAETLPIGLAGRDVAGQAQTGTGKTAAFLIVTLQRLLT
I3YBS6_THIV6      FDLDPRILAGLADAGFSRCTPIQAETLPIALAGRDVAGQAQTGTGKTAAFLLVVMQRLLN
S6BG71_9GAMM      FPFSQALLDGIHDAGFEYCTPIQAATLPLALDGQDVAGQAQTGTGKTAAFLLAILHLLDQ
V4JG62_9GAMM      FDLDQRILNGLADAGFTYCTPIQAETLPLALAGHDVAGQAQTGTGKTAAFLVAAMQRLLT
RHLB_XANAC        FDLHPALIAGLESAGFTRCTPIQALTLPVALPGGDVAGQAQTGTGKTLAFLVAVMNRLLI
RHLB_XYLFT        FDLHPALLTGLTRAGFTLCTPIQALTLPVALAGRDIAGQAQTGTGKTLAFLVVVVNRLLS
H8KZW2_FRAAD      FDLHPLLRQGLDEAGFSRCTPIQALTLPVALTGRDVAGQAQTGTGKTCAFLVALMNRLLT
M4NKJ1_9GAMM      FDLHPLLQQGLDDSGFTRCTPIQEMTLPLALAGRDVAGQAQTGTGKTCAFLVALMNHLLT
K0C868_CYCSP      LGLTAPLIQGLDEANFIKCTPIQEQTLPISLLGNDVAGQAQTGTGKTIAFLLATYHTLLT
I1YHJ7_METFJ      LSLHENLQRGLADAGFAFCTPIQAQTLPLLLLNKDVAGQAQTGTGKTIAFLLATFQRLLS
Q3J811_NITOC      LNLAEALIQGIQKAGFAICTPIQALALPLLLAGEDVAGQAQTGTGKTASFLLATMQCLLR
H8GKI6_METAL      LELSDSILNSLDSAGFKCCTPIQDRALPLLLRDRDIAGQAQTGTGKTATFLLATFQRLLN
R4V3K2_9GAMM      LNLHESLLTGLKEAGFEHCTPIQAEALPIALKGGDVAGQAKTGTGKSAAFLLACMHRLMT
Q0A6X5_ALKEH      LGLHDALMDGIKRAGFEYCTPIQAATLPKALEGRDIAGQAQTGTGKSAAFLLAAMHRLMT
A1WYL7_HALHL      LPIHDAVLDGLDDAGLSHCTPIQAATLPRTLAGGNIAGEAQTGTGKTAAFVVATLHHLMS
A5EYB1_DICNV      FPIHSALLEALEDIHFTKTTPIQAQTLPLTLAGYDVMGIAQTGTGKTAAFLLSLMHYLMT
B3E4Q8_GEOLS      LSLPAQVLQGIHQAGFNACTPIQAQTLPLSLSGKDVAGQAQTGTGKTAAFLITLFTKLLA
Q3A6L3_PELCD      LNLPAEVQRGIDAMGFTALTPVQEQSIPLALDKKDVAAQAQTGTGKTAAFLISLFARLMS
D5MJD9_9BACT      FSLPASIARGIEAAGFTQCTPIQAETLPLALAGKDIAGQAQTGSGKTAAFLIPLFVRLLT
E1QG61_DESB2      FNLPEPLLRGLADSGYTHCTPIQERTIPLGLAGKDVAGEAQTGTGKTAAFLVPIFYHMLR
B8FIL9_DESAL      FDLPETLLEGLKDAGFERCTPIQAQVLPVALSGKDIAGQAQTGTGKTAAFLVPMFSKLLG
K4KN61_SIMAS      LDLPDPLLHAIADLGFEYASPIQAQSLPYALNGDDLVGKAQTGTGKTAAFLLAIIDELLN
A4A5A5_9GAMM      LDLHPTLMHGIAEIGFEYCSPIQAQILPHTLQGHDAIGKAQTGTGKTAAFLITIFDDLLK
C5BSZ2_TERTT      LDLSSQVARALADMGFEHCSPIQAKSLPYSLSGHDVLGKAQTGTGKTAAFLIAVFEDLLR
Q21N47_SACD2      LNLSPLVMRALSDLKFTECSAIQAKSLPFTLRGHDVLGKAQTGTGKTAAFLIALIEDLLG
RHLB_PSESM        FNLAPELMHAIQDLGFPYCTPIQAGVLGFTLKGKDAIGRAQTGTGKTAAFLISIIEQLTQ
Q1QX32_CHRSD      FDLPVPLMRAIHALGFEYCTPIQAEALAKTLLGGDVVGKAQTGTGKTAAFLISILAYFLE
K0CCW2_ALCDB      FDLELPLMRGIAETGFQYCTPIQAEVLRHTLAGADAIGRAQTGTGKTAAFLITVINDLLR
Q6FCM5_ACIAD      LNLHPQLKQAIDALGFTQMTPIQQKVLKYTLAGHDAIGRAQTGTGKTAAFLISVINDLLN
M5DS63_9GAMM      LDLPDSVMQGIHKLGFTYCTPIQAESLPAALRGRDTIGQAQTGTGKSAAFLLTILNRLLT
A6VX62_MARMS      LNLPDRVIKSIAEMGFEYCSEIQAETLPMTLLGYDIIGQAQTGTGKTAAFLIAMISDFLD
A8ZRU7_DESOH      MDLPDALMHAIYDLGFTYCTPIQAEILPSTLAGRDAFGRAQTGTGKTAAFLISILTHMHN
A0LLL9_SYNFM      LDLPAPILRGIADAEFRYCTPIQAALLPHTLNGLDAAGRAQTGTGKTAVFIITMLTQFLR
E6W520_DESIS      LNLPEELMHAIYDLGFAYCTPIQEQVLPRAIEGKDAIGKAQTGTGKSAAFLMTIICRLLS
D6Z2Z3_DESAT      LDLPQELMRAIHASGFQYCTPIQAEILPPTLAGHDAFGKAQTGTGKSAAFLISIITRLLR
I5B4L5_9DELT      LQLTTGMMHAICDLNFKYCTEIQAQLLPHTLDGRDATAKAQTGTGKSATFIITLIDRFVR
C0QD57_DESAH      LDLPLGLMHAISDENFQYCMPVQAEVLPHTLMGKDATAKAQTGTGKSAAFLVTIIARLMK
Q6APU7_DESPS      FAIPLPLMHGIADLKFEYCTPIQEQSLEAVLAGKDLIGKANTGTGKTAVFLVGVMARLLA
M1PCR9_DESSD      FSLSPGLMHGIADLNFRYCTPIQQKSLPDVIAGKDIIGKASTGTGKSAVFLIGIFARLLG
D5VC57_MORCB      LPLSEPILKAVQALKFDQLTPIQAQILPHTLANQDAIGQAQTGTGKTATFLITIIESLLK
A5WDI1_PSYWF      LSLSDSILRSVNDLGFTELTGIQAQILPHTLAGQDAIGQAQTGTGKTATFLITIIEALLK
M1FKF3_9ALTE      LNLDHRLQQAIAAIGFEYCTPIQAETLPWTLACQDLIGQAQTGTGKTAAFLITAIQTMLE
Q2SJR0_HAHCH      LNLHPKLEQAIRDLNFERCTPIQGQTLPHTLQGADLIGQAQTGTGKTAAFLITILQRLVS
                  : :   :  .:          :*   :       :  . ..** **:  *:      :  

RHLB_HAMD5        NAADE---------------------------------------------------TRQC
RHLB_ECOLI        HPAIA---------------------------------------------------DRKV
X2H190_9GAMM      HEPLP---------------------------------------------------DHKA
RHLB_PHOPR        NPASD---------------------------------------------------ERKT
RHLB_AERHH        HPLTK---------------------------------------------------PRLI
RHLB_HAEIN        HQDPN----------------------------------------------------LKY
F4HAT0_GALAU      EPAS-------------------------------------------------------H
RHLB_PSYIN        NAQPE---------------------------------------------------NRRK
RHLB_SHEAM        TPVPE---------------------------------------------------HRQL
RHLB_PSEA6        NPQPT---------------------------------------------------K---
Q48AH1_COLP3      KEAPT---------------------------------------------------H---
Q3IDI9_PSET1      SSKAP---------------------------------------------------S---
RHLB_IDILO        NESSE---------------------------------------------------KTE-
C7R9Y4_KANKD      LPEIE---------------------------------------------------GRRK
W8KEA6_9GAMM      HPAPE---------------------------------------------------QRRP
D3SEQ2_THISK      QAPAP---------------------------------------------------DRRA
L0GXY7_9GAMM      NPRP---------------------------------------------------DATEV
I3YBS6_THIV6      TPPP---------------------------------------------------PPGQI
S6BG71_9GAMM      EPAD---------------------------------------------------QRRRA
V4JG62_9GAMM      CSDPIADLQPDSAWDSAPNSELESEAEFAGVSEHAAAMTLPTKTDLATVVKPDRQRADKA
RHLB_XANAC        RPALADRKP---------------------------------------------------
RHLB_XYLFT        SPGLVNRNP---------------------------------------------------
H8KZW2_FRAAD      QPAMATRKD---------------------------------------------------
M4NKJ1_9GAMM      TPAVAERKD---------------------------------------------------
K0C868_CYCSP      KTPADNKK----------------------------------------------------
I1YHJ7_METFJ      QPAQIDP-----------------------------------------------------
Q3J811_NITOC      EPSAGAG-----------------------------------------------------
H8GKI6_METAL      DTEAKEAANQ------------------------------------------------PI
R4V3K2_9GAMM      TPVAE-----------------------------------------------------DK
Q0A6X5_ALKEH      VPVEE-----------------------------------------------------GK
A1WYL7_HALHL      HPVEE-----------------------------------------------------DA
A5EYB1_DICNV      NPVHP-----------------------------------------------------KA
B3E4Q8_GEOLS      SPSAAADGSL--------------------------------------------------
Q3A6L3_PELCD      DKKTET------------------------------------------------------
D5MJD9_9BACT      SRHPTLS-----------------------------------------------------
E1QG61_DESB2      DQRTDR------------------------------------------------------
B8FIL9_DESAL      LENRSK------------------------------------------------------
K4KN61_SIMAS      NP--IEGE-------------------------------------------------RFA
A4A5A5_9GAMM      HP--HEGE-------------------------------------------------RFL
C5BSZ2_TERTT      QP--APEE-------------------------------------------------RFA
Q21N47_SACD2      TP--IEEE-------------------------------------------------RYA
RHLB_PSESM        TP--PPAE-------------------------------------------------RYM
Q1QX32_CHRSD      EK--APDG-------------------------------------------------QKP
K0CCW2_ALCDB      HP--LTVP-------------------------------------------------RYA
Q6FCM5_ACIAD      NP--IQEQ-------------------------------------------------RYR
M5DS63_9GAMM      N---VPAE-------------------------------------------------RFA
A6VX62_MARMS      YP--LEEK-------------------------------------------------RAN
A8ZRU7_DESOH      NP--ITAA-------------------------------------------------RKP
A0LLL9_SYNFM      NP--APEG-------------------------------------------------RRK
E6W520_DESIS      RP--Q-EK-------------------------------------------------ASI
D6Z2Z3_DESAT      EP--DTVP-------------------------------------------------RQL
I5B4L5_9DELT      TS--VK---------------------------------------------------REK
C0QD57_DESAH      NP--TRGK-------------------------------------------------REK
Q6APU7_DESPS      D---KKGG-------------------------------------------------LGK
M1PCR9_DESSD      E---QQQK-------------------------------------------------RRN
D5VC57_MORCB      RPFQADEI-------------------------------------------------RYL
A5WDI1_PSYWF      RPFADDEM-------------------------------------------------RYI
M1FKF3_9ALTE      TPIEDSK--------------------------------------------------RFA
Q2SJR0_HAHCH      NPILTEE--------------------------------------------------RFS
                                                                              

RHLB_HAMD5        EQPRALIMVPTRELAIQIYTDAETLSQFTSLKMGLAYGGDGYDKQLKILES-GVDILIGT
RHLB_ECOLI        NQPRALIMAPTRELAVQIHADAEPLAEATGLKLGLAYGGDGYDKQLKVLES-GVDILIGT
X2H190_9GAMM      NQPRAIIIAPTRELVVQIYHDAEVLSEETGLKLGLAFGGDGYDKQLKMLSA-GVDILIAT
RHLB_PHOPR        NQPRAIIMAPTRELAIQIYNDAAPLLASTGLKAGLAYGGEAYEKQQKVFAE-GVDILIGT
RHLB_AERHH        NQPRAIIMAPTRELAVQIYNDAESMSASTGLKLGLAYGGEGYDKQLAVLEQ-GVDILIGT
RHLB_HAEIN        PHPRALILAPTRELAVQISNDAEFLAKASGLKTALAYGGDGYDKQLQAIER-GVDILIGT
F4HAT0_GALAU      HTLAAIILAPTRELAVQIYHDAQHFAQTTGLKLGLAYGGDGYDKQLQALQQ-GVNILIGT
RHLB_PSYIN        NQPRAIILAPTRELAIQIHKDAMVLASMSNLRLGLAYGGEKVEIQRTKLEK-GVDILIGT
RHLB_SHEAM        NQPRAIVMAPTRELAIQIAKDATLLSKHSGLKVGIVYGGEGYEAQRKVLDK-GVDVLIGT
RHLB_PSEA6        KQPRAIIMAPTRELAVQIFNDAELLSQHTGLSLGLIYGGEGYQSQREKLEE-GVDIIIGT
Q48AH1_COLP3      NQPRALIMAPTRELAIQIHRDATEMAKSTGLRLGVVYGGEGYESQRLELEA-GVDILIGT
Q3IDI9_PSET1      KHPRALIMAPTRELAIQIHKDAKILAPHCNLNLGLVYGGEDYEKQRAQLEK-GVDILIGT
RHLB_IDILO        SGPRALIMAPTRELAIQIAHDADALIEHCGLKMGVIYGGEGYEGQKEQLAA-QPDILVGT
C7R9Y4_KANKD      NEPRSLIMAPTRELAVQIAKDAVQLAKHTDLKIRVVYGGEDHEKQRQQLID-GVDILIGT
W8KEA6_9GAMM      NQVRALILAPTRELAIQIHKDAMVLGSHTGLTLGLAYGGTDYEKQRKQLSD-GVDILIGT
D3SEQ2_THISK      TDVRALIVAPTRELAIQIHKDAEMLGRETGLKLALAYGGTGYDSQREQLEA-GADILIGT
L0GXY7_9GAMM      KDPRVLILAPTRELAVQIHRDTLALAKHTDFRIGLVYGGTGYQQQRDDLAR-GVDILIGT
I3YBS6_THIV6      SHPRALILAPTRELAVQIHRDTLLLATHTGLRAGLVYGGTGYQQQRDDLAA-GVDILIGT
S6BG71_9GAMM      NQPRALIVAPTRELAIQIHRDAEVLAGHTGHHVRVVYGGTAYEKQRKDLEA-GVDILIGT
V4JG62_9GAMM      CQPRAVILAPTRELAVQIHRDAESIGRHTGLRFGLVYGGTGYQRQRDEVAA-GVDLLIGT
RHLB_XANAC        EDPRALILAPTRELAIQIHKDAVKFGADLGLRFALVYGGVDYDKQRELLQQ-GVDVIIAT
RHLB_XYLFT        EDPRALILAPTRELAIQIYNDAVKFGGNLGLRFALIYGGVDYDRQREMLRK-GADVVIAT
H8KZW2_FRAAD      NDPRALIVAPTRELAIQIEKDARAIGGPTGLRIALIYGGVDYDKQRQQLRD-GCDIIIAT
M4NKJ1_9GAMM      SDPRALVIAPTRELAIQIEKDAKAIGRHTGLRSALIYGGVDYDKQRQQLKD-GCDIIIAT
K0C868_CYCSP      -GVRALILAPTRELAIQIANDAKIIGKHTDIKVGLAYGGTDYDKQRKTIED-GVDILIGT
I1YHJ7_METFJ      QQPRALILAPTRELAIQIAKDAALLNKYANLRIALAHGGKDYQKQRDAIAA-GCDMLIGT
Q3J811_NITOC      QQPRGLIVAPTRELALQVSKDAQFLGQYTNLKCVAVHGGANYRKQRHLLEQ-GCDILIGT
H8GKI6_METAL      KNPRALILAPTRELAIQIHKDALLLSEHLPLKFALIYGGTDYQKQLDKIKS-NVDVIIGT
R4V3K2_9GAMM      TGPWAIILAPTRELALQIHKDAERLGWFTGMDFACIYGGTGYESQRKALER-GTDILIGT
Q0A6X5_ALKEH      EGPWTLILAPTRELALQIHRDALQLGRYTGLKCAAIYGGTGYEAQRQQLQE-GVDIIIGT
A1WYL7_HALHL      VGPWAIMLAPTRELALQIYNDAEQIGAYTGLKFAAVYGGTGYESQRKQLQE-GVDVIIGT
A5EYB1_DICNV      KGPWAIVLAPTRELAIQIKKEMDLLGAYTGLVSLAIYGGTSIEHQKKLFQACNVDVIIGT
B3E4Q8_GEOLS      PRPRALILAPTRELVVQIEKDAQLLGSHCGFNIQAIYGGIDYMKQKNALKD-GADIVIGT
Q3A6L3_PELCD      RAPRALILAPTRELVVQISKDAMGLGQFCGFKIQPIFGGVDYEKQRQALHA-GVDILIAT
D5MJD9_9BACT      GAPRALILAPTRELAVQILWDAELLGGFTGLTRLAAYGGVDYQKQRDALQQ-NVDILIGT
E1QG61_DESB2      QFPAALIIAPTRELAVQIYDDAQQIGRHTDLRMVAVFGGVDYLKQARALRE-GVDIVVAT
B8FIL9_DESAL      TLPSALIVAPTRELALQIYEEAEVLGGHTDFTIAQAIGGMDYRKQMDILKQ-GADILIGT
K4KN61_SIMAS      GEARALIIAPTRELVIQIAEDAKALTKYTDLTVHTLVGGMDYGKQQQRLHSELVDILVAT
A4A5A5_9GAMM      GEPRALVIAPTRELVMQIAADAEDLGKHTGLNTCTLIGGMDYQKQLNQLGREVVDLVVAT
C5BSZ2_TERTT      GEPRALVIAPTRELVMQIAKDAAAIGKYAGLSVQTLVGGMDFNKQMQALHGQFVDILVAT
Q21N47_SACD2      GEARSLVIAPTRELAMQIAKDAENLVKHTDLKVHILVGGVDYAKQLQKLQAEHIDILVAT
RHLB_PSESM        GEPRALIIAPTRELVVQIAKDAADLTKYTNLNVMTFVGGMDFDKQLKQLEARHCDILVAT
Q1QX32_CHRSD      GAPRALIVAPTRELALQIEKDAKALARFTSLNVASVVGGMDYQKQRDQLG-RKVDVLVAT
K0CCW2_ALCDB      GEPRALIVAPTRELAMQIEKDALQLARYTDLQVMSVVGGMNFNRQQERLQTRLIDILVAT
Q6FCM5_ACIAD      GEVRALILAPTRELALQIESDARELTRFTDLNVLTLVGGVDFDKQKKPLNEKFIDILVAT
M5DS63_9GAMM      SEPRALVIAPTRELVMQIGKDAEGLAKYTGLNVLTVVGGMDYEQQRKVLRDEVVDILVAT
A6VX62_MARMS      NFARGLIIAPTRELAIQIADEAVKLTSNCHLNVVTLVGGLSYEKQKIALETENVDILVAT
A8ZRU7_DESOH      GTPRALVLAPTRELVIQIGEEAQQLARHLPVNIVSVFGGMDFKQQQDRLTREPVDIIVAT
A0LLL9_SYNFM      GTPRALVLAPTRELALQIEKETHLLSRHTPFKSVAIFGGMDYEKQKRRLTGEVIDIVVAT
E6W520_DESIS      GRPRALILAPTRELAMQISKDAHDLCRYTPLKIVTLFGGMDMNKQRQRLENEAVDIVVAT
D6Z2Z3_DESAT      ALPKALILAPTRELAIQIHRDAEELTQYSELNCVAVFGGTDYEKQRKMFEQAPVDLLIAT
I5B4L5_9DELT      KYPRALILAPTRELVHQIEKDFKGLAKYSHLRIVPIFGGTDYRKQQTLLTDKPVDVIAAT
C0QD57_DESAH      GTPRALIIEPTRELVLQIEKDAKALTLYTPLRTVSVFGGMDYKRQQDQLASAHVDIIAAT
Q6APU7_DESPS      RTPRALILAPTRELVMQIVKDAKKLGRYTGVNADAVYGGAEYEKQMELLKRGKTDIVVAT
M1PCR9_DESSD      GTPRALIIAPTRELVIQIAKDARAIAKYLPMRVAEAYGGTDYERQQKNIRDRPVDILVAT
D5VC57_MORCB      GEPRALVLAPTRELAQQILADCRELTRFSQLYNLCITGGSDFDKQLEQLHKRPLDILIGT
A5WDI1_PSYWF      GEPRALILAPTRELANQIYDDAIALTKHTSLHSVCVMGGIDYDKQIAALDKSYTDILIAT
M1FKF3_9ALTE      SEPRVLALAPTRELAMQIAKDAEQLCAHTGHKVVTVVGGMHYDKQRDQLQNEVVDILVAT
Q2SJR0_HAHCH      SEPRALVVAPTRELALQIEKDACALAKHLKLNIISVIGGTQLDRQRRKLRDEAVDLLIAT
                       : : *****. *:  :   :            **     *   .     ::: .*

RHLB_HAMD5        PGRIIDYAKQ-NFIHLNALQVIVLDEADRMYDLGFIKDIRWLFRRMPPAEKRLNMLFSAT
RHLB_ECOLI        TGRLIDYAKQ-NHINLGAIQVVVLDEADRMYDLGFIKDIRWLFRRMPPANQRLNMLFSAT
X2H190_9GAMM      TGRLIDYAKQ-NYINLEAIQVAVLDEADRMFDLGFIRDVRWIFKHMSPPSKRLTMLFSAT
RHLB_PHOPR        CGRIIDFYKQ-RVIDLASIQVVVLDEADRMFDLGFIKDIRFLFRRMPAPKARLNMLFSAT
RHLB_AERHH        TGRIIDYFKS-KVIDLSNIQVVVLDEADRMFDLGFIKDIRFLFRRMPPATERLSMLFSAT
RHLB_HAEIN        TGRVIDYVKQ-GVIGLDEIQVVVLDEADRMFDLGFIRDIRYLLRKCPAPQARLTMLFSAT
F4HAT0_GALAU      TGRVIDYMKQ-RIISLDHVQVVVLDEADRMFDLGFIRDIRYILRHCPPPSERLTMLFSAT
RHLB_PSYIN        TGRTIDFVKQ-GVIDMGSIQSVVLDEADRMFDLGFIKDIRYLFRRMPEAKSRLNMLFSAT
RHLB_SHEAM        TGRIIDYVRQ-GVINLGAIQAVVLDEADRMFDLGFIKDIRFLFNRMPGAKERLNMLFSAT
RHLB_PSEA6        TGRIIDYYKQ-NIFSLAGIQVAVLDEADRMFDLGFIKDIRYLFNRMPKPTERLSMLFSAT
Q48AH1_COLP3      CGRLIDYMKQ-GIYNLKNIEVIVLDEADRMFDLGFIKDIRYMFDKMPPATERLSMLFSAT
Q3IDI9_PSET1      TGRLIDLYKQ-GCYTLNEIEVVVLDEADRMFDLGFIKDIRYMFHRMPDTSKRLNLLFSAT
RHLB_IDILO        TGRLIDFYKQ-DLFSLKDIEVVVLDEADRMFDLGFIDDIRYLLQKMPDPSKRLNLLFSAT
C7R9Y4_KANKD      TGRLIDYFKT-KAFGLEAIDSVVLDEADRMFDLGFIKDIRYLFNRMPPATDRLNMLFSAT
W8KEA6_9GAMM      PGRIIDYFKQ-KVFDLRQAQTLVLDEADRMFDLGFIKDVRFLLRRMPPPTERQSMLFSAT
D3SEQ2_THISK      PGRIIDYFKQ-KVFGLGHTEVVVLDEADRMFDLGFIKDVRFLMRRCAPASERLSMLFSAT
L0GXY7_9GAMM      PGRLIDYFKQ-KVFSLRHVEVAILDEADRMFDLGFIKDIRFLLRRMPPPEERLGLLFSAT
I3YBS6_THIV6      PGRLIDYLKQ-NVFDLKAIEAVVLDEADRMFDLGFIKDIRFLLRRMPPPESRLGMLFSAT
S6BG71_9GAMM      PGRLIDYFKQ-RVFDLRAIQAVLLDEADRMFDLGFIKDIRYLLRRCPPPERRLSMLFSAT
V4JG62_9GAMM      PGRLIDYFKQ-RVFNFKSVQVVVLDEADRMFDLGFIKDIRFVLRRMPPVTKRLGMLFSAT
RHLB_XANAC        PGRLIDYVKQHKVVSLHACEICVLDEADRMFDLGFIKDIRFLLRRMPERGTRQTLLFSAT
RHLB_XYLFT        PGRLIDYLKQHEVVSLRVCEICVLDEADRMFDLGFIKDIRFILRRLPERCSRQTLLFSAT
H8KZW2_FRAAD      PGRLLDYYKQ-QVFGFDSVEVMVLDEADRMFDLGFIKDIRFIFRRLPAREHRQVLLFSAT
M4NKJ1_9GAMM      PGRLLDYHKQ-GVFSLNSVEVMVIDEADRMFDLGFIKDVRFIFRKLPPREQRQVLLFSAT
K0C868_CYCSP      PGRTIDFFKQ-KVFNLRNTEVLVLDEADRMFDLGFINDIRYLLRRLPKPENRLNLLFSAT
I1YHJ7_METFJ      PGRLLDYHKQ-RVFDLRQIQAVVLDEADRMFDLGFIKDVRYFLRRIPKPSKRLGMLFSAT
Q3J811_NITOC      PGRLIDYYQQ-RIIGFKKIQVVVLDEADRMFDLGFIRDIRYILRRLPPPDKRLGMLFSAT
H8GKI6_METAL      PGRIIDFYKQ-QAFSLDHIQASVLDEADRMFDLGFIKDIRYLLRRMPPRDQRLNMLFSAT
R4V3K2_9GAMM      PGRIIDFYKQ-GVFSLDNIEVCILDEADRMFDMGFIADIRYLLRRMPPPEKRLNMLFSAT
Q0A6X5_ALKEH      PGRVIDFFKQ-RIFHLKHIEVVILDEADRMFDLGFIADIRYLMRRMPEPSKRMNMLFSAT
A1WYL7_HALHL      PGRIIDFHKQ-KVFNLRNIEVVVLDEADRMFDLGFISDIRFLLRRMPPADQRLNLLFSAT
A5EYB1_DICNV      PGRIIDLFKQ-KVFRLKNIEVCVLDEADRMFDLGFIDDVRYLLRQMPPAYERLNLLFSAT
B3E4Q8_GEOLS      PGRLIDYLKQ-KVYSLKHIEMLVIDEADRMFDMGFIPDLRYILRRLPPFDQRQNLMFSAT
Q3A6L3_PELCD      PGRLIDYVKQ-GAVSLGSIEALVIDEADRMFDMGFIRDLRYILRKLPAFDRRQTMLFSAT
D5MJD9_9BACT      PGRLIDYFKQ-GVYELSQVEVLVVDEADRMFDMGFIKDLRFLLRRLPPYHKRQSFLFSAT
E1QG61_DESB2      PGRAIDYIKQ-RALDLRAVKHLVIDEADRLFDMGFIADLRWIMRRLPPYDRRQSMLFSAT
B8FIL9_DESAL      PGRIIDYYKQ-GIFKTHAIKSVVIDEADRLLDLGFAKDMRYILRKMPHYEKRQSMLFSAT
K4KN61_SIMAS      PGRLIDFTGN-RDVYLDHVEILVLDEADRMLDMGFIPQVRRIIRQTPQKHMRQTLLFSAT
A4A5A5_9GAMM      PGRLIDFTGR-RDLVLDQVEVLVLDEADRMLDMGFIPQVKRIVRQTPHKDYRQTLLFSAT
C5BSZ2_TERTT      PGRLLDFCER-REVYLDQLEILVIDEADRMLDMGFIPQVKRIVRLAPRKTHRQTLLFSAT
Q21N47_SACD2      PGRLLDFCEK-RAVYLDQVEVLVIDEADRMLDMGFIPQVKRIVRMTPPSTHRQTLLFSAT
RHLB_PSESM        PGRLLDFNQR-GEVHLDMVEVMVLDEADRMLDMGFIPQVRQIIRQTPHKGERQTLLFSAT
Q1QX32_CHRSD      PGRLLDFHEK-RDVDLTQTEVLVLDEADRMLSMGFIPDVKRIVRHTPKAEERQTFLFSAT
K0CCW2_ALCDB      PGRLLDFAKR-RDLWLDRVESLVLDEADRMLDMGFIPDVKRIVRMTPPNRHRQTLLFSAT
Q6FCM5_ACIAD      PGRLIDFVEQ-KEVWLDQIEFLVIDEADRLLDMGFIPSVKRIVRFSPRKEQRQTLMFSAT
M5DS63_9GAMM      PGRLIDFMRS-QDVFLDQIEVLVLDEADRMLDMGFIPDVRRIVRSTPPKDERQTLLYSAT
A6VX62_MARMS      PGRLLDFARS-RKVQLGKVECLVLDEADRMLSMGFIPDVKSIIRMTPHKETRQTMLFSAT
A8ZRU7_DESOH      PGRLLDFSRR-RAVMLKQVEILVIDEADRMLDMGFIPDVRKIIYATPQKGNRQTLLFSAT
A0LLL9_SYNFM      PGRLLDFKRQ-GDLHLSKVEILVIDEADRMLDMGFIPDVQRIIHYTPPKAQRQTMLFSAT
E6W520_DESIS      PGRLLDLKYQ-KCVFLGKVEILVIDEADRMLDMGFIPDVRQIVNSTMPKHLRQTLLFSAT
D6Z2Z3_DESAT      PGRLLDFARQ-KVVSLKEVRVLVIDEADRLLDMGFIPDVRRIIQQTPEKSQRQTLFFSAT
I5B4L5_9DELT      PGRLLDFISK-KLIDLSRVEIVVIDEADRMLDMGFIPDVRRLIYMTPHKDKRQTLFFSAT
C0QD57_DESAH      PGRLMDFMRQ-KLINLGKIEILVIDEADRLLDMGFIPDMRNIIYNTPHKKERQTLFFSAT
Q6APU7_DESPS      PGRLIDFHNK-RLVNFDNCQTLVIDEADRMLDMGFIPDVRRIVSWMPKKRDRQTLMFSAT
M1PCR9_DESSD      PGRLLDFSRK-RVVQLDQAGIMVIDEADRMLDMGFIPDVRSIIHKIPNKDKRQTMMFSAT
D5VC57_MORCB      PGRIIDWVNK-GELFLDRVEVFVLDEADRMLDMGFIPDIKRIVRHMPSNTERQSLLFSAT
A5WDI1_PSYWF      PGRLIDLIYK-GHVFLDRIEAFVLDEADRMLDMGFIPDIKRLMRYMPPNTDRQSLLFSAT
M1FKF3_9ALTE      PGRLIDFLGS-QDVFLDQIDILILDEADRMLDMGFIPDVKRIIRKCTPKEDRQTLLFSAT
Q2SJR0_HAHCH      PGRLLDHLTS-ADIYLDQVEVLVLDEADRMLDMGFIPDVKRIVR-ATPRE-RQTLLFSAT
                   ** :*                ::*****: .:**  .:: ..        *  :::***

RHLB_HAMD5        LSYRVRELSFEQMNHPEYIEVEPLQKIGSQIQEELFYPSNEDKMRLLQTLIEEEWP-DRC
RHLB_ECOLI        LSYRVRELAFEQMNNAEYIEVEPEQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWP-DRA
X2H190_9GAMM      LTHNVRELAFEHMNNPQYVEVEPEQKIGHRIKEELFFPSNEDKLALLQTLIEEEWP-DRC
RHLB_PHOPR        LSYRVKELAFEHMNSPESVVVEPNQKTGHLIQEELFYPSNQEKMRLLQTLIEEEWP-DRA
RHLB_AERHH        LSLRVQELAYEHMNHPEHVQIEPEQMTGVRIKEELFYPSNEDKMLLLLSLMEEEWP-EKA
RHLB_HAEIN        LSYKVRELAFEDMNEPEYIEIEPEQKTGHRIKEELFYPSNQDKMALLLTLMEDEWP-ERC
F4HAT0_GALAU      LSFKVRELAFEDMNDPHYIEIESAYKTADTVKEELFYPSNQDKMRLLLTLLEEEWP-ERC
RHLB_PSYIN        LSHKVQELAFEHMNDPESIQIEPEVMTSVNITEELFYPSNQDKILLLLSLIEEDWP-DKA
RHLB_SHEAM        LSMKVQELAYDHMNDPVKVEIAPEEKTSRNIKEEIFYPSMEDKLKLLHSLIEEDWP-EKA
RHLB_PSEA6        LSYRVQELAYEHMDNPTHVQVEPERKTGTRIKEELFYPSDEDKMALLLSLMEEEWP-DKA
Q48AH1_COLP3      LSFRVKELAFDHMNDPTSVEVEPEQKTNSRISEELFYPSNEDKMTLLQTLIEEDWP-EKA
Q3IDI9_PSET1      LSYRVQELAFEHMTNPEHVQIEPDVKTGKRIQEELFHPSQEDKIKLLLTLIEEEWP-EKA
RHLB_IDILO        LSYRVQELAYEHMNAPTKLEVEPLQKTATRVTEELFYPSKPEKFPLLLTLIEEDWP-DKA
C7R9Y4_KANKD      LSHRVQELAYEHMNNPQHVQVQTQQVSANKIREALFYPSREEALPLLVGLMQRLEP-EKS
W8KEA6_9GAMM      LSWRVMELAYEHMNNPAKVQTQDEQVTAERVRQAIYYPANDQKIPLLLGLMRKLGP-ERS
D3SEQ2_THISK      LSLRVMELAYEHMSNPEKVQVEAETLTADRVRQVIYYPANEEKIPLLLGLARDLKP-ERA
L0GXY7_9GAMM      LSYRVTELAYEHMNNPELIKVEPDRVTAERVTQSGYMVANEEKIPLLIGLLRRLEG-ARA
I3YBS6_THIV6      LSYRVTELAYEHMNRPQLIKIETDKITADRVRQCCYMTSNEEKIPLLIGLVRGWKD-ARI
S6BG71_9GAMM      LSWRVLELAYEHMNNPQKVEVEAEQITADRVRETGYMVANEEKIPLLLGLINRLED-ARS
V4JG62_9GAMM      LSYRVTELAYEHMNDPRMVEIAPEQVTVDRVRQACYMVANDEKVRLLIGLIRGFQD-ARV
RHLB_XANAC        LSHRVLELAYEHMNEPEKLVVETESITAARVRQRIYFPSDEEKQTLLLGLLSRSEG-ART
RHLB_XYLFT        LSHRVLELAYEYMNEPEKLVAETESVTTTRVRQRIYFPAEEEKIPLLLGLLSRNEG-MRT
H8KZW2_FRAAD      LSHRVLELAYEHMHEAEKLVVESDNVTADRVRQLVYFPAKEEKMPLLLNLLKTTGERARC
M4NKJ1_9GAMM      LSHRVLELAYEHMHEAEKLVVESDHVTADKVRQVVYFPAKEEKMPLLLNLIDRHKP-SRS
K0C868_CYCSP      LSFKVTELAYEHMNNPVMVRVEPEQITAKQVVESVYYPADNEKIPLLLHLLTNEKP-ERG
I1YHJ7_METFJ      LSYKVLELAYEHMNNPEKVQIAPEKVAADRIEETVYYPANDEKIPLLLALIKRINP-LRS
Q3J811_NITOC      LSLRVMELAYEYMNNPQLLRIEPQKVTVDKITERVYFPANEEKISLLLALFKRLVP-RHA
H8GKI6_METAL      LSYKVTELAYEHMNNPVLIKIETETVTSRSIKQTAFCPSNEQKIPLLIGILQQYQP-QRS
R4V3K2_9GAMM      LSERVRELAYEHMNEPESIKIESETITADRVRQTLYHVENTEKIGLLLGVLQQQDP-TRT
Q0A6X5_ALKEH      LSHRVMELAYEHLNDPEVVRIESEQITADKVRQKLYHVSKDEKIPLLLGLIRQEEAMNRS
A1WYL7_HALHL      LSYRVMELAWEHMGDPPRVAVESEQRTADHVRQTLYHIAKEDKTSFVVGLLQHIDP-RRT
A5EYB1_DICNV      MPQKVQELAYEHFNAPKVVAIESQQTTANNITHYLYHTAKHEKTPLLLGLFARERP-ERS
B3E4Q8_GEOLS      LNQRVMELSYEFMNVPQKVSVTPEKMTAERVEQVLYHVSNKEKFPLLLGLLRREGM-ART
Q3A6L3_PELCD      LSHRVMELAYEFMDLAEKIKVAPENVTAEQIEEVLYHVSRREKFALLLGLLKKEPA-KCV
D5MJD9_9BACT      LSFREMELSYEFMNNPIKVAISPEQVTVDKVEHLLFHVEKQEKFRLLRWLLQREAW-QRI
E1QG61_DESB2      LGYRVLELTYEFMNMPAKVSVAPRQRTVEQVDQELYHCSAPEKMSLLLGLLRREGV-DRV
B8FIL9_DESAL      LSYRVLELTYDYMNLPEFISVTPEEVTVKGIDQILYHVGQDQKLPLLLGVFKNEDW-TRA
K4KN61_SIMAS      FTDDVLNLANQWTIDPVRVEIEPESVATDTVEQHIYLASTEEKYTLLYNLLKQDEV-ESL
A4A5A5_9GAMM      FTQDIINLSQQWTTDAITIEIEPDHVATDSVDQRIYLASSEERFRILVNLLRSDDA-SSV
C5BSZ2_TERTT      FSDDVLRLAESWMFEPVSVEIEPETVATDSVEQFIYMVSGDEKLPLLCNLISMPDV-KNV
Q21N47_SACD2      FSEDVLRLSEQWMHEPVTVSIEDENVAADRVKQVVYLVSSEEKFTVLGNLMREPDV-ENI
RHLB_PSESM        FTEDVMNLAKQWTTDPSIVEIESLNVASDNVEQHIYAVAGADKYKLLYNLVTDNGW-ERV
Q1QX32_CHRSD      FSQDILNLANQWTHDAAHVEIEVSLENAANIDQRVYLVSDSDKQRLLVNLLNQENM-ERV
K0CCW2_ALCDB      FNEDVMALAQRWTEDPVTVEIEPAQVTTETVEQKVYITATEDKFNLLYNLIISENM-EKV
Q6FCM5_ACIAD      FSYDVLNLARQWLFEPVTVEIEPEQKTNNDVEQRVYMVAKQDKYRLLQDILRDEPI-DKV
M5DS63_9GAMM      FNYDVRILIDQWTKDPHQVVIEPEQVTTDRVVQKCYLVAESDKYRVLEQVLNEEKP-ERC
A6VX62_MARMS      FPKDIQALAQQWTYFPKEVSVVPKEATNQNIDQVIYTVEADQKWPVLQQLIEKNGG-QRT
A8ZRU7_DESOH      LTEAITRLASAWTRDPVQVAIEPEHVAVDSVDQVVYIVTSDRKLALLYNIIVQQNL-SRV
A0LLL9_SYNFM      LTAEVTRFASQWTRNPVTVEIEPEQVAVDTVNQRVLITTIDEKFTLLFNMITRQNL-DRV
E6W520_DESIS      LSNEVTRLASAWMTEPFMVEIEPEQVTVETVDQLVYITTREEKFTLLWNTINQANL-TRV
D6Z2Z3_DESAT      LNSQIANLSAQWTKDPVTVEIEPEQVASDRVEQRVYMVTAKEKMTVLYNLITGKQL-ERV
I5B4L5_9DELT      LTDDVLRLAQSWTRDAVGIEIDPEHAAAESINQIVYLTTEEDKFKNVCNLLISENL-ERV
C0QD57_DESAH      LAPEILRMANQWTVDPAVVEIDPDKTAADSINQKVFIVTEDQKFPLLYNLISGEKL-ERV
Q6APU7_DESPS      ISSDVNNLSAQWCVDPEVVEAEADQVTTDTVEQKVYLVTAEEKYNVLYNLIKENSD-ERI
M1PCR9_DESSD      ITEEVARLASQWCVNPISVETEADNMAVETVTQVVYTLTRDEKYLVLYNIINSENC-DRV
D5VC57_MORCB      FNQDVMNLAYRWLHQPAFVEIAPESKTNQAIDQQFYLVTEREKTSALKQILADDSV-KKT
A5WDI1_PSYWF      FNQDVMNLAYQWLMNPVFVEIEPEHKTSDLVEQHFYLLTEADKHQALIQILAQPET-KKV
M1FKF3_9ALTE      FNQDVLNLASMWTQSAEFVEIEPEQKTAERVEQTVYLVGDDEKLRVLVNYLKRPEV-DKA
Q2SJR0_HAHCH      FSEDIKNLARRWTEEPVEVMLAVDHLPAKTVDQRVYMVESSAKRKLLVNLLKDSET-RRV
                  :      :       .  :           : .             :             

RHLB_HAMD5        IIFANTKQRCEDIWGHLVADGHRVGLLTGDVAQRKRIQILDDFSKGYLDILVATDVAARG
RHLB_ECOLI        IIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILDEFTRGDLDILVATDVAARG
X2H190_9GAMM      IVFANTKVACEKIWRHLIADGHRVGLLTGDIAQKKRLSILEQFTRGDLDILVATDVAARG
RHLB_PHOPR        IIFANTKHRCEDIWGHLAADNHRVGLLNGDVPQKKRVRILEQFTQGDIDILVATDVAARG
RHLB_AERHH        IVFANTKHVCEDVHAWLENDGHRVGLLTGDVPQKKRMKILEDFTKGTVDILVATDVAARG
RHLB_HAEIN        IVFANTKHRCEEIWGYLAADGHRVGLLTGDVAQKKRLSLLKQFTDGDLDILVATDVAARG
F4HAT0_GALAU      IIFANTKHQCEKIWQYLLADQLRAGLLTGDVPQKKRFALLEQFANGQLDILVATDVAARG
RHLB_PSYIN        IVFANTKHTCEKVWGYLAGDGLRTGLLTGDVPQNKRLKILQQFTDGEIDILVATDVAARG
RHLB_SHEAM        IVFANTKYQCENLWASLEADGHRVGLLTGDVPQKKRLKILEQFTQSELDILVATDVAARG
RHLB_PSEA6        IVFANTKHSCEKVADWLQADGHRVGLLSGDVPQNKRLKILEDFTSGKLDILVATDVAARG
Q48AH1_COLP3      IVFANTKHVCEKVFDHLNADKIRVGLLTGDVPQKKRLKILEEFTDGTVDILVATDVAARG
Q3IDI9_PSET1      IIFANTKHSCETVYAWLKADGHRVGMLTGDVNQKKRQSILAEFSKGDLDFLVATDVAARG
RHLB_IDILO        IVFANTKHGCEKVHGWLVANEHRAGLLTGDVPQKKRLRILEDFAEGKLDFLVATDVAARG
C7R9Y4_KANKD      IVFTNTKRAAEHVWACLAGNDIKAGLLTGDVHQKKRLRLLDELKNDDVSVLVCTDVAARG
W8KEA6_9GAMM      MVFVNTKHGAEKVTAWLEGNGIRVALLSGDVPQRKRQSLLAKFEQSEYQVLVATDVAARG
D3SEQ2_THISK      IVFVNTKHGAEKVCDWLNVNGQKAALLSGDVPQNKRSSLLERFTAGEYAFLVATDVAARG
L0GXY7_9GAMM      IVFANTKRETERIWGYLEGNGLRAAILSGDVPQRKRLSLLRHFTAGDLPILVATDVAARG
I3YBS6_THIV6      MVFVNTKREADRVWGYLQGNGINTAVLSGDVPQNKRLKLLRDFTEGNLPVLVGTDVAARG
S6BG71_9GAMM      IVFVNTKREAERVWGYLEGNGHKAAILSGDVPQKKRERLLKQFADDEVSVLVATDVAARG
V4JG62_9GAMM      MIFINTKREGEWVWGFLEGNGLKSAMLSGDVPQKKRLSLLRRFQTGELPIMVATDVAARG
RHLB_XANAC        MVFVNTKAFVERVARTLERHGYRVGVLSGDVPQKKRESLLNRFQKGQLEILVATDVAARG
RHLB_XYLFT        MVFVNTKVFVEGVARALDEAGYRVGVLSGDVPQRKRETLLNRFQKGQLEILVATDVAARG
H8KZW2_FRAAD      IIFVNTKAAAEKITERVGRYGHRVGALSGDVPQLKRQKLLQRFQDGQLDILVCTDVAARG
M4NKJ1_9GAMM      IIFVNTKAAAERVTERVKRHGCRVGAISGDVPQLKRQKLLQRFQDGQLDILVATDVAARG
K0C868_CYCSP      IIFINTKHTADRLHRYLKGNDFDNAVLSGDVPQKKRQTILTRFQDGKLPLLIATDVAARG
I1YHJ7_METFJ      IVFVNTKHTADLVWGFLEGNGHKAALLSGDVPQKKRERLLTHFQDGEFPFLVATDVAARG
Q3J811_NITOC      IVFTNTKHVAEKVWGYLEGNGFKAALLSSDVPQGKRQRLLAAFQDRIYPILVATDVAARG
H8GKI6_METAL      IIFVNTKRCAELLDDTLTANGFKTAALSGDVPQEKRQRLLNDFQENNVSLLIATDVAARG
R4V3K2_9GAMM      LIFVNTKRDADRVTGYLMGNDIKAAVISGDIPQNKREQLLGKFQSGDLPILVATDVAARG
Q0A6X5_ALKEH      IIFVNTKRAADRVTGYLLGNDIEAAVISGDIPQKKRESLLKRFQDGELRFLVATDVAARG
A1WYL7_HALHL      LIFANTKRAAERLVGYLKGNGIEAAVISGDIPQNKREQLLEQFRTGELPVLVGTDVAARG
A5EYB1_DICNV      MIFLNTKHDLERLSLVLTANGYHNAALSGDVAQKKREQIIRDFQEGTVNIVVATDVAARG
B3E4Q8_GEOLS      MLFVNTKREAERLQDRLNANEFPCRVISGDVDQRKRMNILEQFKRGELAILIATDVASRG
Q3A6L3_PELCD      MLFVNTKREAEHLTGRLQVNGFKAALISGDIPQKKRMRILDEFKEGRIHFLVGTDVASRG
D5MJD9_9BACT      LIFSNTRQGAERLTDKLVRCGFRAGLISGSIDQRKRLQIITKFKAGTLPILVATDVASRG
E1QG61_DESB2      MIFANTKRAVDAIAYKLRGNGLPAEGISGDLTQRRRMQLLEQFKSGELKILVATNVAARG
B8FIL9_DESAL      LVFVNTKSGVEFVAHKLRGNGFPAGGITGDLPQRKRLQLMERFKNGELSILVATDVASRG
K4KN61_SIMAS      IVFANRRDECRRLHEQLEAHGFKAGLLSGEVAQNKRVRTLDAFKTGEMEVLVATDVAGRG
A4A5A5_9GAMM      IVFANRRDQVRRLFERLRKASITCGMLSGEIAQAKRTKTLDQFKKGEISVLVATDVAGRG
C5BSZ2_TERTT      MIFANRRDQCRTLYERLRKQGYKVGLLSGEIPQGKRVKTLEAFKEGSLQALVATDVAGRG
Q21N47_SACD2      MIFANRRDQCRDLHHKLQRRGFRVGLLSGEIAQNKRIRTLEDFRTGKLTALVATDVAGRG
RHLB_PSESM        MVFANRKDEVRRIEERLVRDGVNAAQLSGDVPQHKRIKTLEGFREGKIRVLVATDVAGRG
Q1QX32_CHRSD      IVFGNRRDLVRNLDSELRKAGINVAMLSGDVPQNTRITTLDKFRNGEVDVLVATDVAGRG
K0CCW2_ALCDB      IVFANRRDITRRLNDRLVKKGLKVSLISGDVPQNQRMKTLERFRAGDLRVLIATDVAGRG
Q6FCM5_ACIAD      MIFANRRDQVRRLYDHLKKDGYKVGMLSGEIAQDKRLKMLEQFKQGKNNIMIATDVAGRG
M5DS63_9GAMM      IIFANRRDLTRNLCDKLNKHGHVSVLLSGEVAQQKRVRTLERFRDGHVNILVATDVAGRG
A6VX62_MARMS      IIFANRRDETRDLYERLRKANINCAILSGEVAQDKRVKTLANFKEGIIQVLVATDVAGRG
A8ZRU7_DESOH      LVFCNRKDAVSRLADRLTRYGIKCEILTGDVPQQKRSRRLEDFKSGKIRVLVATDVMARG
A0LLL9_SYNFM      IVFTNRRDQARRLTERLGSYGISCALLSGEVDQKKRVKTLEEFRNGKIRVLVATDVAARG
E6W520_DESIS      IVFANRRDETRHLSEKLTRYGVTNAILSGEVPQAKRIRTLENFREGKIAVLVATDVAGRG
D6Z2Z3_DESAT      IVFCNRRDVTRRVRERLYRHGISCAMLSGEVSQQQRMKTLDNFKEGKIRVLVATDVAGRG
I5B4L5_9DELT      IIFVNRKDTARHLSEKLSRYGLNAGILSGDVAQDKRFEVLNRFKTGDLNVLVATDVAARG
C0QD57_DESAH      ILFVNMRSTTRRIAQRLVQFDISSEILSGEVSQKQRIRTLDDFRNGKVRVLVATDVAARG
Q6APU7_DESPS      MIFANMKSETRKLADRLKRNSIDCLLLSGDVPQNKRQSRLESFRTGKVKVLVATDVAGRG
M1PCR9_DESSD      IIFTNMKRDAKRLHDRLQRDGISCTLLTGDVPQQKRTARLESFRNGTIKAMVATDVAGRG
D5VC57_MORCB      IIFANRKDQVKRLYDYLRRH-HKVTMLSGDVAQQKRERYLQRFKDGEVNVLVATDVAGRG
A5WDI1_PSYWF      IVFANRKDQVKRLYTKLSAD-HNVVMLSGDVDQAKRERYLDKFKNGNAKVLVATDVAGRG
M1FKF3_9ALTE      LVFANRRDQCRDLEEDLRNQGVSVSLMSGEIAQAKRLKTLEQFKAGSIQVLVATDVAGRG
Q2SJR0_HAHCH      IVFCNRRDETRSLSEALNRHSIKNELISGELPQQKRLKTLERFRRGDFRVLVATDVAGRG
                  ::* * :     :   :         :...: *  *   :  :       :: *:* .**

RHLB_HAMD5        LHIPKVTHVFNYDLPENVEDYIHRIGRTGRAGEKGYSISLACEAFASHLSTIEACTGHRI
RHLB_ECOLI        LHIPAVTHVFNYDLPDDCEDYVHRIGRTGRAGASGHSISLACEEYALNLPAIETYIGHSI
X2H190_9GAMM      LHIPDVTHVFNYDLPDDCDDYRHRIGRTGRAGAEGYSISLACERYSQNLPAIEKAIDHTI
RHLB_PHOPR        LHIPQVTHVYNYDLPDDAEDYVHRIGRTGRAGESGSSISFACEEYAINLPAIETYIEHPI
RHLB_AERHH        LHIPDVTHVFNYDLPDDAEDYVHRIGRTGRAGKSGHSISLACEDYAFNLPAIEEYIHHPI
RHLB_HAEIN        LHISDVTHVFNYDLPDDREDYVHRIGRTGRAGESGVSISFACEEYAMNLPAIEEYIGHSI
F4HAT0_GALAU      LHIPQVTHVFNYDLPDDYEDYVHRIGRTGRAGENGISISFACEDYAVNLPAIEQYIGHSI
RHLB_PSYIN        LHIPKVSHVFNFDLPDDCEDYVHRIGRTGRAGEKGLAISFACEKYVFNLPAIEEYIKHPI
RHLB_SHEAM        LHISDVSHVYNYDLPDDCEDYVHRIGRTGRAGQKGVSVSFACEEYALNLPAIEDYIKHSI
RHLB_PSEA6        LHIPMVSHVFNYDLPDDAEDYVHRIGRTGRAGQSGSSISFACERYALNLPAIETYIEHAI
Q48AH1_COLP3      LHIPSVTHVFNYDLPDDCQDYVHRIGRTGRAGETGHAISLACEQYVFNLPEIETYIGHDL
Q3IDI9_PSET1      LHIPEVSHVFNFDLPDDCEDYVHRIGRTARAGASGHAISFACEQYAYNLHEIEEYIDHSI
RHLB_IDILO        LHIPEVTHVYNFDLPDDCEDYVHRIGRTGRAGASGAAISLACEEYVYNLPAIEDYIGHTI
C7R9Y4_KANKD      LHIDGVTHVFNYHLPDDAEDYVHRIGRTARAGAEGDAISFAGEDFAMNLTAIEQYVGHNL
W8KEA6_9GAMM      LHIPDVSHVFNFDLPQSGEDYVHRIGRTGRAGAEGDAISFACEDFAFHLPEIEEYIGFKI
D3SEQ2_THISK      LHIPAVTHVFNFDLPQSGEDYVHRIGRTARAGAEGDAISFGCEDSAFYLPDIESYLGERI
L0GXY7_9GAMM      LHIPDVTHVINYDLPEDAQDYVHRIGRTARAGAAGAAISFVCETYAFSLPDIEDFIGIKV
I3YBS6_THIV6      LHIPDVTHVVNYDLPEDPEDYVHRIGRTARAGAAGDAIGFVCETYAFCLPDIETFIGAKI
S6BG71_9GAMM      LHIPGVTHVFNYDLPDDPEDYVHRIGRTARAGAEGDAVAFICETYAFSLPDIEDYIGHKI
V4JG62_9GAMM      LHIPGVTHVINYDLPEDAEDYVHRIGRTARAGEAGDAISFVCETYAFCLPDIETFIGSKI
RHLB_XANAC        LHIDGVKYVYNYDLPFDAEDYVHRIGRTARLGEEGDAISFACERYAMSLPDIEAYIEQKI
RHLB_XYLFT        LHIDGVNYVYNYDLPFDAEDYVHRIGRTARLGADGDAISFACERYAMSLPDIEAYIEQKI
H8KZW2_FRAAD      LHIPAVSHVFNYDLPHDAEDYVHRIGRTARLGAEGDAISFACDLYAMSLPDIETYIGQRI
M4NKJ1_9GAMM      LHIPAVSHVFNYDLPHEAEDYVHRIGRTARLGAEGDAISFACDLYAMSLPDIETYIGQSI
K0C868_CYCSP      LHIPAVSHVFNFDLPQDAEDYVHRIGRTARSGASGKAISFACETYAYSLPDIEAYISHKI
I1YHJ7_METFJ      LHIPEVSHVFNYDLPQDSEDYVHRIGRTARAGASGTAISFACEEYVFSLPDIERYIKHKI
Q3J811_NITOC      LHISTVTHVFNYDLPQDPEDYVHRIGRTARAGASGLAVSFACEDYAFSLPDIEEYIGHKV
H8GKI6_METAL      LHIPDVSHVINYDLPQDVEDYVHRIGRTARFGASGEAISFICEEYAYSMPDIEAYIGEKV
R4V3K2_9GAMM      LHIPEVSHVINYDLPQDAEDYVHRIGRTARAGAAGEAISFACESYVYSLPDIEKYIDQKI
Q0A6X5_ALKEH      LHIEDVSHVINYDLPQDPEDYVHRIGRTARAGASGDAISFACEEYVFSLPDIESFIEQRI
A1WYL7_HALHL      LHIDAVSHVINFDLPHDPEDYVHRIGRTARAGESGDAISLACDEYVFSLPDIEAYLAEKI
A5EYB1_DICNV      IHIDGITHVFNYDLPQIAEDYVHRIGRTARAGASGTAISFACEEYVYSLPEIEHFLGEKI
B3E4Q8_GEOLS      LHIDGVSHVINYDLPQDAEDYVHRIGRTARAGAEGKAISLADEDGAFYIEAIEEYIRHKV
Q3A6L3_PELCD      IHVDGVTHVINYDLPQDREDYVHRIGRTARAGAAGKAISFADEDLVYYLADIEDYIGHRI
D5MJD9_9BACT      LHVEAVSHVINYDLPQDPEDYVHRIGRTARAGAAGKAISLADEEYVLSLDAIERYIGFKI
E1QG61_DESB2      LHVENISHVINYDVPADPEDYVHRIGRTARAGAVGKAITLCCDRYATHLPYVEEYLGEKI
B8FIL9_DESAL      IHVEDVSHVINYDLPQDPENYVHRIGRTARAGKTGKAISLACEHYVFHLEPMEEMIGLSL
K4KN61_SIMAS      IHIDGISHVVNFTLPEEPEDYVHRIGRTGRAGRHGVSVSFACEDDAFRLMPIEELLGQKL
A4A5A5_9GAMM      IHVDGVTHVVNYNLPEDPEDYVHRIGRTGRAGASGTSISFASEDDAFLLPDLEALLGEPV
C5BSZ2_TERTT      IHIDGVSHVVNYTLPEEPEDYVHRIGRTGRAGNTGQSISFACEDDAFRLPAIEELLGRKL
Q21N47_SACD2      IHIDGISHVVNYTLPEEPEDYVHRIGRTGRAGKEGVSVSLACEDDALRLEPIQELLGRKI
RHLB_PSESM        IHIDGISHVINFTLPEVPDDYVHRIGRTGRAGADGVSISFAGEDDSYQLPAIEEKLGRKI
Q1QX32_CHRSD      IHIDDVSHVVNYTLPEDPEDYVHRIGRTGRAGAEGVSISFVGEEDAFALPGIESYIGDKL
K0CCW2_ALCDB      IHIDGVSHVVNFNLPEDPEDYVHRIGRTGRAGASGVSISFACEDDAFLLPQLEEAIGMKL
Q6FCM5_ACIAD      IHVDGVSHVVNFTLPEQSDDYVHRIGRTGRAGTQGVSISFLSEDDAFYLPEIEKAIGKKL
M5DS63_9GAMM      IHVDGVSHVINYTLPEDPEDYVHRIGRTGRAGAMGVSISLVSEDDAFVLPDLEKYLGMKL
A6VX62_MARMS      IHVDNVELVVNYSLPEDPEDYVHRIGRTGRGGETGKSVSFASEDDAFMIPEIERVVGESI
A8ZRU7_DESOH      IHVEDMDHVVNFDLPHDPEDYVHRIGRTGRAGAVGTSISFADERDSFYIPDIEDFMERPL
A0LLL9_SYNFM      LHVEAVSHVFNYNMPMDPEDYVHRIGRTGRAGTSGISVSFASEDDSFLIPALEKYLGHEI
E6W520_DESIS      IHVDSISHVINYNLPENPEDYVHRIGRTGRAGASGISVSFACENDSFYIPAIEDYIGKKL
D6Z2Z3_DESAT      LHIEGISHVINYNLPEDAEDYVHRIGRTGRAGASGISVSFADEEESFYLPAIEEYMGRKL
I5B4L5_9DELT      LHIENISHVINYDLPLEPEHYIHRIGRTGRAGATGTSISFADEMSSFQIPKIEEVLGHKI
C0QD57_DESAH      LHIEGVSHVINYDLPQDPEHYIHRIGRTGRAGAEGISVSFADEMSSFQIPDIEAVLGNKL
Q6APU7_DESPS      IHIDGISYVVNYTLPYEPEDYVHRIGRTGRAGLAGKSVSFACEEGSFYLPDIEEYIGAKL
M1PCR9_DESSD      IHIDDISHVVNFTLPYEPEDYVHRIGRTGRAGADGISISFADEESSFYLMDIEEYIGESL
D5VC57_MORCB      IHVDDVTHVINYTLPDMPDDYVHRIGRTGRAGLSGVSISFVSENDAFNLPALERHIDQKF
A5WDI1_PSYWF      IHVDDISHVVNYTLPDQPDDYVHRIGRTGRAGQKGISISFVSEDDAFNLPAIEAHLDRHL
M1FKF3_9ALTE      IHVNGVTHVFNYNLPDNAEDYVHRIGRTGRAGSTGVSISFAGEDDSFALPAIEKYIGQKL
Q2SJR0_HAHCH      LHIDGVTHVVNYNLPDDPEDYVHRIGRTGRAGATGVSISFACEDDSFLIPELEKYLGHEL
                  :*:  :  * *: :*   :.* ******.* *  * :: :  :     :  ::      .

RHLB_HAMD5        PTSEYNKEALLTDLPQPKRL----------------------------------------
RHLB_ECOLI        PVSKYNPDALMTDLPKPLRL----------------------------------------
X2H190_9GAMM      PVSQYDPSALLVDLPTPKTF----------------------------------------
RHLB_PHOPR        PLSKYNSEALLDELPAPLRL----------------------------------------
RHLB_AERHH        PVSKYDREALLDDVTAPKRV----------------------------------------
RHLB_HAEIN        PVSQYETEALL-ELPKPYRL----------------------------------------
F4HAT0_GALAU      PVSHYDPSALL-PLPK--------------------------------------------
RHLB_PSYIN        PCSEYDKNAMLDSLPVMKVT----------------------------------------
RHLB_SHEAM        PVTSYDRDALIDIPPPVKIH----------------------------------------
RHLB_PSEA6        PVTEYQADALLRDVTPPKPR----------------------------------------
Q48AH1_COLP3      PVTKYDHDALLTDLPRPKPR----------------------------------------
Q3IDI9_PSET1      PLSHYDKTALLDDLTKPTIH----------------------------------------
RHLB_IDILO        PVTKYDGDALLSDLRRPRPI----------------------------------------
C7R9Y4_KANKD      PKLEIKSEYLANLKPSLPIQ----------------------------------------
W8KEA6_9GAMM      DSEMTDHAILATDLEPPKRR----------------------------------------
D3SEQ2_THISK      PTETVDPAALFSDPVRPKPR----------------------------------------
L0GXY7_9GAMM      PIDHIDPDLLAEVDPTSRVR----------------------------------------
I3YBS6_THIV6      PVFPVDPALLADVNPRSRLR----------------------------------------
S6BG71_9GAMM      PMKPVTRELLAEVDPASRVH----------------------------------------
V4JG62_9GAMM      EVNPVSESMLADIDYRSRVR----------------------------------------
RHLB_XANAC        PVEPVTSELLTPLPRAPRVPVEGEEADDDAGDSVGTIFREAREQRAAEE--------QRR
RHLB_XYLFT        PVAAVTAELLAPLSRPGR-------ASNGNGDTVGDISPHSRDVLVAQE--------WRR
H8KZW2_FRAAD      PVGQIQPEWLVMPKAPPVAPAREATETAESAADASARPPR---RRRRSG--------TGR
M4NKJ1_9GAMM      PVGAMEPELLVMPKPHAIDPEFAANAAADSAAFGDVVAPRPGEKPRRSGAPGRSGERSGS
K0C868_CYCSP      PFENIDGASLPDVKPATK------------------------------------------
I1YHJ7_METFJ      PVSSASDEQLATPAPAVKP-----------------------------------------
Q3J811_NITOC      VPFSVEEEELLVPEQRVFV-----------------------------------------
H8GKI6_METAL      PVQAVTQELLAQ--DVILP-----------------------------------------
R4V3K2_9GAMM      PSEMAPPDLIATDI-KAPAR----------------------------------------
Q0A6X5_ALKEH      PAEMPSPEMMVEP--KPPKR----------------------------------------
A1WYL7_HALHL      PSAPPPAEYFAEL--EAPKM----------------------------------------
A5EYB1_DICNV      PVKPIEESLIVDVIPPSDEA----------------------------------------
B3E4Q8_GEOLS      AVEWAEDDLFIHDYKRPKHRPA--------------------------------------
Q3A6L3_PELCD      PSVFPEDSDFCHTYKAYK------------------------------------------
D5MJD9_9BACT      PVQWPDESAFAPGVAAGA------------------------------------------
E1QG61_DESB2      PVCWADDSLFVPDQAGPAPRM---------------------------------------
B8FIL9_DESAL      PVEWPEEEYFQEDKAGPMPAR---------------------------------------
K4KN61_SIMAS      KCEQPPEALLAPTPERLPPQRRSRSGGGRPGGGRPGGGRRPGGRSGGSRGQRR-------
A4A5A5_9GAMM      VCEHPPAELLSR------------------------------------------------
C5BSZ2_TERTT      KCELPPEHLLNYDN----------------------------------------------
Q21N47_SACD2      PCEQPPEELLKPLAR---------------------------------------------
RHLB_PSESM        SCETPPTHLLRAVVRQTN------------------------------------------
Q1QX32_CHRSD      PCQHPPDGLL--------------------------------------------------
K0CCW2_ALCDB      PCEHPPAPLLEDQRQA--------------------------------------------
Q6FCM5_ACIAD      PLTRLEGYC---------------------------------------------------
M5DS63_9GAMM      ELTQP-------------------------------------------------------
A6VX62_MARMS      RCEYMVDTSL--------------------------------------------------
A8ZRU7_DESOH      PCIEPDSTWLELPPPAAPK---KERPR---------KTTPRTGRVKSTPGK---------
A0LLL9_SYNFM      HCEHPDEDMLETLPEPTHTPVAAERPR---------RSGPYRGRNPRSTGRRKTG-----
E6W520_DESIS      TCKYPGDELLRPLPAPQKK---EAAPQ---------EASSGSKRSSRSRNRRKPRKSE--
D6Z2Z3_DESAT      DCVYPEDELLIPLPPPVQKAPPVDKNLSGNQGGRSGKPGRKSGPPRRSSNSGRPRRS---
I5B4L5_9DELT      SCEYPTGALEAKLPAPVPRPSKQRSKQNHTKAENKEKTPYRKRKK----PATTMAGKNP-
C0QD57_DESAH      ECEYPDDAMLAPLPKPKRRIPPKPDTRPPQKKNRSSRSNSRPRSKGTPGPKGSSRQRNPR
Q6APU7_DESPS      DCVLPPEELLVHAPKGTAPVAVAHKKYKPRKKTS--------------------------
M1PCR9_DESSD      PCITPNEALL---------------KPIVRKK----------------------------
D5VC57_MORCB      KLNQFEFLDEHK------------------------------------------------
A5WDI1_PSYWF      KLEQWG------------------------------------------------------
M1FKF3_9ALTE      ANEVPDEALMVPMDNAPIARKRGRRPQGTRPTGNRSSGNRSGNSRPRRS-----------
Q2SJR0_HAHCH      ALIHPDDDLLQ-------------------------------------------------
                                                                              

RHLB_HAMD5        -----------------------QRHHRHYAGSRNQGASRKP------------------
RHLB_ECOLI        -----------------------TRPRTG-NGPRRTGAPRNR------------------
X2H190_9GAMM      -----------------------KR------------APRRR------------------
RHLB_PHOPR        -----------------------QRTPRQGGNRRPNGNRQGQ------------------
RHLB_AERHH        -----------------------FRN-RQPVNRNMR-DRQGG------------------
RHLB_HAEIN        -----------------------KRAVPPQGHTRHRSYHAK-------------------
F4HAT0_GALAU      ------------------------RRFPRKARS---------------------------
RHLB_PSYIN        -----------------------KYKAHP--NSRKDN-----------------------
RHLB_SHEAM        -----------------------RKPHAGGRNLRDRNGSPRP------------------
RHLB_PSEA6        -----------------------HKK-----RMQNGRNPQK-------------------
Q48AH1_COLP3      -----------------------QRRPRTGANRQGGRANPR-------------------
Q3IDI9_PSET1      -----------------------RKRNFSTGPRNRSNNSGR-------------------
RHLB_IDILO        -----------------------QRRRRHNSGGGKGKPRGR-------------------
C7R9Y4_KANKD      -----------------------QKRRHPTQRRGGGKPRHPR------------------
W8KEA6_9GAMM      -----------------------QRKPSSGPPRGRSGGRSGSSSGPGKQPRARQRSDQES
D3SEQ2_THISK      -----------------------PRKPRDD--RRGGGGRGG-------------------
L0GXY7_9GAMM      -----------------------TPRRERISR-DERGKGRATPGGKQPRGRRDGP-----
I3YBS6_THIV6      -----------------------PAREDREERRDGRGTRSAAPARGE-RTRREGPGAREE
S6BG71_9GAMM      -----------------------IERKRRPPR--GKGSSKGRP-----------------
V4JG62_9GAMM      -----------------------VPRRAREGRERDNGRRTRSGKRSQGGKRSQGRRRKGD
RHLB_XANAC        GGGRGGPGG--------------SRSGSGGGRRDGAGADGKPR-----------------
RHLB_XYLFT        GKPRGSPG---------------ERDGRIRVCKGTRSDGGGGR-----------------
H8KZW2_FRAAD      AAGAGEPGR------------VSQTSVAAAVAVASVSDPAPGH-----------------
M4NKJ1_9GAMM      SRGAARPPRERKPELADGRVTAAEQPAVEGVHKTEAAPRADAG-----------------
K0C868_CYCSP      ------------------------RTAKPSTHKRPANARTQQK-----------------
I1YHJ7_METFJ      -----------------------ERKSAPKLKTGSSDKTRNAT-----------------
Q3J811_NITOC      -----------------------SHKDKKKS------HRRAPH-----------------
H8GKI6_METAL      -----------------------ERKPRPPQ-------GDKPH-----------------
R4V3K2_9GAMM      -----------------------MDNRRSTG-----------------------------
Q0A6X5_ALKEH      -----------------------IQRSRPGGKGGRGRPGG--------------------
A1WYL7_HALHL      -----------------------PRKPRNGG-----------------------------
A5EYB1_DICNV      -----------------------LDALRNEKE----------------------------
B3E4Q8_GEOLS      ----------------PVASTKQPRGQRPK------------------------------
Q3A6L3_PELCD      ---------------------PVKKSARGR------------------------------
D5MJD9_9BACT      -----------------------AVAANSV------------------------------
E1QG61_DESB2      ----------------PRPAFGPREGGRGRDRDGD-GARGGRGGRR--------------
B8FIL9_DESAL      ----------------KRGPKPDQGQGRGKGRGGKRGGKPGGGPRRR-------------
K4KN61_SIMAS      ------------------------------------------------------------
A4A5A5_9GAMM      ------------------------------------------------------------
C5BSZ2_TERTT      ------------------------------------------------------------
Q21N47_SACD2      ------------------------------------------------------------
RHLB_PSESM        ------------------------------------------------------------
Q1QX32_CHRSD      ------------------------------------------------------------
K0CCW2_ALCDB      ------------------------------------------------------------
Q6FCM5_ACIAD      ------------------------------------------------------------
M5DS63_9GAMM      ------------------------------------------------------------
A6VX62_MARMS      ------------------------------------------------------------
A8ZRU7_DESOH      ------------------------------------------------------------
A0LLL9_SYNFM      ------------------------------------------------------------
E6W520_DESIS      ------------------------------------------------------------
D6Z2Z3_DESAT      ------------------------------------------------------------
I5B4L5_9DELT      ------------------------------------------------------------
C0QD57_DESAH      NAPKKESSQR--------------------------------------------------
Q6APU7_DESPS      ------------------------------------------------------------
M1PCR9_DESSD      ------------------------------------------------------------
D5VC57_MORCB      ------------------------------------------------------------
A5WDI1_PSYWF      ------------------------------------------------------------
M1FKF3_9ALTE      ------------------------------------------------------------
Q2SJR0_HAHCH      ------------------------------------------------------------
                                                                              

RHLB_HAMD5        ------------------------------------------------------------
RHLB_ECOLI        ------------------------------------------------------------
X2H190_9GAMM      ------------------------------------------------------------
RHLB_PHOPR        ------------------------------------------------------------
RHLB_AERHH        ------------------------------------------------------------
RHLB_HAEIN        ------------------------------------------------------------
F4HAT0_GALAU      ------------------------------------------------------------
RHLB_PSYIN        ------------------------------------------------------------
RHLB_SHEAM        ------------------------------------------------------------
RHLB_PSEA6        ------------------------------------------------------------
Q48AH1_COLP3      ------------------------------------------------------------
Q3IDI9_PSET1      ------------------------------------------------------------
RHLB_IDILO        ------------------------------------------------------------
C7R9Y4_KANKD      ------------------------------------------------------------
W8KEA6_9GAMM      TAGSQ-------------------------------------------------------
D3SEQ2_THISK      ------------------------------------------------------------
L0GXY7_9GAMM      ------------------------------------------------------------
I3YBS6_THIV6      RSRASTPRRASEAKPTASAKPAEATVPVAAPVSTPALTIAPDIQSTPPASAPTPPTRVRR
S6BG71_9GAMM      ------------------------------------------------------------
V4JG62_9GAMM      QPQGN-------------------------------------------------------
RHLB_XANAC        ------------------------------------------------------------
RHLB_XYLFT        ------------------------------------------------------------
H8KZW2_FRAAD      ------------------------------------------------------------
M4NKJ1_9GAMM      ------------------------------------------------------------
K0C868_CYCSP      ------------------------------------------------------------
I1YHJ7_METFJ      ------------------------------------------------------------
Q3J811_NITOC      ------------------------------------------------------------
H8GKI6_METAL      ------------------------------------------------------------
R4V3K2_9GAMM      ------------------------------------------------------------
Q0A6X5_ALKEH      ------------------------------------------------------------
A1WYL7_HALHL      ------------------------------------------------------------
A5EYB1_DICNV      ------------------------------------------------------------
B3E4Q8_GEOLS      ------------------------------------------------------------
Q3A6L3_PELCD      ------------------------------------------------------------
D5MJD9_9BACT      ------------------------------------------------------------
E1QG61_DESB2      ------------------------------------------------------------
B8FIL9_DESAL      ------------------------------------------------------------
K4KN61_SIMAS      ------------------------------------------------------------
A4A5A5_9GAMM      ------------------------------------------------------------
C5BSZ2_TERTT      ------------------------------------------------------------
Q21N47_SACD2      ------------------------------------------------------------
RHLB_PSESM        ------------------------------------------------------------
Q1QX32_CHRSD      ------------------------------------------------------------
K0CCW2_ALCDB      ------------------------------------------------------------
Q6FCM5_ACIAD      ------------------------------------------------------------
M5DS63_9GAMM      ------------------------------------------------------------
A6VX62_MARMS      ------------------------------------------------------------
A8ZRU7_DESOH      ------------------------------------------------------------
A0LLL9_SYNFM      ------------------------------------------------------------
E6W520_DESIS      ------------------------------------------------------------
D6Z2Z3_DESAT      ------------------------------------------------------------
I5B4L5_9DELT      ------------------------------------------------------------
C0QD57_DESAH      ------------------------------------------------------------
Q6APU7_DESPS      ------------------------------------------------------------
M1PCR9_DESSD      ------------------------------------------------------------
D5VC57_MORCB      ------------------------------------------------------------
A5WDI1_PSYWF      ------------------------------------------------------------
M1FKF3_9ALTE      ------------------------------------------------------------
Q2SJR0_HAHCH      ------------------------------------------------------------
                                                                              

RHLB_HAMD5        --------------------------------------------RSPQ------------
RHLB_ECOLI        --------------------------------------------RRSG------------
X2H190_9GAMM      --------------------------------------------SST-------------
RHLB_PHOPR        --------------------------------------------GQSRPRNNNRRHPQSQ
RHLB_AERHH        --------------------------------------------GNS----NNRRRPPRK
RHLB_HAEIN        ------------------------------------------------------------
F4HAT0_GALAU      ------------------------------------------------------------
RHLB_PSYIN        ---------------------------------------------------------YHR
RHLB_SHEAM        --------------------------------------------SGSHRSGSGRPPRHDR
RHLB_PSEA6        -----------------------------------------------------RQSSGSR
Q48AH1_COLP3      -----------------------------------------------------QGNRGST
Q3IDI9_PSET1      -----------------------------------------------------RPNNSYQ
RHLB_IDILO        --------------------------------------------------------RSGP
C7R9Y4_KANKD      --------------------------------------------NS--------------
W8KEA6_9GAMM      ------------------------------------AAKPQGEPSGEGNGKPPRRRRRRK
D3SEQ2_THISK      -------------------------------------ARGSGKPSGGGG----HRHRSGG
L0GXY7_9GAMM      -------------------SDAPREEAAPAAPEAGQHDAATSPNDNAPSPK-KRRRRRRR
I3YBS6_THIV6      PTSTRPKVERAALTSRPLSPAQPKPEPAPAILTAPVAEPSSEPVTGVDETKPKRRRRRRK
S6BG71_9GAMM      -----------------------------------------------------RRRSRDR
V4JG62_9GAMM      ------------------GEHPVQTSASVETQPAAEVSPRTADAAGDQHAGKPRRRRRRK
RHLB_XANAC        --------------------------------------------PRRKPRVEGQAPAAAA
RHLB_XYLFT        --------------------------------------------RRTKFRLETERDSSVD
H8KZW2_FRAAD      --------------------------------------------AAGEGGTDPARKR--R
M4NKJ1_9GAMM      --------------------------------------------PAAEGTRKPRRRRGGR
K0C868_CYCSP      --------------------------------------------SRSHKR----------
I1YHJ7_METFJ      --------------------------------------------RRPRS-RRKPKQSVSK
Q3J811_NITOC      --------------------------------------------PRQKK-KSFQKKETYS
H8GKI6_METAL      --------------------------------------------RRQRNGKPRPPKAPAS
R4V3K2_9GAMM      ---------------------------------------------GNRRGSG----GGNN
Q0A6X5_ALKEH      --------------------------------------------AGNRRRSGNDRRGGNN
A1WYL7_HALHL      ---------------------------------------------GPRRSGGGQSGRSSS
A5EYB1_DICNV      --------------------------------------------SRIRIHNRGNRKPMTK
B3E4Q8_GEOLS      ------------------------------------AKDQKGAPRKAAAAPPEGEKKKRR
Q3A6L3_PELCD      ------------------------------------SAAKPGSPPKKDGAP-----RRRR
D5MJD9_9BACT      ------------------------------------RQGRKSAETEGA------------
E1QG61_DESB2      -------------------------------TSSAPAAPTTTVASGDGEKVADGQGQKRR
B8FIL9_DESAL      ----------------------------KPRKEGGSPSPENAPVQADGEAPKK-KPRRRR
K4KN61_SIMAS      ------------------------------------------------------------
A4A5A5_9GAMM      ------------------------------------------------------------
C5BSZ2_TERTT      ------------------------------------------------------------
Q21N47_SACD2      ------------------------------------------------------------
RHLB_PSESM        ------------------------------------------------------------
Q1QX32_CHRSD      ------------------------------------------------------------
K0CCW2_ALCDB      ------------------------------------------------------------
Q6FCM5_ACIAD      ------------------------------------------------------------
M5DS63_9GAMM      ------------------------------------------------------------
A6VX62_MARMS      ------------------------------------------------------------
A8ZRU7_DESOH      ------------------------------------------------------------
A0LLL9_SYNFM      ------------------------------------------------------------
E6W520_DESIS      ------------------------------------------------------------
D6Z2Z3_DESAT      ------------------------------------------------------------
I5B4L5_9DELT      ------------------------------------------------------------
C0QD57_DESAH      ------------------------------------------------------------
Q6APU7_DESPS      ------------------------------------------------------------
M1PCR9_DESSD      ------------------------------------------------------------
D5VC57_MORCB      ------------------------------------------------------------
A5WDI1_PSYWF      ------------------------------------------------------------
M1FKF3_9ALTE      ------------------------------------------------------------
Q2SJR0_HAHCH      ------------------------------------------------------------
                                                                              

RHLB_HAMD5        ------------------------------------------------------------
RHLB_ECOLI        ------------------------------------------------------------
X2H190_9GAMM      ------------------------------------------------------------
RHLB_PHOPR        KQQ---------------------------------------------------------
RHLB_AERHH        S-----------------------------------------------------------
RHLB_HAEIN        ------------------------------------------------------------
F4HAT0_GALAU      ------------------------------------------------------------
RHLB_PSYIN        THKR--------------------------------------------------------
RHLB_SHEAM        TRRHS-------------------------------------------------------
RHLB_PSEA6        NRRKP-------------------------------------------------------
Q48AH1_COLP3      PNRGTRS-----------------------------------------------------
Q3IDI9_PSET1      KGRS--------------------------------------------------------
RHLB_IDILO        PRNAS-------------------------------------------------------
C7R9Y4_KANKD      ------------------------------------------------------------
W8KEA6_9GAMM      PRQEGPATPS--------------------------------------------------
D3SEQ2_THISK      GKPKGS------------------------------------------------------
L0GXY7_9GAMM      PTARPEDGQAVAPPPAEQP-----------------------------------------
I3YBS6_THIV6      PTEGGAEEQQVSANPLPETVE---------------------------------------
S6BG71_9GAMM      GPGGGKGGAAG-------------------------------------------------
V4JG62_9GAMM      PVDDSVPSA---------------------------------------------------
RHLB_XANAC        STEHPVVAAVAAQAPSAGVADAERAPRKRRRRRNGRPVEGAEPALASTPVPAPAAPRKPT
RHLB_XYLFT        GAVTPVFGVSTGIVSAPG----KEVGRNIGLRRRSRSMDSGESG----------------
H8KZW2_FRAAD      RRRRGAGRNDQTATASSVASVGQAGGRPTAAEPTAPGVAAAAPAPVVTP----------A
M4NKJ1_9GAMM      NRRREGAPTDGVETTGHQPAVAEGNRAPRGERRPPRERNAAESAGSGHS----------R
K0C868_CYCSP      ------------------------------------------------------------
I1YHJ7_METFJ      PDANQS------------------------------------------------------
Q3J811_NITOC      GGKNHT------------------------------------------------------
H8GKI6_METAL      APENPR------------------------------------------------------
R4V3K2_9GAMM      RRPSSSSQS---------------------------------------------------
Q0A6X5_ALKEH      GSNGSGGNN---------------------------------------------------
A1WYL7_HALHL      SRRRSGGARTSR------------------------------------------------
A5EYB1_DICNV      SIRRRRYQK---------------------------------------------------
B3E4Q8_GEOLS      PRRKKPGGSVATREENVKTD----------------------------------------
Q3A6L3_PELCD      PRRRPRGKSSGAPSGKDKS-----------------------------------------
D5MJD9_9BACT      ------------------------------------------------------------
E1QG61_DESB2      RRRRKPAGQPKTTNSAGDGE----------------------------------------
B8FIL9_DESAL      RRKKKPAASPPSENQS--------------------------------------------
K4KN61_SIMAS      ------------------------------------------------------------
A4A5A5_9GAMM      ------------------------------------------------------------
C5BSZ2_TERTT      ------------------------------------------------------------
Q21N47_SACD2      ------------------------------------------------------------
RHLB_PSESM        ------------------------------------------------------------
Q1QX32_CHRSD      ------------------------------------------------------------
K0CCW2_ALCDB      ------------------------------------------------------------
Q6FCM5_ACIAD      ------------------------------------------------------------
M5DS63_9GAMM      ------------------------------------------------------------
A6VX62_MARMS      ------------------------------------------------------------
A8ZRU7_DESOH      ------------------------------------------------------------
A0LLL9_SYNFM      ------------------------------------------------------------
E6W520_DESIS      ------------------------------------------------------------
D6Z2Z3_DESAT      ------------------------------------------------------------
I5B4L5_9DELT      ------------------------------------------------------------
C0QD57_DESAH      ------------------------------------------------------------
Q6APU7_DESPS      ------------------------------------------------------------
M1PCR9_DESSD      ------------------------------------------------------------
D5VC57_MORCB      ------------------------------------------------------------
A5WDI1_PSYWF      ------------------------------------------------------------
M1FKF3_9ALTE      ------------------------------------------------------------
Q2SJR0_HAHCH      ------------------------------------------------------------
                                                                              

RHLB_HAMD5        ----------------------------------
RHLB_ECOLI        ----------------------------------
X2H190_9GAMM      ----------------------------------
RHLB_PHOPR        ----------------------------------
RHLB_AERHH        ----------------------------------
RHLB_HAEIN        ----------------------------------
F4HAT0_GALAU      ----------------------------------
RHLB_PSYIN        ----------------------------------
RHLB_SHEAM        ----------------------------------
RHLB_PSEA6        ----------------------------------
Q48AH1_COLP3      ----------------------------------
Q3IDI9_PSET1      ----------------------------------
RHLB_IDILO        ----------------------------------
C7R9Y4_KANKD      ----------------------------------
W8KEA6_9GAMM      ----------------------------------
D3SEQ2_THISK      ----------------------------------
L0GXY7_9GAMM      ----------------------------------
I3YBS6_THIV6      ----------------------------------
S6BG71_9GAMM      ----------------------------------
V4JG62_9GAMM      ----------------------------------
RHLB_XANAC        QVVAKPVRAAAKPSGSPSLLSRIGRRLRSLVSGN
RHLB_XYLFT        HVVATADQVAAKSGSQPSLLGRIGRRIRSLLSMF
H8KZW2_FRAAD      ELKPGRPQEITPVAMDPVKPAGLFKRLGRLLFGR
M4NKJ1_9GAMM      PSRQVAVTSGKPSEHAHPKKPSLFRRLTRLFTGR
K0C868_CYCSP      ----------------------------------
I1YHJ7_METFJ      ----------------------------------
Q3J811_NITOC      ----------------------------------
H8GKI6_METAL      ----------------------------------
R4V3K2_9GAMM      ----------------------------------
Q0A6X5_ALKEH      ----------------------------------
A1WYL7_HALHL      ----------------------------------
A5EYB1_DICNV      ----------------------------------
B3E4Q8_GEOLS      ----------------------------------
Q3A6L3_PELCD      ----------------------------------
D5MJD9_9BACT      ----------------------------------
E1QG61_DESB2      ----------------------------------
B8FIL9_DESAL      ----------------------------------
K4KN61_SIMAS      ----------------------------------
A4A5A5_9GAMM      ----------------------------------
C5BSZ2_TERTT      ----------------------------------
Q21N47_SACD2      ----------------------------------
RHLB_PSESM        ----------------------------------
Q1QX32_CHRSD      ----------------------------------
K0CCW2_ALCDB      ----------------------------------
Q6FCM5_ACIAD      ----------------------------------
M5DS63_9GAMM      ----------------------------------
A6VX62_MARMS      ----------------------------------
A8ZRU7_DESOH      ----------------------------------
A0LLL9_SYNFM      ----------------------------------
E6W520_DESIS      ----------------------------------
D6Z2Z3_DESAT      ----------------------------------
I5B4L5_9DELT      ----------------------------------
C0QD57_DESAH      ----------------------------------
Q6APU7_DESPS      ----------------------------------
M1PCR9_DESSD      ----------------------------------
D5VC57_MORCB      ----------------------------------
A5WDI1_PSYWF      ----------------------------------
M1FKF3_9ALTE      ----------------------------------
Q2SJR0_HAHCH      ----------------------------------