CLUSTAL format seed alignment for MF_00662

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSD_BACAN       --------------MRRTLYRLMIELTNGRFTSYTLRKFAQSRLSSIIIPSYAKVFQINQ
PSD_BACCR       --------------MRRTLYRLMIELTNGRFTSYILRKFAQSRLSSIIIPSYAKVFQINQ
PSD_BACHD       --------------MRKTFFRLCFELSSHPVLSSMLQAFTTSKASRWLIPSFVRVYNING
PSD_BACSU       ----------MFNTAVKILYRSLIELTNHRLSSYLIKGFCESKISKPVIPLFSKHFRLNW
PSD_SALTI       -----------MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDM
PSD_SALTY       -----------MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDM
PSD_ECOLI       -----------MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDM
PSD_YERPE       -----------MLDSIKIKLQYLLPKQGLTQLAGWGANKQGGWLTQLVIKAFARYYKVDM
PSD_DICD3       -----------MLDRIKIALQHLLPKVWLTQLAGWGADRQAGMLTKLVIDLFARIYKVNM
PSD_VIBPA       ------------MDKIKVGLQYWIPQHGLTRLVGKLASAKAGSLTTAVIRWFIKQYNVNM
PSD_VIBVU       ------------MDKIKVGLQYWIPQHGLTRLVGKLASAKAGSLTTAIIRWFIKQYNVNM
PSD_VIBCH       ------------MDKIKVGLQYWIPQHALTRLVGKLASARAGSLTTAIIRWFIKQYNVNM
PSD_HAEIN       -----MMTSNSYWQRLKVAFQYVMPQIYLTQIAGWFAKQKWGKITHFVIKAFAKKYNIDM
PSD_PASMU       MNILEKKAQLSYWQRIKIAFQYVMPQLYLTRLAGWFAKQQWGAVTHFVIKLFAKKYHVDM
PSD_PSEAE       ---------MSFKDRLFICSQYLLPHHLLSRLIGFAADCRATWFKDRLIAWFARRYQVDM
PSD_PSEPK       -----------MKSRLFIISQYLLPHHLLSRLAGCIAECRVRWFKNAFTAWFAKRYQVNM
PSD_XANAC       -------------MSLVTSLTYVLPHRLLSSLARALAYSQTPSTKQWLIDTVTRKFGVDL
PSD_XANCP       -------------MSLVTSLTYVLPHRLLSSLARALAYSKSPATKQWLIDTVTRKFGVDL
PSD_XYLFA       -------------MNFVTTLTYLLPHRMLSSLARHVAYCQHPLIKQWLIDTVIAKFDVNL
PSD_XYLFT       -------------MNFVTTLTYLLPHRMLSSLARHVAYCQHPLIKQWLIDTVIAKFDVNL
PSD_COXBU       ----------------MTKLHKYLPQRTLSKIVGWLATREWGLLTQWAIRLFIRHYGINM
PSD_WIGBR       ---------------MKTKLQYYLPKMLITKFFGWLAEKKAGIITYWIILFFIKIYKINL
PSD_HELPY       --------------------MVALSNALSRVFGSLAGYKFPSFIQKGINALYVKIFKIDL
PSD_HELPJ       --------------------MVALSNALSRVFGSVAGYKFPSFIQKSINALYVKIFKIDL
PSD_CAMJE       ---------------------MSFSKESSRLFGFVAGIKFPKMIQKVINENYVKYFNINM
                                       :                               : :: 

PSD_BACAN       DEMEKG-LKEYRTLHELFTRKLKEGKRSIDTDASSIVSPVDGVFADHG--PIEDTK--TF
PSD_BACCR       DEMEKG-LKEYRTLHELFTRKLKEGKRSIDTDASSIVSPVDGVFADHG--PIEDTK--TF
PSD_BACHD       QEAEKP-LHTYQSLQEVFTRTLTENCRPIDLSPKSIVSPVDGVLAEQG--TLSDEA--NF
PSD_BACSU       DDVDGT-AADYGSLSELFIRQINLERRPVSKEAHAVVSPVDGVVQTVG--IINPNQ--TF
PSD_SALTI       TEAQKPDTASYRTFNDFFVRPLRDDVRPLNTDPNILVMPADGVISQLG--RIEEDK--IL
PSD_SALTY       TEAQKPDTASYRTFNDFFVRPLRDDVRPLNTDPNILVMPADGVISQLG--RIEEDK--IL
PSD_ECOLI       KEAQKPDTASYRTFNEFFVRPLRDEVRPIDTDPNVLVMPADGVISQLG--KIEEDK--IL
PSD_YERPE       KEAQDPEFSAYRTFNEFFVRPLRAGVRPVVAEENLLAQPADGAISQLG--AIREGQ--IL
PSD_DICD3       QEAQQPDTASYRSFNDFFVRPLKPGIRPVDPLPNRLVFPADGAISQLG--AIDDDR--IL
PSD_VIBPA       DEAKHSDPKHFKTFNEFFVRELKEGARPITEGDEIITHPADACVSQFG--PIEDGQ--LI
PSD_VIBVU       DEAKHADPKHYKTFNEFFVRELKEGARPIAEGDAIITHPADACVSQFG--PITNGQ--LI
PSD_VIBCH       DEALHSDPTHFKTFNEFFVRELKAGVRPIAEGEKVITHPADACVSQFG--AIEYGK--LI
PSD_HAEIN       SIAQKEQFSDYASFNEFFIRPLKENARPINQNPTALCLPADGRISECG--HIDDNL--LL
PSD_PASMU       SEAAKPNFSDYASFNEFFIRPLADNARPINQNPTALCLPADGRISQLG--HIEQDL--LL
PSD_PSEAE       REAQVEDLQAFEHFNAFFTRALKDGARPLAQEPGAVLCPADGAISQLG--PIEHGR--IF
PSD_PSEPK       SEALVEDLSAYEHFNAFFTRALKPGARPLDETPGAILCPADGAVSQLG--PIEHGR--IF
PSD_XANAC       SEAQEPDPHAYPTFNAFFTRALKPGARVPDADPSAVLMPADGRISQLG--PVENGR--IF
PSD_XANCP       SEAQEPDPRVYPTFNAFFTRALKPGARVPDADPQALLMPADGRISQLG--PIENGR--IF
PSD_XYLFA       SEAAEPDAHAYPSFNAFFTRSLKTGIRLPDPNPDTLLMPADGRISQLG--PIREGR--IF
PSD_XYLFT       SEAAEPDAHAYPSFNAFFTRSLKAGIRPPDPNPDTLLMPADGRISQLG--PIREGR--IF
PSD_COXBU       QEAQYPDIGHYPSFNAFFTRYLKRELRPVVEEPRAIASPVDGIISEMG--QIKGEN--LI
PSD_WIGBR       KEIKTKDIKSYNTFNDFFSRRIKIDCRRIDYDPSIIICPADGIITNFG--YIENTE--KL
PSD_HELPY       SEFEPL--ENYRSLNALFTRSLKKE-RPFDKSPNICIAPCDALITEC--AFLDNDS--AL
PSD_HELPJ       SEFEPL--ENYKSLNALFMRSLKKE-RPFDKAPNICIAPCDALITEC--AFLDNDS--AL
PSD_CAMJE       SEFKAP--CEYESLNALFTRTLQIP-RKFEEG---FISPSDGKILECGSTFLANEEHFAF
                          :  :  .* * :    *           * *. .       :       :

PSD_BACAN       DIKGKRYSIVDMLG-NEERAQRYAGGTYMVIYLSPSHYHRIHSPLSGSVTERFVLGRKSY
PSD_BACCR       DIKGKRYSIVDMLG-NEERATRYAGGTYMVIYLSPSHYHRIHSPLSGSVTERFVLGRKSY
PSD_BACHD       VVKNQTYTLEEMLG-GKEKAKLYREGTYLLFYLSPSHYHRIHSPVNGTIKEQWTLGNKSA
PSD_BACSU       TVKGKDYSFAELTG-CKSADHQYNGGYFVVLYLSPRHYHRFHSPISCRYQKLAELGNRSY
PSD_SALTI       QAKGHNYSLEALLAGNYLMADKFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLF
PSD_SALTY       QAKGHNYSLEALLAGNYLMADKFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLF
PSD_ECOLI       QAKGHNYSLEALLAGNYLMADLFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLF
PSD_YERPE       QAKGHNYSLEALLAGNYLLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYVPGDLF
PSD_DICD3       QAKQHDYTLEALLAGNYIISDLFRDGLFVTTYLSPRDYHRVHMPCDGILRDMIYVPGDLF
PSD_VIBPA       QAKGHNYSAQELLGGDEKLAEEFKDGSFATLYLSPRDYHRVHMPCDGTLRQMIYVPGDLF
PSD_VIBVU       QAKGHDFSAQELLGGDAALAEEFKDGSFATLYLSPRDYHRVHMPCDGTLRQMIYVPGDLF
PSD_VIBCH       QAKGHTYSAQELLGGDAKLAEEFRDGDFATLYLSPRDYHRVHMPCDGTLRQMIYVPGDLF
PSD_HAEIN       QAKGHFFSLEDLLAEDKELVETFKNGEFVTTYLSPRDYHRVHMPCDATLRKMIYVPGDLF
PSD_PASMU       QAKGHYFSLNDLLAGDEALAHHFKDGEFATTYLSPRDYHRVHMPCDATLCKMIYVPGDLF
PSD_PSEAE       QAKGHSYSLAELLGGDAELAAPFMGGDFATVYLSPRDYHRVHMPLAGTLREMVYVPGRLF
PSD_PSEPK       QAKGHGFSAQELLGGDPAMAAPFMGGEFATIYLSPKDYHRVHMPLAGTLREMVYVPGRLF
PSD_XANAC       QAKGQSFTAAELLG-DEAAAAPFNDGVFATVYLSPKDYHRVHMPWTGTLRETVHVPGRLF
PSD_XANCP       QAKGQSFTAAELLG-DESAAVPFHNGLFATVYLSPKDYHRVHMPWSGTLRETVHVPGRLF
PSD_XYLFA       QAKGQSFTATELLG-DTAAAAAFTNGLFATVYLSPRDYHRVHMPCTGQLLKTVHVPGRLF
PSD_XYLFT       QAKGQSFTATELLG-DTAAASAFTNGLFATVYLSPRDYHRVHMPCTGQLLKTVHVPGRLF
PSD_COXBU       QAKNHHYTITALLGEDPSRASQFLDGDFFTAYLAPKNYHRIHMPLDGRLIEMIHIPGKLF
PSD_WIGBR       QLKNHNYTLKSLLAQNETMIDIFQHGIFFTTYLSPKNYHRIHMPCDGSLIKMIYVPGQLF
PSD_HELPY       QIKGMPYKAHELVG---EINPLSPSFFYANFYLSPKDYHHYHAPCDLEILEARYFAGKLL
PSD_HELPJ       QIKGMPYKAHELVG---EINPLSPSFFYVNFYLSPKDYHHYHAPCDLEILEARYFAGKLL
PSD_CAMJE       SIKGHAYSVEELLKDSFEKDELKNGLDYVNIYLSPKDYHRYHSPCDMQILSATYTSGVLY
                  *   :.   :               :   **:* .**: * *      .         

PSD_BACAN       PVNAAGMEYGKEPLSKNYRSVTEVNSDGE-HMALVKVGAMFVNSIELLHERDTVQ-----
PSD_BACCR       PVNAAGMEYGKEPLSKNYRSVTEVSSDGE-HMALVKVGAMFVNSIELLHERDTVQ-----
PSD_BACHD       PVNNLGLRYGKRPLSRNYRLLTELEAEEG-RCIVAKIGALNVNSIVPTHQSEHVD-----
PSD_BACSU       PVNQLGLKYGKDVLSKNYRFVYELNSGSR-NVLMIPVGAMNINSIVQTNTRTELE-----
PSD_SALTI       SVNYLTAQNVPNLFARNERVICLFDTEFG-PMAQILVGATIVGSIETVWAGTITPPREGI
PSD_SALTY       SVNHLTAQNVPNLFARNERVICLFDTEFG-PMAQILVGATIVGSIETVWAGTITPPREGI
PSD_ECOLI       SVNHLTAQNVPNLFARNERVICLFDTEFG-PMAQILVGATIVGSIETVWAGTITPPREGI
PSD_YERPE       SVNPLTAANVPNLFARNERVICIFDTAFG-PMAQILVGATIVGSIETVWAGTITPPREGV
PSD_DICD3       SVNPLTAANVPNLFARNERVICLFDTPFG-PMVQILVGATIVGSIETVWAGVVTPPREGI
PSD_VIBPA       SVNPLTAENVPNLFARNERVVCIFDTEFG-PMAQVLVGATIVGSIEQVWAGTITPPRGNT
PSD_VIBVU       SVNPLTAENVPNLFARNERVVCIFDTEFG-PMAQVLVGATIVGSIEQVWAGTITPPRGNT
PSD_VIBCH       SVNPLTAENVPNLFARNERVVCIFDTEFG-PMAQVLVGATIVGSIELVWAGTVTPPRGNT
PSD_HAEIN       SVNPFLAQHVPNLFARNERVICVFDTEFG-TMVQILVGATITASIGTTWAGVINPPRHNE
PSD_PASMU       SVNPFLAEHVPNLFARNERVICVFDTEFG-KMVQILVGATITASMSTVWAGVINPPRPEK
PSD_PSEAE       SVNQTTAENVPELFARNERVVCLFDTERG-PMAVVLVGAMIVASIETVWAGLVTPPKREL
PSD_PSEPK       SVNQTTAENVPELFARNERVVCLFDTERG-PMAVVLVGAMIVASIETVWAGLVTPPKREL
PSD_XANAC       SVGPDAVRKVPRLFARNERLVCHFDTEFG-PMASVMVGALLVSGVETVWSGVEIPRYGDR
PSD_XANCP       SVGPDAVRNVPRLFARNERLVCHFDTDFG-PMASVMVGALLVSGVETVWSGVEIPRYGDR
PSD_XYLFA       SVGPDAVRQIPRLFARNERLACHFDTAFG-PMVLVMVGALLVSGVETVWGGVEIPAYGDR
PSD_XYLFT       SVGPDAVRQIPRLFARNERLVCHFDTTFG-PMVLVMVGALLVSGVETVWGGVEIPAYGDR
PSD_COXBU       SVNPASVQTVPRLFARNERAVCLFETENG-LMAVILVGAMLVGSINTVWHGTVVPTAEG-
PSD_WIGBR       SVNLKFYKNISNIFSKNERVICLFKTNFG-YMIQILVGSIISGTISTSWYGKINYKRDGI
PSD_HELPY       PVNKPSLHKNNNLFVGNERVTLVAKDIQGNRLYFVAVGALNVGKMRFNFDKNIQTNAKAR
PSD_HELPJ       PVNKPSLHKNKNLFVGNERVALVAKDIQGNKLYFVAVGALNVGKMRFNFDKNIQTNAKAR
PSD_CAMJE       SVNEKHLERISNLYVKNERVSLKCQNEKG-IFWLVFVGAQNVGKMRFNFDASIQTNAKIS
                .*.             * *     .           :*:     :               

PSD_BACAN       ------------------KGEEMAYFTFGSTVVLLFEKDMIEVVQELKSGQELRLGEKIA
PSD_BACCR       ------------------KGEEMAYFTFGSTVVLLFEKDMIEVVQELKSGQELRLGEKIA
PSD_BACHD       ------------------KGEEIGYFAFGSSVMLFFEKGTIQLDHQPRA-VEVKMGEKVG
PSD_BACSU       ------------------IGEELGYFSFGSTVILVFEKDAFQPSAHLAEGQEVQVGELIG
PSD_SALTI       IKRWTWPEGEHEGSVALLKGQEMGRFKLGSTVINLFAPGKVNLIASLASLSVTKIGQPLA
PSD_SALTY       IKRWTWPEGEHEGSVALLKGQEMGRFKLGSTVINLFAPGKVNLIASLASLSVTKIGQPLA
PSD_ECOLI       IKRWTWPAGENDGSVALLKGQEMGRFKLGSTVINLFAPGKVNLVEQLESLSVTKIGQPLA
PSD_YERPE       IRRWTYPQAGCEGAITLEKGQEMGRFKLGSTVINLFAEGKVYFAPQLNSGAVTRMGEVLA
PSD_DICD3       IKRWAYPMEG-EGAVILEKGDEMGRFKLGSTVINLFAKDRVQLMPGLASQSVTRMGEAMA
PSD_VIBPA       VYKWDYPAEG-DKAVILKKGEEMGRFKLGSTVINLFAKDAIEFDVSMENGQPTVMGTPYA
PSD_VIBVU       VYKWDYPASG-NHAVILKKGEEMGRFKLGSTVINLFAKDAIRFDESMANGQPTVMGTPYA
PSD_VIBCH       VYRWDYPANG-NQAVVLKKGEEMGRFKLGSTVINLFAKQAIRFDDSMALGAPTRMGEPYA
PSD_HAEIN       VKTWTYEGES---AVKLLKGQEMGWFQLGSTVINLFQANQVRLADHLSVNEPVRMGEILA
PSD_PASMU       ITTWTYEGAS---AVKLTKGQEMGAFQLGSTVINLFEKDRVQLASHLQVDSPVRMGEILA
PSD_PSEAE       KTFRYDEAARA--PIRLEKGAELGRFKLGSTAIVLFGPQQVAFNDGLGAASPVRMGECLA
PSD_PSEPK       KTFRYDEASRT--PIHLEKGAELGRFKLGSTAIVLFGPEQVKWAESLGAGSAVRMGQQLA
PSD_XANAC       ITRKDYRGKG----VVLEKFAEMARFNYGSTVIVLLPPGVATLDGGLAAETSVRLGQALA
PSD_XANCP       ITRKDYRGKG----ITLERFAEMARFNYGSTVIVLLPPGVAALEGGLAAESSVRLGQALA
PSD_XYLFA       ITHKDYQGRN----IAIERFAEMARFNYGSTVIVLLPPNVFTLAPHLTAESPVTLGQALA
PSD_XYLFT       ITYKDYQGRN----IAIERFAEMARFNYGSTVIVLLPPNVLTLAPHLTAESPVTLGQALA
PSD_COXBU       IAVHNYREKN----IKFKRGEEIGHFKMGSTVILLFPKNTIQWNPNCQPKGTICYGENIG
PSD_WIGBR       IKLWKYNINSNNKPIFLKKGDEMGFFTLGSTVITLFSKKNILIKENLSNYKEVRVGDVLA
PSD_HELPY       FTQTYSYNPP----IKVKKGDNLGNFEMGSTIVLFIQN--TAFKDLKEK--NVKFGESIG
PSD_HELPJ       FMQTYSYNPP----IKVKKGDNLGNFEMGSTIVLFIQN--TAFKDLKEK--SVKFGESIG
PSD_CAMJE       HNFTRKYEN-----LNFKKGEELGNFELGSTIVLISQKGLLTFNLKVGQ--GIKFGEKIA
                                     ::. *  **: : .                    *   .

PSD_BACAN       TRLAHK--------------------------------
PSD_BACCR       TRLAHK--------------------------------
PSD_BACHD       SWLR----------------------------------
PSD_BACSU       YEE-----------------------------------
PSD_SALTI       TSTETFVAPEVEPAPLPAEEIKAEHDASPLVDNKKDDT
PSD_SALTY       TSTETFVAPEVEPAPLPAEEIKAEHDASPLVDNKKDDT
PSD_ECOLI       VSTETFVTPDAEPAPLPAEEIEAEHDASPLVDDKKDQV
PSD_YERPE       EAVPTTPSY-----------------------------
PSD_DICD3       EALDEDILARMSANDDTDTTP-----------------
PSD_VIBPA       LKK-----------------------------------
PSD_VIBVU       HQQ-----------------------------------
PSD_VIBCH       HQA-----------------------------------
PSD_HAEIN       YKK-----------------------------------
PSD_PASMU       HQK-----------------------------------
PSD_PSEAE       LPKQS---------------------------------
PSD_PSEPK       APAQA---------------------------------
PSD_XANAC       RRQ-----------------------------------
PSD_XANCP       RRQVA---------------------------------
PSD_XYLFA       HRLSLNHSTQAPTQEK----------------------
PSD_XYLFT       HRLSLNHSTQAPTQEK----------------------
PSD_COXBU       TVSLIEVA------------------------------
PSD_WIGBR       YGIQNVK-------------------------------
PSD_HELPY       EFHAN---------------------------------
PSD_HELPJ       EFHAN---------------------------------
PSD_CAMJE       D-------------------------------------