CLUSTAL format seed alignment for MF_00664

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSD_BACTN       ----------------MGRLKKLKKIRIHREGTHILWASFLLLLL--INAALYWGIDCKI
PSD_CHLTE       -------------------------MRIAPYGTGSVVKTAIFCFVIFITALFLPQPG---
PSD_STRCO       ----------MPHSQTSAPRDSLAGVRLARGASPWLLPTVATAAVSLLRARRSGTA----
ASD_METJA       ------------------------------MGK--YKKFFAIAV----------------
ASD_ARCFU       --------------------------MIERSGYGIIAASLLLSAVAYLL-----------
ASD_METKA       --------------------------MMAPGWWKFVTPPAALGAALFPWSR---------
ASD_HALSA       ----------------------------------MLARGPWTWKYALPPA--VVGVAALA
ASD_METAC       --------------------------MIAKGSEPWLFAAASATALFAILSWATDSLPF--
ASD_METMA       --------------------------MIAKGSEPWLFTAASVTALFAILSRATDGLPF--
ASD_METTH       --------------------------MLPKRA-SFLVSVATIPLLFG-------------
PSD_AGRFC       --------------MNLFDTIRNTIVPIHKEGYVFVAAFFVASLV-------LGWI----
PSD_RHIME       --------------MSLIDTVRNTLVPVHREGYRFIAIFFVVSLA-------LGFLW---
PSD_RHILO       --------------MSLVDTVKNAFVPIHREGYPFIAACGAGTLF-------L--GYF--
PSD_BRUME       --------------MSLTDTIRNTFVPIHREGYPFIAGFFVVSLM-------LGWLW---
PSD_BRUSU       --------------MSLTDTIRNTFVPIHREGYPFIAGFFVVSLI-------LGWLW---
PSD_BRADU       --------------MSILDSIQRQIPPIHKEGYPFIGGFALASLI-------LFWLW---
PSD_RICCN       -----------------MKQYNDLFKIIHREGYIFIASFALVSFL-------LASF----
PSD_RICPR       -----------------MKQYNDLFKIIHREGYIFIASFALVSFL-------LASF----
PSD_MYCLE       MARRPRAESSKEGPAHLLELVRSAVPPVHSAGHPFISAGLAVTSAGAVGQVVTGRD----
PSD_MYCTU       ----MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHR------------
PSD_NEIGO       ------------------MNRLYPHPIIAREGWPIIGGGLALSLL-------VSMC----
PSD_NEIMA       ------------------MNRLYPHPIIAREGWPIIGGGLALSLL-------VSMC----
PSD_NEIMB       ------------------MNRLYPHPIIAREGWPIIGGGLALSLL-------VSIC----
PSD_NITEU       -----------------MSTPYYPHPIIAREGWPFIAGAFAVALL-------VQFMA---
PSD_RALSO       ------------------MNNTYPHPIIAREGWPYLGGIFIVTLIVHAAA----------
PSD_ZYMMO       ------MNKEEQRKNSAAQSIRWHFPSIHPEGRKFFVIAVIISAI-------ITYFS---
                                                                            

PSD_BACTN       PFYVVAVASIAVYLLMVNFFRCPIRLFGKDTEKIVVAPADGKIVVIE-----EVDE-NE-
PSD_CHLTE       -GVILATAALGFLLFTLYFYRDPERKIPDG-KGLVIAPADGKIVLKQ-----TLDHP---
PSD_STRCO       --KAVAVPATALAAGMLWFFRDPEREI--T-QGRVVSPADGVVQSIM---------P---
ASD_METJA       ---------CSLLLFTVYFYRDPDRVITKG-NNIILSPADGTVEYIK---FYENGNP-EV
ASD_ARCFU       -HPLISALFVGFALFTAYFFRDPERKI----GEGVVSPADGRIDYLE-------------
ASD_METKA       ---PLSFLCLGTAAFLAFFFRNPPREPPSD-PSLAVSPADGRLLGYVMEAGEASDD--EL
ASD_HALSA       ASSPWGVVGVALAAFVVWFHRDPDRS-P-N-GAGVVVPADGTVSVIR-------------
ASD_METAC       -LNHAAHMGMALTFFMVIFFRDPERKVEIS-DAYMISPADGTVIDIR-------------
ASD_METMA       -LNYIANVGMALTFVMVIFFRDPERKVETS-DTYMISPADGTVIDIR-------------
ASD_METTH       -YHAIGILMFTVIAFMMQFFRDPDRIPPSD-EDLIIAPADGRRLSGKIDRIERVGS----
PSD_AGRFC       -AEPLFWVGLVLTAWCAYFFRDPERVTPQD-DDLIISPADGKVSAVQ-----SVVPPLEL
PSD_RHIME       -EP-LMWIGFVLTAWCAYFFRDPERMTPID-DDLVISPADGTVSSVA-----TVMPPEEL
PSD_RHILO       -SSVLFWLGLILTAWCVYFFRDPERVTPVD-DRLVVSPADGIISAVG-----PAVPPREL
PSD_BRUME       --DPLFWIGMVLTVWCIYFYRDPERVTPMD-DDLVISPADGKVSFVG-----LAVPPAEL
PSD_BRUSU       --DPLFWIGMVLTVWCIYFYRDPERVTPMD-DDLVISPADGKVSFVG-----LAVPPAEL
PSD_BRADU       -SP-LGWIGTILTVWCALFFRDPVRVTPVR-EGLVVSPADGRVSMIT-----MALPPAEL
PSD_RICCN       -NEKLGCIGCIATAWCIYFFRNPDRFVPIS-DDLVISPADGIIQEIK-----EALPPPEL
PSD_RICPR       -NEKLGCIGFIATIWCIYFFRNPDRFVPIS-DDLVISPADGIIQEIK-----EASPPPEL
PSD_MYCLE       -LRWLRRVGLLAASACAVFFRHPSRVPPTR-AGVVVAPADGMICVID-----SATPPAEL
PSD_MYCTU       -YRWLRGTGLLAAAACAGFFRHPQRVPPTR-PAAIVAPADGVICAID-----SAAPPAEL
PSD_NEIGO       -CGWWSLPFWVFTVFALQFFRDPAREIPQN-PEAVLSPVDGRIVVVE-----RARDPYR-
PSD_NEIMA       -CGWWSLPFWVFTVFALQFFRDPAREIPQN-PEAVLSPVDGRIVVVE-----RARDPYR-
PSD_NEIMB       -CGWWSLPFWVFTVFALQFFRDPAREIPLN-PEAVLSPVDGRIVVVE-----RARDPYR-
PSD_NITEU       -GWLWALPFWLIALFVLQFFRDPPRVVPAL-AGAVLAPADGRIVAVD-----KVQDPY--
PSD_RALSO       -GLGWAWPFWLLTVFVLQFFRDPARTVPTQ-ANAILSPADGRIVAVE-----QVRDP---
PSD_ZYMMO       -WLWMAWPLGVLCFCVAAFFRDPIRTVPEG-DGLIVSPADGMVCLIA-----DVPPPPEL
                                  *.* * *          : *.**                   

PSD_BACTN       -------------YFHDRRLMISIFMSIVNVHANWYPVDGTIKKVAHHNGNFMKAWLPKA
PSD_CHLTE       -------------VTGPGSTLVSIFMSPFNVHVNRIPVDGLVRDLRYHEGKFLMAFDHRS
PSD_STRCO       --------------WKDGRTRVAIFMSPLNVHVNRAPLAGTVTSVEHVPGGFVPA-FNKE
ASD_METJA       FKDGNCYVLNVSRYFPNGCYVVGIFMSPLDVHVNRAPIGGRIVYIKHIDGSFYPAFLEGV
ASD_ARCFU       ------------------GRRLEIFMSPFDCHINRAPWGGKVLSVKFIEGSTPPAFIRKS
ASD_METKA       ------------SSYLDDPITVSVFMSPLDVHVNRAPLDGRVVEAEILKGRFRPAFRKDS
ASD_HALSA       -------------TRDDGRVRVGVFMNVHNVHVNRVPVAGRVESVVHEPGGHRPA-FSKE
ASD_METAC       ------------------DRKICIFMFLQNVHVNRAPISGKIREITYKKGGYLPA-FCKD
ASD_METMA       ------------------DRKICIFMFLQNVHVNRAPISGKISEIIYKKGGYLPA-FCKD
ASD_METTH       ----DYPLIDRIFPDGSGGILISTFMSPFDVHVNRAPVSGKVIYTEHVDGRFQVA-RSRV
PSD_AGRFC       ----E--------LGKEPMVRISVFMNVFNCHVNRAPVRGRIVNVAYRPGLFLNAEVDKA
PSD_RHIME       ----G--------LGSEPMLRISVFMNVFNCHVNRAPMGGTVRRIAYRAGKFVNAELDKA
PSD_RHILO       ----G--------LGNVEMTRISVFMNVFSCHVNRSPVRGRIAKIEHRPGKFLNAELDKA
PSD_BRUME       ----D--------LGYEPMTRVSVFMNVFSVHINRSPVRGKIDKVVHRPGKFLNAELDKA
PSD_BRUSU       ----D--------LGYEPMTRVSVFMNVFSVHINRSPVRGKIDKVVHRPGKFLNAELDKA
PSD_BRADU       ----G--------LGDRPLPRISVFMSVFNCHVNRSPIAGRVDRIAYRPGLFINAELDKA
PSD_RICCN       ----G--------LGDVEMIRVSIFLNIFNVHVNRIPANGKILALHYNPGKFFNASLDKA
PSD_RICPR       ----G--------LGDLEMIRVSIFLNIFNIHVNRIPANGKILALHYNPGKFFNASLDKA
PSD_MYCLE       ------------SMGNMSLPRVSIFLSLLDVHVQRAPISGEVIAVQYQPGRFGAADLAPA
PSD_MYCTU       ----S--------MGDTPLPRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEA
PSD_NEIGO       ---------------DVDALKISIFMNVFNVHSQKSPADCTVTKVVYNKGKFVNADLDKA
PSD_NEIMA       ---------------DVDALKISIFMNVFNVHSQKSPADCTVTKVVYNKGKFVNADLDKA
PSD_NEIMB       ---------------DVDALKISIFMNVFNVHSQKSPADCTVTKVVYNKGKFVNADLDKA
PSD_NITEU       --------------LPREALKVSVFMNVFNVHSNRSPVDGEIRNRWYFPGNFLNASLPKA
PSD_RALSO       -------------YADRDALKISVFMNVFNVHSNRAPVDGTVQQVQYFPGKFVNADLDKA
PSD_ZYMMO       --------AGADGLGDAPLTRVSIFMSVFDVHINRAPVPGRIARIAYIPGAFVNADLDKA
                                     :  *:   . * :  *    :       *    *     

PSD_BACTN       STENERSTVVIETPEGVEVLTRQIAGAVARRIVTYAEVGEECYIDEHMGFIKFGSRVDVY
PSD_CHLTE       MTDNERMEITLDTAAG-PLWFCQVSGFVARRIVCDLEAGQEVASGKRFGMIKLGSRVDIV
PSD_STRCO       SENNERVVWHFDTELG-DIEMIQIAGAVARRIVPYVPQGTKVEQGERVGLIRFGSRVDLY
ASD_METJA       EKINERNIVIIKNGSE-YVGVVQIAGFVARRCWLSIKEGECINMGQKIGMIKLGSQTAVI
ASD_ARCFU       GVRT--NEILIETEHG-VFRVLQMAGIFARRIVSYVSEGDVVKKGQKIGMIRFGSRVVLE
ASD_METKA       ATENNRAVLLFD--GDPPFVVRLVSGAVARRIDLYVQEGDEVNKGEPIGMIRFGSRVDLA
ASD_HALSA       SAHNER--VRIETA---EWTVVLIAGAFARRIHPYVEAGEDLARGDRLGHISFGSRADVV
ASD_METAC       SERNERNEFIIHSKYG-DVEVTQIAGTIARRIVTYSNVNDSVEQGQRIGMIRFGSRVDVT
ASD_METMA       SERNERNEFIIHSKYG-DVRVTQIAGIIARRIVTYSNVNDTVEQGQRIGMIRFGSRVDVT
ASD_METTH       LTENEKNLIVIKTDYG-NVGVIQIAGFVARRIVQYVKEGEYVERGDRIGMIRFGSRVDLV
PSD_AGRFC       SEDNERNGLVIETSHGK-VGVVQIAGMVARRIVCWVKPNEPVDAGERFGLIRFGSRLDIF
PSD_RHIME       SQENERNGLVIETKHGQ-IGVVQIAGLVARRILCWTRESASLEAGERFGLIRFGSRLDVF
PSD_RHILO       STENERNGLVIESPNGT-VAAVQIAGLVARRIVCWAEAGGSIGTGERFGLIRFGSRVDVF
PSD_BRUME       STENERNSVLIESPHGK-IGVVQIAGLVARRIVCWSNQDDELSVGERFGLIRFGSRVDVY
PSD_BRUSU       STENERNSVLIESPHGK-VGVVQIAGLVARRIVCWSNQDDELSVGERFGLIRFGSRVDVY
PSD_BRADU       SEDNERNSLVITTPTAR-IGVVQIAGLIAKRIVCFVREGQAIGAGERFGLIRFGSRLDVY
PSD_RICCN       SIYNERQSVLMETAQGQKIVFVQIAGLIARRIVCDLEEGNEVKTGERYGIIRFGSRVDVY
PSD_RICPR       SLYNERQSVLMETDQGQKIVFVQIAGLIARRIVCDLEEDNEVKMGERYGIIRFGSRVDVY
PSD_MYCLE       STENERTSVRIRTAGGTEVVVVQIAGLLARRIVCYAHIGDKLTIGDTYGLIRFGSRLDTY
PSD_MYCTU       SDDNERTSVRIRMPNGAEVVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTY
PSD_NEIGO       STENERNAVLATTASGREITFVQVAGLVARRILCYTQAGAKLSRGERYGFIRFGSRVDMY
PSD_NEIMA       STENERNAVLATTASGREITFVQVAGLVARRILCYTQAGAKLSRGERYGFIRFGSRVDMY
PSD_NEIMB       STENERNAVLATTASGREITFVQVAGLVARRILCYTQAGAKLSRGERYGFIRFGSRVDMY
PSD_NITEU       SLENERNALWIRTDGGQDVTCVQIAGLIAKRIVCHVHPGEHLARGQRFGFIRFGSRVDVY
PSD_RALSO       SLENERNAVVLRRADGQVVTSVQVAGLIARRILCYTKVGETLARGQRYGFIRFGSRVDVY
PSD_ZYMMO       SEKNERQHFMIETKEGINVGLTQIAGLIARRIVPLTKVEDYVERGERIGLIRFGSRLDVY
                   .                   ::* .*:*             ..  * * :**:    

PSD_BACTN       LPLGT---EVCVNMGQLTTGNQTVIAKLK-------------------------------
PSD_CHLTE       LPSSI---QIKVKEGMKTTAGETILGQTGGF-----------------------------
PSD_STRCO       LPEGV---EVDVEVGQKTVAGVTRIDRD--------------------------------
ASD_METJA       IPANY---NITVKVGERVYAGQTIIAVKRTDN----------------------------
ASD_ARCFU       VPEGF---RFVRGVGEKVKAGETVALRDESFQGS--------------------------
ASD_METKA       VPRSS-VEELLVRKGDSVKAGETPVIRVKR------------------------------
ASD_HALSA       LPPAYDRGDVVVESGQTVRAGETVLAR---------------------------------
ASD_METAC       IPHDF---DITVCKGERVLAGKTVIATIKNDRDF--------------------------
ASD_METMA       IPHDF---DITVEKGERVLAGKTIIATIKNDRDF--------------------------
ASD_METTH       LPENC---EVLVKTGSRPMAGETVVARFNPGKKR-------------VNVQ---------
PSD_AGRFC       LPAGF---EPRVSVGQTAIAGETVLAEFGSAKG---------------PVLSRRG-----
PSD_RHIME       LPAGA---EPRVTVGQTATGGETVLAEFGSAKG---------------PVISRRA-----
PSD_RHILO       LPLTA---TPRVAVGQTAVGGETVLAEFGGVAGT--------------PLVRIS------
PSD_BRUME       LPSDA---TVRVAVGQTAIAGETVLADYGTERGE--------------PVVRIA------
PSD_BRUSU       LPSDA---TVRVAVGQTAIAGETVLADYGTERGE--------------PVVRIA------
PSD_BRADU       LPVGT---KALVSEGQTAIAGETILADLAGDD----------------PSRAYRAN----
PSD_RICCN       LPLKT---ALLVSKGQTAIGGETIIADFGRKKTT--------------EFKFERK-----
PSD_RICPR       LPLKT---ALLVSKGQTAIGGETIIADFGRKKTE--------------EFKFERK-----
PSD_MYCLE       LPPGT---EPVVQVGQRAVAGETVLADLT-------------------------------
PSD_MYCTU       LPAGA---EPIVNVGQRAVAGETVLAECR-------------------------------
PSD_NEIGO       LPVDA---QAQVAIGDKVTGVKTVLARLPLTDSQADPVSQAASVETAANPSAEQQQIEAA
PSD_NEIMA       LPVDA---QAQVAIGDKVNGVSTVLARLPLTAPQIESEPESEPALQTAPVETAANPSAEQ
PSD_NEIMB       LPVDA---QAQVAIGDKVTGVSTVLARLPLTAPQTESEPESEPALQTAPVETAANPSAEQ
PSD_NITEU       LPLGT---KVNVAIGDKVYATQTVLAEFH-------------------------------
PSD_RALSO       LPLTA---RPRVTIGEKVSATLTVLAELD-------------------------------
PSD_ZYMMO       LPAGV---TPQVALGQRCLAGETILGQIGSQAKPLTGMRL--------------------
                :*            *    .  *                                     

PSD_BACTN       --------------------
PSD_CHLTE       --------------------
PSD_STRCO       --------------------
ASD_METJA       --------------------
ASD_ARCFU       --------------------
ASD_METKA       --------------------
ASD_HALSA       --------------------
ASD_METAC       --------------------
ASD_METMA       --------------------
ASD_METTH       --------------------
PSD_AGRFC       --------------------
PSD_RHIME       --------------------
PSD_RHILO       --------------------
PSD_BRUME       --------------------
PSD_BRUSU       --------------------
PSD_BRADU       --------------------
PSD_RICCN       --------------------
PSD_RICPR       --------------------
PSD_MYCLE       --------------------
PSD_MYCTU       --------------------
PSD_NEIGO       AAKIQAAVQDVLKD------
PSD_NEIMA       RQIEAVAAKIQAAVQDVLKD
PSD_NEIMB       RQIEAAAAKIQAAVQDVLKD
PSD_NITEU       --------------------
PSD_RALSO       --------------------
PSD_ZYMMO       --------------------