CLUSTAL format seed alignment for MF_00665

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SSPO_BACVZ      MVKRKANHVINGMNDAKSQGKGAG----YIEN-DQLVLTEEERQNNKKRKTNQ
SSPO_BACSU      MVKRKANHVINGMNDAKSQGKGAG----YIEN-DQLVLTEAERQNNKKRKTNQ
SSPO_BACLD      MAKRKANHVINGMNNAKRQGNGAG----YIEN-DQHILTEAERQNNKKRKTNQ
SSPO_BACP2      MTKRKANHVINGMNAAKSQGNGAG----YIED-DQLVLTAEQRQNNKKRKKNQ
SSPO_BACAN      MGKRKANHTISGMNAASAQGQGAG----YNEEFANENLTPAERQNNKKRKKNQ
SSPO_BACC1      MGKRKANHTISGMNAASAQGQGAG----YNEEFANENLTPAERQNNKKRKKNQ
SSPO_BACCR      MGKRKANHTISGMNAASAQGQGTG----YNEEFANEPFTPAERQNNKKRKKNQ
SSPO_BACCN      MGKRKANHIVPGMNAASAQGQGTG----YNEEFANEPLTAAQRQNNKKRKKNQ
SSPO_GEOKA      MAKRKANHVIPGMNAAKAQGMGAG----YNEEFSNEPLTEAQRQNNKKRKKNQ
SSPO_GEOTN      MAKRKANHVIPGMNAAKAQGMGAG----YNEKFSNEPLTEAQRQNNKKRKKNQ
SSPO_ALKHC      MVRKKANHSRPGMNAAKAQGKDAGLTSQFHAEIGQEPLNQAQRQNNKKRKKNQ
                * ::****   *** *. ** .:*    :  .  :  :.  :********.**