CLUSTAL format seed alignment for MF_00666

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SSPP_BACC1      MS-QTMSKNNREAKEK---KGQP--EPLSGSHKVKNRNHSRQKHHAHHDM
SSPP_BACCR      MS-HTMGKNNREAKEK---KGQP--EPLSGSHKVKNRNHSRQKHHAHHDM
SSPP_BACCN      ME-KNNSKSIRQNSKKGQPSGQP--EPLSGSHKVKNRNHSRQKHHAHHDM
SSPP_BACVZ      MTNKNTSKDMHKNAPKGHNPGQP--EPLSGSKKVKNRNHTRQKHNTSHDM
SSPP_BACSU      MTNKNTSKDMHKNAPKGHNPGQP--EPLSGSKKVKNRNHTRQKHNSSHDM
SSPP_GEOKA      MTNKNDGKDMRKNAPKGDNPGQP--EPLDGSKKVKNRNHTRQKHNTSHDM
SSPP_GEOTN      MTNKNDSKDMRKNVSKGDNPGQP--EPLDGSKKVKNRNHTRQKHNTSHDM
SSPP_BACLD      MTNKNDGKDMRKNAPKGAQPGQP--EPLSGSKKVKNRNHTRQKHNSSHDM
SSPP_BACP2      MTNKNTGKDIRQNSPKEHQSGQP--EPLSGSKKVKNRNHTRQKHNSHHDM
SSPP_BACHD      MTERHTAKDIRKNAPKGENPGQP--EPLSGSKKVKKRNHVSQTNGEG---
SSPP_OCEIH      MSKRKMGPKQQKNPELPKSPEQPYGEPLSGSKKEKKANHSGQKHNPHHGL
                *  :  . . ::         **  ***.**:* *: **  *.: