CLUSTAL format seed alignment for MF_00668

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BIOW_STAAE      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAA3      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAA8      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAAN      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAA9      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAA2      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAAC      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAAM      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAA1      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAAS      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAAW      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAAB      ---------------------------------------MYSIKMRSS--NQ------DV
BIOW_STAAR      ---------------------------------------MYSIKMRSS--NQ------DI
BIOW_STAES      ---------------------------------------MYSIKMRAS--HE------DI
BIOW_STAEQ      ---------------------------------------MYSIKMRAS--HE------DI
BIOW_BACAM      MTYSEKALIFCISVNLKFILVHINFQSKRKEGNICGKKPTYSVRMRAS--RNAPHEQGGK
BIOW_BACVZ      ----------------------------------MREETYYSVRMRAS--RNAPHEQGGK
BIOW_BACAS      ----------------------------------MEEEIYYSVRMRAS--RDAPHEQGGK
BIOW_BACLD      ----------------------------------MKGEAYYSVRMRAS--ENGPHEEGGK
BIOW_BACSU      ---------------------------------MMQEETFYSVRMRAS--MNGSHEDGGK
BIOW_BACST      ----------------------------------MQEETFYSVRMRAS--MNGSHEDGGK
BIOW_BACSH      ----------------------------------MQEETFYSVRMRAS--MNGSHEDGGK
BIOW_BACA1      ----------------------------------MREEKFYSVRMRAS--KNGSHEVGGK
BIOW_ALKPO      ---------------------------------MQHEHIYFSVRMRAA--QGGSHEQGGK
BIOW_LYSSH      -----------------------------------MLETCYSIRMRAA--EK-NLEGGEK
BIOW_CORDI      -------------------------------MLYASYMSYVSIKMHAS--SNG------A
BIOW_CORPF      -------------------------------------MTFYSVRMRAS--LQG------Q
BIOW_VEIPT      ------------------------------------MDELYSVRMRAA--QGGPHENGGH
BIOW_METRM      -----------------------------------MKLMMYSIKMRSA--KGGPHEEGGK
BIOW_PELCD      -----------------------------------MSESLYSIRMRSS--CDE------R
BIOW_DESDA      --------------------------------------MLYSIKMRAE--------SGSR
BIOW_FIBSS      -------------------------------------MDYYSLKMRASQHVGEGENSHEQ
BIOW_THEYD      ---------------------------------------MWSVRMRAS----KKENNIEK
BIOW_HYDTT      ---------------------------------------MRSVRMRAE--------LDGM
BIOW_THEAH      ---------------------------------------MRSIRMRAE--------FQGE
BIOW_AQUAE      -------------------------------------MDLFSVRMRAQ--------KNGK
BIOW_SULAA      ------------------------------------MKEYFSVKMRAS--------LQGR
BIOW_SULSY      -------------------------------------MKFYSVKMRAS--------LNDR
BIOW_PERMH      --------------------------------------MYYSIKLRAS--------RDGK
BIOW_METIM      --------------------------------------------MRAS--------REGK
BIOW_META3      --------------------------------------MAFSIKMRAS--------KGDK
BIOW_METJA      -----------------------------------MVIVMYSIKMRAS--------KNGK
BIOW_METSF      ---------------------------------------MYSIKMRAS--------KNGK
BIOW_METVM      ---------------------------------------MYSIKMRAS--------KNGK
BIOW_METM5      ---------------------------------------MFSLKMRAS--------RNGN
BIOW_METM6      ---------------------------------------MFSLKMRAS--------RNGN
BIOW_METM7      ---------------------------------------MFSLKMRAS--------RNGK
BIOW_METMP      ---------------------------------------MFSLKMRAS--------SNGN
BIOW_METVS      ---------------------------------------MFSLKMRAS--------KDGV
                                                            :::             

BIOW_STAAE      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAA3      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAA8      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAAN      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAA9      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAA2      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAAC      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAAM      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAA1      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAAS      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAAW      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAAB      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIQQIKALQIIED
BIOW_STAAR      HISGAETICE-FDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIM-EPIKQIKALQIIED
BIOW_STAES      HISGAETMCE-FEDLENYLKKYFNKAFNHENGNIDFLNLKIEKVK-APIQTLVALPVVEN
BIOW_STAEQ      HISGAETMCE-FEDLENYLKKYFNKAFNHENGNIDFLNLKIEKVK-APIQTLVALPVVEN
BIOW_BACAM      HISGGERLIT-YSGLQEAVDGLLHKGFSHSRGIPDFMQIQLESIN-EPIETIRPLPVAFH
BIOW_BACVZ      HISGGERLIT-YSGLQEAVDGLLHKGFSHSRGIPDFMQIQLESIN-EPIETIRPLPVAFH
BIOW_BACAS      HISGGERLIT-YSGLQEAVNGLLHKGFSHSRGTPDFMQIQLESIN-QPIKTIRPLPVAVH
BIOW_BACLD      HISGGERLVP-FIGLNDAVSDLLEKGMSHSRGRPDFMQIQFDLVN-EPIKLVQPLRIETN
BIOW_BACSU      HISGGERLIP-FHEMKHTVNALLEKGLSHSRGKPDFMQIQFEEVH-ESIKTIQPLPVHTN
BIOW_BACST      HISGGERLIP-FHEMKHTVNALLEKGLSHSRGKPDFMQIQFEEVY-ESIKTIQPLPVHTN
BIOW_BACSH      HISGGERLIP-FHEMKRTVNSLLEKGLSHSRGKPDFMQIQFEEVH-EPIKTIQPLPVRTN
BIOW_BACA1      HLSGGERLTT-YENMIHTVNALLEKGIYHSRGKPDFMKIQFECID-EPIQLVNPLHIETH
BIOW_ALKPO      HISGGEKIVP-YHDLSSCMAELAEKGLNHSRGKPDFMNIQFEQIE-EAVKYVSPLPVGTH
BIOW_LYSSH      HISGGERIGS-EFQIEPIVKQLLNKARNHSRGDADFIQITVEKLTGDQILYMPPLEITTI
BIOW_CORDI      HISGAETLVD-ESRAYEFLSSFYQRANTHSKGKPEITTLTIRRIKDADIITIPALEVKCL
BIOW_CORPF      HISGAETLVSCPTDVPRLTAQFVERAMNHAKGVPDAITTKIESIPESDIQRVPRLLTREY
BIOW_VEIPT      HISGAERIVT-LNQVGFIAQSLAERALHHSKGTADFINITVDLIPSETITYIDCLKVKEH
BIOW_METRM      HISGAERILR-EDEIEEELINVYRRAITHEKGKPDFINLKIEAIDEDKILYKKRLNIIQH
BIOW_PELCD      HISGAENLAP-AERLHALASAMVRRALAHDKGQAEQIFLSIEKVDTADIVCHGLPDIRTI
BIOW_DESDA      HISGAERIVE-RRDMAQAMDALTRRGMEHPNGPAEAVTVTVRPITRPLMHI-QALPVHEP
BIOW_FIBSS      HISGAERIVG-RDSVEAVCAAMVRRAMNHSKGDPDFINVKIEKVHESDIQVLKSLPVTRV
BIOW_THEYD      HISGAEGIYD-YSQIERVLKQLFKRAFEHSKGKPDKVVITVERINE-EIQTVSALPVNTF
BIOW_HYDTT      HVSGAERVIPH-YELEKVVMELLKR--PKRYD---KIVITIERVENL-ETIPKSLPIKSH
BIOW_THEAH      HVSGAERIVPY-HEVEKTVLELLKR--PRVYD---KVVITVERLKDV-EIVPKALPILSY
BIOW_AQUAE      HVSGAERIVKK-EELETAVKELLNR--PKEFD---FMNVKVEKVKDF-EVVKFNLKISTY
BIOW_SULAA      HVSGAERIVLK-EDLPTVISQLSQR--PKEYD---SLNIKVEKINDL-NYIEKSLNVKTI
BIOW_SULSY      HVSGGERITTE-ESIQKVVSELLTR--PKEFD---FVNIKIEKINNI-KFIEKSLDIKTI
BIOW_PERMH      HLSGGERIVLK-DKIEEAVNQLYRKAEPKDPD---EINIKIESIKEKPLVIKSSLKIENI
BIOW_METIM      HISGGERLVSE-EKIEEAVLELLRKALTHENGKPDFINIKIEKIDK--VNYIKALPIKTI
BIOW_META3      HISGAETIVMEKENIENITAGYIKRALEHELGAPDFINIKIDKINKKDIIYIDALPIKTI
BIOW_METJA      HISGAERIVNK-DEIEETVKELVRRALTHENGTPDFINIKIEEIKE-EITYINHLPIKTI
BIOW_METSF      HISGAERIVNK-DEIEDVARELIKRALTHENGTPDFINIKIEEIKE-DIEYIDHLPIKTI
BIOW_METVM      HISGAERIVEK-EKIEEVVKDLTKRALNHENGTPDFINIKVEKIVG-EIEYIDHLPIITI
BIOW_METM5      HVSGAERLVNE-EKIEKISSELIKRAMSHENGVPDFINLKIEKVTE-KINKLKHLEIKTV
BIOW_METM6      HVSGAERLVNE-EKIEKISSELIKRAMSHENGVPDFINLKIEKVTE-KINKLKHLEIKTV
BIOW_METM7      HVSGAERLVTE-EKIEEISSELIKRAMGHENGVPDFINLKIEKVTE-KINNLKHLEIKTV
BIOW_METMP      HVSGAERLVKE-EQIEEISSELIKRAMNHENGVPDFINLKVEKVTE-NINYIEHLKIKTI
BIOW_METVS      HVSGAERISTE-NKIEEIANSLIKRALFHENGTPDTINLKLEKITS-EITYLKHIPIKTL
                *:**.* :                :   :  .        .  :                

BIOW_STAAE      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAA3      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAA8      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAAN      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAA9      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAA2      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAAC      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAAM      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAA1      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAAS      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAAW      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAAB      D-------KANLQHLTQECGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAAR      D-------KANLQHLTQKCGVTEQA-LNQ----------GMTYIKNETVYTGAIILSAIS
BIOW_STAES      L-------NDTLTQLAKQTGVSEYA-LNK----------GLEFIKNDITYTGAIILSAQT
BIOW_STAEQ      L-------NDTLTQLAKQTGVSEYA-LNK----------GLEFIKNDITYTGAIILSAQT
BIOW_BACAM      QSDTPEKGQAIARKLLQKAGIPPHM-IEK----------AYENIAEYAEARGAVLFDIRA
BIOW_BACVZ      QSDTPEKGQAIARKLLQKAGIPPHM-IEK----------AYENIAEYAEARGAVLFDIRA
BIOW_BACAS      QTDTAEKGQAVARKLLQKAGIPPHM-IEK----------AYQNIAEYAEVRGAVLFDIQT
BIOW_BACLD      ETVSAEEGQALARELISRAGVPESA-VEK----------AFQGIAEYWGVRGAVLFDIHS
BIOW_BACSU      EVSCPEEGQKLARLLLEKEGVSRDV-IEK----------AYEQIPEWSDVRGAVLFDIHT
BIOW_BACST      EVSCPEEGQKLARLLLEKEGVSRDV-IEK----------AYEQIPEWSDVRGAVLFDIHT
BIOW_BACSH      EVSSPEEGQKLARLLLEREGVSREV-IEK----------AYQQIISWSGVRGAVLFDIHS
BIOW_BACA1      EVESAEKGQVLARKLLEKAGIQKKM-IDL----------AYEQIPECSGLRGAILFDIHS
BIOW_ALKPO      VVSSVADGQATARSLLTEAGIKPQV-IEE----------AYYVLSELTELRGALFIDAAT
BIOW_LYSSH      DESSIERAHKEARSILTSVGVSKQA-QNV----------AFHLLASNQNLRGAILLHSQT
BIOW_CORDI      PALHPSEAHRQVIEQL--SNVVSPT-IAQ-----MALHTVLNAR----NMRGAILLCAHT
BIOW_CORPF      QARDCHDAHGFVQQQL--TTVCSAE-VAQ-----KAVDLLLTIR----NMRGAILLDAHS
BIOW_VEIPT      TANTVTEAHQLAVKLLQGTDISESA-IRN-----SIFLLKSLVS----SMRGAMLVDAIS
BIOW_METRM      KVSSKEEGLKLAKELLIKNTVSEEA-AKE-----GISSIQKLKE----SIHGAMLLDKDS
BIOW_PELCD      RVASVEQGRDAALSMLEKAGVNPQA-ARR-----AMATMARGAAPNGDSMRGAMLVDAST
BIOW_DESDA      HVRDQHEARQV---LTEELRGMALD-PSP---------VLDLLYSLRKPMRGAVLLDVTG
BIOW_FIBSS      DVETWQEGLEKAFGLITPLMALRQA-QGPCDGAKKFKEKLQDLLRETFPMRGAMLYDIAT
BIOW_THEYD      FTNSPEEAFCLISEKLSSIGISDKA-LFS-----------AFEVIKKYPMRGATLIDSIT
BIOW_HYDTT      DFADVEQAHEFVIKKLK-EIGIE-----ESITQKALKLLTEGPNPKGGNMRGAVLMDPVS
BIOW_THEAH      DFKSVEEARAFAVSKLV-EAGVP-----KPVAELAIKLLHEGPNPKGGNMRGAVLMDVET
BIOW_AQUAE      SFKSPEEAREFAVKKLT-QEGIK-----EEVAKKAVEILSKGANPKGGNMRGAVLMDIET
BIOW_SULAA      NVKDWIEGNKVAVEILQ-NQGVD-----KKIAEKYINLIHQGAVNG-ENMRGAMIVNLS-
BIOW_SULSY      NVKNHKEGNEIALKLLE-EVGID-----REIAKAYIDLLHTGANPDRENMRGAMIITRS-
BIOW_PERMH      ICEDYKSSNQIALEILKRSTGIP-----VERLKELIDLVHTGSAPDGSNMRGAMIVNQK-
BIOW_METIM      TCKNKKEAREVAKKILLEE------------GIPEEVVEKAFKIIDKGGMRGAAILNLN-
BIOW_META3      NCKNKEDARRVAKNLLKNE------------GISDKLIEKSFKIIDDGGMRGAPILNLN-
BIOW_METJA      HCKDKEEARETAKKILRNE------------GIPDSVIDYAYEIIDKGGMRGAAILNLK-
BIOW_METSF      HCKNKEEAREKAREILRNE------------GIPDKVIDYAYEIIDKGGMRGAAILNLK-
BIOW_METVM      PCKNIKEARKKAIEILINE------------GIPKEIILQAFEIIDRGGMRGAALLNLK-
BIOW_METM5      HSTSKENSRNIARNLLKNELEKYYLKNGKDIEKIDELIDFAFKIIDAGNMRGAAILDLD-
BIOW_METM6      HSTSKENSRNIARNLLKNELEKYYLKNGKDIEKIDELIDFAFKIIDAGNMRGAAILDLD-
BIOW_METM7      HSTSKETSRVIARNLLKNELEKYYLKNGKDIEKIDELIDFAFKIIDEGNMRGAAILDLD-
BIOW_METMP      NSNSKETSREFAINILKKELENYFLKNGKDTKKIDELIDSAFKIIDAGNMRGAAILDLD-
BIOW_METVS      ISNNKETSRNISRNILRKELEVYFLKNGKDFGKIDILIDTAFEIIDKGNMRGAAVLDLD-
                                                                   ** .     

BIOW_STAAE      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAA3      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAA8      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAAN      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAA9      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAA2      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAAC      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAAM      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAA1      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAAS      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAAW      GKRLDS-FGQRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAAB      GKRLDS-FGQRGIRATHFSFEDMN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAAR      GKRLDS-FGHRGIRATHFSFEDIN----------NKGDLNERVTDALAIASCINAHPYVK
BIOW_STAES      GQRLDS-TEQRGIRVTQLAFKTCK----------CNGEISERVKDARALATCINAFEGVK
BIOW_STAEQ      GQRLDS-TEQRGIRVTQLAFKTCK----------CNGEISERVKDARALATCINAFEGVK
BIOW_BACAM      GERIDG-RGNRGVRVSRMDWPSHDF--QKWAFT-HNMPENSRIKEAHAIAAKVCAHPGII
BIOW_BACVZ      GERIDG-RGNRGVRVSRMDWPSHDF--QKWAFT-HNMPENSRIKEAHAIAAKVCAHPGII
BIOW_BACAS      GKRIDG-RKERGVRVSRMDWPAHDF--QKWTLE-HKMPENPRIKEAHAIAAKVCAHPGII
BIOW_BACLD      GRRIDG-RKEKGVRVSRLDWPEADF--QRWAAL-CGVPPNPRLKEALAIASKVCEHPAVI
BIOW_BACSU      GKRMDQ-TKEKGVRVSRMDWPDANF--EKWALH-SHVPAHSRIKEALALASKVSRHPAVV
BIOW_BACST      GKRMDQ-TKEKGVRVSRMDWPDANF--EKWALH-SHVPAHSRIKEALALASKVSWHPAAV
BIOW_BACSH      GKRIDQ-TKGKGVRVSRMDWPDANF--EKWALR-YHVPAHSRIKEALALASKVSRFPAAV
BIOW_BACA1      GKRIDQ-RKERGVRVSRMDWPDTNF--DKWTKC-YQMPRNSRIKEALVLATKVSEHPATI
BIOW_ALKPO      GQRLDD-PIKNGVRVTRMDWPLDDF--SCWLNE-HQLSPNIRMKEALALATKVTQHPATI
BIOW_LYSSH      GLRLDN-RGLKGVRVSRIDWQDAD------------VGYNERVREALALATKVANSPYTI
BIOW_CORDI      GQRLDPYDPQRGVRASTFGVTPQES--AGPT------LNKSHFNEALVLASKVMSAPGIV
BIOW_CORPF      ARRLEP-DHNRGIRASNFGDASSIS--AKPDNK-EIGISKNHYHEALILSSKVMSAPGII
BIOW_VEIPT      GERLD--AGNRGVRVSHMDSFDSDK--LGDNE---------HMREALVLASKVQSAEGIV
BIOW_METRM      GKRIDD-KGIKGVRVTGIASADIKK--YKESLK-RDGREGLHLEEALILASKIASCKAIV
BIOW_PELCD      GQRLEK-DRYRGVRVSRMDLDEQTSVRLKNLLQ-TAGLDNPHVREALVLAAKVIHAPGVI
BIOW_DESDA      MKRLEP-DPQRGVRATCMD-YTGNR----------CEG-KNHFREALCLASKVAHCPQII
BIOW_FIBSS      GNRLEP-DKDRGVRATYMDALHSSE----------VDGCKNHFNEAIVLATKVANAPGMV
BIOW_THEYD      GERLER-DKTRGIRVSRIHMDKRKRMKLIRQIK-NLSTQPQRVIEAITIASKVASYPEVV
BIOW_HYDTT      GERLEP-DQERGIRTTRIDWRNRTAIKEALRERGIKKFYLERLIDALAIATKNI-HCGVI
BIOW_THEAH      GERLEP-DRERGIRTTRMDWKDRKYIKEVLKKRGIKREYLERLIDALAVATKNV-YCGVL
BIOW_AQUAE      GERLEE-DKERGVRTIHFDWKDRKKVTEKL----LKEGYTLRTVDALALTFKNL-FCGVV
BIOW_SULAA      GERVEK-DKTRGIRTVNIDFEDRKAITELLK----EKGYTERTVDALALATKTLNHPDIV
BIOW_SULSY      GKRVEK-DRYRGVRTTNVDFLHREEVKKILL----EKKYTERTLDALALSTKNLNHLDII
BIOW_PERMH      GERIEL-DHFRGIRTTTVDFLDRDKILKKLV----KKGYTERTVDALCLTTKNMLYPDMI
BIOW_METIM      GERLEP-DRERGVRVKNIDTSERLKEKILKE-----GLGTERTVDAIAIASKVI-RLGII
BIOW_META3      GERLEP-DKERGVRVKNISTTEELKEKILKN-----NIGTDRTVDAIAIASKVI-NLGVI
BIOW_METJA      GERLEP-DKERGVRVKNIDTTKELKEKILKE-----NLGTERTVDAIAIASKVI-HLGVI
BIOW_METSF      GERLEP-DKERGVRVKNIDTTKELKEKILKE-----KLGTERTVDAIAIASKVI-HLGVI
BIOW_METVM      GERLDP-DKERGVRVKNIDVSESLKNEILTK-----NLGTERTVDAIAIASKVI-HLGVL
BIOW_METM5      GNRLEN-ILERGIRVKNIDTTEELSEKILKD-----SSLTERTVDAIAIATKVV-NCGVI
BIOW_METM6      GNRLEN-ILERGIRVKNIDTTEELSEKILKD-----SSLTKRTVDAIAIATKVV-NCGVI
BIOW_METM7      GNRLET-DSNRGIRVKNIDTTDELSEKILGN-----SSLSERTVDAIAIATKVV-NCGVI
BIOW_METMP      GNRLEK-SSDRGIRVRNIDTAEELSKKILKD-----GSLTERTVDAIAIATKVV-NCDII
BIOW_METVS      GNRLEE-DTEKGVRVKNIDTSEELKSKILAD-----SKLTDRTIDAIAIATKVL-NFGFI
                  *::     .*:*.  .                       :  :*  ::          

BIOW_STAAE      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAA3      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAA8      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAAN      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAA9      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAA2      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAAC      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAAM      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAA1      GELCVSDDLTYTTGYFAAAKIGYHRLFDIKPVNTRYGGRIIFVDDCI-----DLNHYISF
BIOW_STAAS      GELCVSDDLTYTTGYFASAKIGYHRLFDIKPVNTRYGGRIIFVDDRI-----DLNHYISF
BIOW_STAAW      GELCVSDDLTYTTGYFASAKIGYHRLFDIKPVNTRYGGRIIFVDDRI-----DLNHYISF
BIOW_STAAB      GELCVSDDLTYTTGYFASAKIGYHRLFDIKPVNTRYGGRIIFVDDRI-----DLNHYISF
BIOW_STAAR      GELCVSDDLTYTTGYFASAKIGYHRLFDIKPVNTRYGGRIIFVDDRI-----DLNHYILF
BIOW_STAES      AELCVSDDLHYTTGYFASPKLGYRRIFNIKEKGTRHGGRIIFVDEGI-----HLNEYVSF
BIOW_STAEQ      AELCVSDDLHYTTGYFASPKLGYRRIFNIKEKGTRHGGRIIFVDEGI-----NLNAYVSF
BIOW_BACAM      AELCWSDDPDYITGYVAAKKLGYQRIAKMKNAGDESGCRIFFTDGSI-----DTESCIHF
BIOW_BACVZ      AELCWSDDPDYITGYVAAKKLGYQRIAKMKNAGDESGCRIFFTDGSI-----DTESCIHF
BIOW_BACAS      AELCWSDDPDYITGYVAAKKLGYQRITKMKNAGDESGCRIFFTDGAI-----DTESCIHF
BIOW_BACLD      AELCWSDDPDYITGYVAAKKLGYQRMTKMKEHGDESGCRIFFVDGSA-----DVKSCIDD
BIOW_BACSU      AELCWSDDPDYITGYVAGKKMGYQRITAMKEYGTEEGCRVFFIDGSN-----DVNTYIHD
BIOW_BACST      AELCWSDDPDYITGYVAGKKMGYQRITAMKEYGTEEGCRVFFIDGSN-----DVNTYIHD
BIOW_BACSH      AELCWSDDPDYITGYVAGKKMGYQRITALKEYGSEDGCRIFFIDGSE-----DVNTYIHD
BIOW_BACA1      AELCWSDDPDYITGYVASKKLGYQRITKLKEYGNESGCRIFFVDGLR-----DLETYIDY
BIOW_ALKPO      AELCWSDDPDYITGYVASQKFGYQRISQLKELGEEKGCRIFFVDQTKM---KNLDAYINY
BIOW_LYSSH      AELCWSDDPEYVTGYVSNHEIGYVRITPLKREGCESGGRIFFVSDEV-----ELESYIHY
BIOW_CORDI      AEICISDDPAYTTGYVTTENT-YIRIPHMKDPYSPIGGRVFLLDT----RVSTPEDTISY
BIOW_CORPF      AEICISDDPDYTTGYVSLNGV-YTRVHTMKRLGSPLGGRVFILDS----EKASVATAINH
BIOW_VEIPT      GELCWSDDPDYTIGYVACNGV-YHRIPNMKEIGSNLGGRVFFVKP-----NIDLEGVIEY
BIOW_METRM      AELCWSDDPSYVIGYVGTKEN-YHRIPILKDKGNPVGGRVFFVDTSQLNDNYTLEDLIDY
BIOW_PELCD      AELCWSDDPGYTAGYVAGASLGYVRFPLLKPAGEVRGGRAFFLSS-----DADLAQLIPY
BIOW_DESDA      GELCISDDPDYTTGYFASQVRGYVRIHHIKQAGQQLGGRIFLFRG----QQAEIGQCVDY
BIOW_FIBSS      AEFCVSDDPNYVTGYVASKELGYVRIMKMKEMGDENGGRIFLFDS----RKASAEECIEY
BIOW_THEYD      AELCISDNPDYTIGYIASRDLGYLRITNIKNKGETIGGRAFFVKT-----PCDIEKLTNY
BIOW_HYDTT      AEICWSDDPEYTTGYIASKEFGYIRIKPMKEEHTPTGGRVYFVKRE------SLQELIEC
BIOW_THEAH      AELCWSDDPEYTTGYVAGPHIGYVRIKPMKEEGVPIGGRVYFIRKE------NLEKIIQC
BIOW_AQUAE      AELCWSDDPDYVTGYVSGKEIGYVRITPLKEKGDPLGGRVYFVSRK------ELSEIIEC
BIOW_SULAA      AEYCISDDPSYTTGYVATKTT-YYRINPLKQLSNEKGGRIYFVKDTA-----NIEDIYQY
BIOW_SULSY      AEYCISDQPDYTTGYVAVNNT-YYRINPLKEYSNPKGGRIYFVKDDT-----DIEELYKY
BIOW_PERMH      AEYCISDEPDYITGYVSTKDF-YYRITPLKSEGNPKGGRIYFVRNSI-----DLQDFYRF
BIOW_METIM      AELCTSDNKSYTTGYVATKKG-YFRITNLKNINEP-GGRVFFVKDID-------EELIKR
BIOW_META3      AELCTSDNNSYTTGYVATKNG-YFRITNLKQENEN-GGRVFFVKNDT-----NIEDLIYK
BIOW_METJA      AELCTSDNKSYTTGYVATKKG-YFRITNLKKEGES-GGRVFFVKDDV-----DIEDLINK
BIOW_METSF      AELCTSDNKSYTTGYVATKRG-YFRITNLKKEGES-GGRVFFVKNDV-----NIEDLIDK
BIOW_METVM      AELCTSDNKNYTTGYVATKKG-YFRITNLKREGDP-GGRVFFIKDDR-----NIKKLIEK
BIOW_METM5      SELCTSDNFSYTTGYVATKDG-YFRILNLKDKGQV-GGRVFFVENS------KIDELYDK
BIOW_METM6      SELCTSDNFSYTTGYVATNDG-YFRILNLKDKGQV-GGRVFFVENS------KIDELYDK
BIOW_METM7      SELCTSDNFSYTTGYIATKDG-YFRILNLKGNGEV-GGRVFFVENS------KIDELYDK
BIOW_METMP      AELCTSDNFSYTTGYVATKDG-YFRILNLKDSGQV-GGRVFFAESS------DIDELYDK
BIOW_METVS      AEICTSDNYSYNIGYVATKSG-YFRIPNLKNEGEF-GGRVFFIENSA-----NIEEIFEK
                .* * **:  *  **.      * *.  :*      * *  :                  

BIOW_STAAE      LESTPKQVVYETV---------------
BIOW_STAA3      LESTPKQVVYETV---------------
BIOW_STAA8      LESTPKQVVYETV---------------
BIOW_STAAN      LESTPKQVVYETV---------------
BIOW_STAA9      LESTPKQVVYETV---------------
BIOW_STAA2      LESTPKQVVYETV---------------
BIOW_STAAC      LESTPKQVVYETV---------------
BIOW_STAAM      LESTPKQVVYETV---------------
BIOW_STAA1      LESTPKQVVYETV---------------
BIOW_STAAS      LESTPKQVVYERV---------------
BIOW_STAAW      LESTPKQVVYERV---------------
BIOW_STAAB      LESTPKQVVYETV---------------
BIOW_STAAR      LESTPKQVVYETV---------------
BIOW_STAES      LETVPKEIIEK-----------------
BIOW_STAEQ      LETVPKEIIEK-----------------
BIOW_BACAM      LEKQPVFIQREENI--------------
BIOW_BACVZ      LEKQPVFIQREENI--------------
BIOW_BACAS      LEKQPVFIQREGKI--------------
BIOW_BACLD      LEKQPVFIGQEVNHESIIR---------
BIOW_BACSU      LEKQPILIEWEEDHDS------------
BIOW_BACST      LEKQPILIEWEEDHDS------------
BIOW_BACSH      LEKQPILIEWEEDHDS------------
BIOW_BACA1      LEKQPVFIQWEEENDA------------
BIOW_ALKPO      LTTQPVLIRWKQEVMADESRSMAGRAAE
BIOW_LYSSH      LEREPILIRGHLK---------------
BIOW_CORDI      LEQKPVLITGVN----------------
BIOW_CORPF      IENTPVLIL-------------------
BIOW_VEIPT      LEKEPVLVQW------------------
BIOW_METRM      LEKQIVLIE-------------------
BIOW_PELCD      LERQVVLIDRIGRIFPDERWPA------
BIOW_DESDA      LENQPVMVVMESL---------------
BIOW_FIBSS      LQKKKVLVDVVGRT--------------
BIOW_THEYD      LERKPVLVI-------------------
BIOW_HYDTT      LERKVMLIEQLL----------------
BIOW_THEAH      LQEKPILINNL-----------------
BIOW_AQUAE      LTQKVVLIEL------------------
BIOW_SULAA      LESEAFLIKQLGDLQ-------------
BIOW_SULSY      LQEESFLIKEVGSLE-------------
BIOW_PERMH      LQEKPVLIEDVGID--------------
BIOW_METIM      LEEEAYIIDL------------------
BIOW_META3      LENKPYIIK-------------------
BIOW_METJA      LENKPFIIK-------------------
BIOW_METSF      LENKPFIIK-------------------
BIOW_METVM      LENKPCIIR-------------------
BIOW_METM5      LENMPVTVY-------------------
BIOW_METM6      LENMPVIVY-------------------
BIOW_METM7      LENMPVIVY-------------------
BIOW_METMP      LENMPVIVY-------------------
BIOW_METVS      IEKTPVIVY-------------------
                :      :