CLUSTAL format seed alignment for MF_00670

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UXAB_ECOLI      MKTLNRRDFPG--------AQYPERIIQFGEGNFLRAFVDWQIDLLNEHTDLNSGVVVVR
UXAB_SHIFL      MKTLNRRDFPG--------AQYPERIIQFGEGNFLRAFVDWQIDLLNEHTDLNSGVVVVR
UXAB_YERPE      MQTLNRRDFPG--------RSHPDKIIQFGEGNFLRAFVDWQIDLLNEHTDLNAGIVVIR
UXAB_BACTN      MKALNKETAPK--------VQRPERIIQFGEGNFLRAFVDWIIYNMNQKTDFNSSVVVVQ
UXAB_CLOAB      MKLNRSNFSEF--------KKYPEKILQFGEGNFLRAFVDWQVDRMNKAADFNAGVVIVQ
UXAB_BACSU      MQKLNKNVYDHY-------TQYPEKILQFGEGNFLRGFIDWQIDQLNQHTDFNGSVAVVQ
UXAB_BACHD      MEKLSHGLVTSRNMIRYKSSQLPERVLQFGEGNFLRGFIDWMIQQMNKQNVFNGRVVAIQ
                *:                  . *::::*********.*:** :  :*:   :*. :. ::

UXAB_ECOLI      PIETS-FPPSLSTQDGLYTTIIRGLNEKGEAVSDARLIRSVNREISVYSEYDEFLKLAHN
UXAB_SHIFL      PIETS-FPPSLSTQDGLYTTIIRGLNEKGEAVSDARLIRSVNREISVYSEYDEFLKLAHN
UXAB_YERPE      PIDTD-FPPSLSTQDGLYTAVIRGLNEQGEAVRESRLIRSVNREINIYRQFDDYLALARD
UXAB_BACTN      PIDKG-MVDMLNAQDDLYHVNLQGLDK-GEVVNSLTMIDVISRALNPYTQNDEFMKLAEQ
UXAB_CLOAB      PLEQG-LVDMLNEQDGLYTLYLQGLKE-GKAVKEHSVIDCVTRGLNPYTQYEEYLKLAEN
UXAB_BACSU      PRGSE-KIKRLNEQDGLYTLFLQGMKD-GEAVNEHMIINSISRGIDLFSDYEAYKELASS
UXAB_BACHD      PTPHGKVVPKLQEQDSLYTVWLRGIAD-GETVDHHEVITSISRGLNPYTNWQDVLEVAAS
                *         *. **.**   ::*: . *:.*    :*  :.* :. : : :    :* .

UXAB_ECOLI      PEMRFVFSNTTEAGISYHAGDKFDDAPAVSYPAKLTRLLFERFSHFNGALDKGWIIIPCE
UXAB_SHIFL      PEMRFVFSNTTEAGISYHAGDKFDDAPAVSYPAKLTRLLFERFSHFNGALDKGWIIIPCE
UXAB_YERPE      ANIRFMFSNTTEAGIAWNEADQFSDAPPSSFPAKLTRLLFERFEHFDGAADKGWVLLPCE
UXAB_BACTN      PEMRFVISNTTEAGIAFDPTCKLEDAPASSYPGKLTQLLYHRFKTFNGDKTKGLIIFPCE
UXAB_CLOAB      PEMEIVISNTTEAGIAFDENDKLGRTCQNSYPGKLTAFLYRRFKTFNGDKSKGMLIIPCE
UXAB_BACSU      ERLRFIISNTTEAGIVCDEKDRLEDRPQKTFPGKLTAFLYFRYQAFKGDQTKGCVLIPCE
UXAB_BACHD      PDISVVFSNTTEAGLTYLEEGYDKEKAPLSFPGKLAACLWHRYETLGWGEGSGLVIIPCE
                  : .::*******:              ::*.**:  *: *:. :     .* :::***

UXAB_ECOLI      LIDYNGDALRELVLRYAQEWALPEAFIQWLDQANSFCSTLVDRIVTGYPRDEVAKLEEEL
UXAB_SHIFL      LIDYNGDALRELVLRYAQEWALPEAFIQWLDQANSFCSTLVDRIVTGYPRDEVAKLEEEL
UXAB_YERPE      LIDYNGEALRELVLRYASHWQLPAAFTHWLTENNTFCSTLVDRIVTGYPRDEVAALQTEL
UXAB_BACTN      LIFLNGHKLKETIYQYIDLWNLGNEFKTWFEEACGVYATLVDRIVPGFPRKDIAAIKEKI
UXAB_CLOAB      LIDRNGEKLKATILKFAELWNLEKEFADWIEEANTFCCTLVDRIVPGYPRDTIEEVHAEL
UXAB_BACSU      LIENNGEKLRETVLHYAHLWKLEEGFTQWIHEANTFCNSLVDRIVPGFPVDSIDEITADL
UXAB_BACHD      LVEQNGKVLKELVCRYAKAWNFPQEFFTWLERENEFCHTLVDRIVPGFPSDTADECFERL
                *:  **. *:  : ::   * :   *  *: .   .  :******.*:* .        :

UXAB_ECOLI      GYHDGFLDTAEHFYLFVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERKVAILNGAHTA
UXAB_SHIFL      GYHDDFLDTAEHFYLFVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERKVAILNGAHTA
UXAB_YERPE      GYQDSFLDTAEYFYLFVIQGPQGLAQELRLDQLDLNVRIVDDIKPYKERKVAILNGAHTA
UXAB_BACTN      QYDDNLVVQAEIFHLWVIEAPQEVAKEFPADKAGLNVLFVPSEAPYHERKVTLLNGPHTV
UXAB_CLOAB      GYEDSLVDVGEQFHLWVIEGPEWIKDILPFEKAGVNIQVVKDVTPYRTRKVRILNGAHTA
UXAB_BACSU      GYQDDLIVVGEQYYLWVIEGPDWIGKELPFAAAGLHTKIVSDLTPYRTKKVRILNGAHTA
UXAB_BACHD      GYEDILLTVAEPYHLFIIEGSERVRKLLPFNEAGLHVRW-NHLEKHRNMKVRVLNGTHTF
                 *.* ::  .* ::*::*:... :   :      ::         ::  ** :***.** 

UXAB_ECOLI      LVPVAFQAGLDTVGEAMNDAEICAFVEKAIYEEIIPVLDLPRDELESFASAVTGRFRNPY
UXAB_SHIFL      LVPVAFQAGLDTVGEAMNDAEICAFVEKAIYEEIIPVLDLPRDELESFASAVTGRFRNPY
UXAB_YERPE      LVPVAYLSGLDTVGQTMDDAQISRFVEKTITEEIVPVLDLPEDELLSFSQAVLSRFRNPF
UXAB_BACTN      LSPVAYLSGVNIVRDACQHEVIGKYIHKVMFDELMETLNLPKEELKKFAEDVLERFNNPF
UXAB_CLOAB      LVPVAYLYGLDTVGHSVEDKVIGKYLTELVYDEIIPTLDLPEEELKYFAGAVLERFLNPF
UXAB_BACSU      MTPVALLYGLKTVRDAVEHPEVGRFIRELIDDEILPVLKM--EGLSQYADDVLNRFKNPY
UXAB_BACHD      MFALSYLSGVDTVGEAMADEQLCSFIRKGLFEEIIPCVDAPEQEVTAFAETVLERFENPF
                : .::   *:. * .:  .  :  :: : : :*::  :.   : :  ::  *  ** **:

UXAB_ECOLI      IKHQLLSIALNGMTKFRTRILPQLLAGQKANGTLPARLTFALAALIAFYRG---------
UXAB_SHIFL      IKHQLLSIALNGMTKFRTRILPQLLAGQKANGTLPARLTFALAALIAFYRG---------
UXAB_YERPE      IQHQLLSIALNGMTKFRTRILPQLLTYQQQKGQLPPRLTFALAALIAFYRG---------
UXAB_BACTN      VDHAVTSIMLNSFPKYETRDLPGLKTYLERKGELPKGLVLGLAAIITYYKGGV-------
UXAB_CLOAB      VNHYLMSIALNSMPKFETRDLPSLLEYKKRKGQLPKKLVFSLAALIEFYKG---------
UXAB_BACSU      IKHYLESIALNAISKFKTRNLPTLKEYAEQKGQLPERLVFSFSALLYFYHD---------
UXAB_BACHD      LQHRLTDIGLNAVNKFRTRLMPTFNDYVAQTGEAPTYLLFSLAALINYYRGVEEDGPFLI
                :.* : .* **.. *:.** :* :      .*  *  * :.::*:: :*:.         

UXAB_ECOLI      -ERNGETYPVQDDAHWLERYQQLWSQHRDRVIGTQELVAIVLAEKDHWEQDLTQVPGLVE
UXAB_SHIFL      -ERNGETYPVQDDAHWLERYQQLWSQHRDRVIGTQELVAIVLAEKDHWEQDLTQVPGLVE
UXAB_YERPE      -EREGQTYPLQDDAHWLERYSTLWNGVKHGDIALAELVNRVLSDANHWGQDLTAVPQLAN
UXAB_BACTN      -RADGAEIVPNDAPEIMNLLKELWAT-----GCTKKVTEGVLAAEFIWGEDLNKIPGLAA
UXAB_CLOAB      -KRGDEDIKLADGEDILELYKDLWSKFDGTDACYRNIVETVLGYEKNWKMNLNELEGLTD
UXAB_BACSU      ------NETLQDDPAVLQFFKEVWCQ---EDGDMLRIASRVLGEQRLWGADLNEIPKLTD
UXAB_BACHD      GRRREDSYLIRDDLEVIEAFKVGWQQVNTGKLSLAQLCEDLLSKRELWGVDLSMERKVVD
                           *    ::  .  *           .:   :*.    *  :*.    :. 

UXAB_ECOLI      QVANDLDAILEKGMREAVRPLC------------
UXAB_SHIFL      QVANDLDAILEKGMREAVRPLC------------
UXAB_YERPE      QVTEQLQTILSRGMRAAVAAYS------------
UXAB_BACTN      AVKADLDSIQEKGMLETVKGIL------------
UXAB_CLOAB      AVTENLIKIDKLGMKEAVKSVM------------
UXAB_BACSU      RVAVYLNHIHELGMQRALEQYCIQGGEVR-----
UXAB_BACHD      KVAESLQIIVEKGMRQAISGVLNQIGGNNHVHKQ
                 *   *  * . **  ::