CLUSTAL format seed alignment for MF_00671

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TOLB_SHEPA      ----MKN----------LGKWLLTSLLICSMPVKAALDIIITEGVDAA--RPIAVIPFVW
TOLB_IDILO      ----MKNI---------LIRSILLFVALTAFVRAGVLEIVITEGIDTA--RPIAVVPFQW
TOLB_VIBPA      ----MIKR---------LLLGMFVLLGSLTNVAHAALELVITDGIDSA--RPIAVVPFKW
TOLB_ECOLI      ----MKQALRV-----AFGFLILWAS-----VLHAEVRIVIDSGVDSG--RPIGVVPFQW
TOLB_EDWI9      ----MKQAFRL-----MVGLLVLWAS-----VLHAEVRIVITQGVDSA--RPIGVVPFKW
TOLB_HISS2      ----MKFSAYL-----TTLFIVLFSLFIQTVQAESEVRIVIDEGVDSA--RPIAIIPFKW
TOLB_HAEIE      ----MKLLKRL-----VSVFAIVLAV-GSNAFAGDEVRIVIDEGVDGA--RPIAVVPFVG
TOLB_BLOPB      MYLIIKKTHKLPHWLQKVSLSIMLIIFLWKPALLADMHIEITCGVNAA--HPIAVIPFTC
TOLB_COXBU      ----MQKRH--------PIIYLLITLLIFVPVSYGALDLELTKGVTAA--IPIAIMPFAG
TOLB_XANOR      ----MKKPLRW------LAALTVLLLPLSALAQQQGLTIDIVGGSASA--TPIAVIPMPY
TOLB_POLSJ      ----MSITPSLS------RRTVMSLLAAGLSPAFAQFRVEVSGVGLTQ--LPIAIASFRG
TOLB_BURVG      ----MSLMTKLGF-----RALVASCLIAAGGAANAQVNVLITGVGSTQ--FPIATANFAN
TOLB_METFK      ----MNKLRLFRS-----FFAFLLPFGMATGAAHGALTVEIVGGAAQQ--IPIAVVPFAQ
TOLB_VESOH      -----------------MKQFIVFILSLYTTLSWAVLEVTIFKQEENT--FPIVISDFFV
TOLB_BRUA2      --MKIGIINTKIRTVFSAFACMIAASLVCTMPARAVVEININKGVIEP--LPIAITDFLS
TOLB_JANSC      ------MLNRRNFIRTTSALAASTALPGYAFGQSGPLRLEITEGVIEP--LPFALPTFLA
TOLB_SPHWW      --MRFRLALSLLSLALFAAPAAAQLE------------VDITGGIAQP--MPIAIPGMPT
TOLB_SPHAL      --MSLRPISLMLALLLTSAPALAQSAPTPPATVQTEPRETIEGTLSQER-TVIGIPSFAT
TOLB_GLUOX      -MSFIPNTEAEALSALFSRRSVLGATAAGGLLATPLAAFAQSGAASGPGEAEITVDQARQ
TOLB_RICPR      --------MRNIVYFILTLFSL---------TSYALETINIEHGRVDP--TPIAVNKFNA
TOLB_ORITB      MINNLSVSMTKVLKIILTIIIILFNTLSILANTTTLSSIKITKGNCTQ--IPIAINFFSA
TOLB_WOLWR      --------------MKLFVHLVLFISLFIPYFTKAALYVDIKKSSVGNIGLVVSKCTCKT
TOLB_WOLPM      --------------MKLFVHLVLFISLFIPYFTKAALYVDIKKSSVGNIGLVVSKCTCKT
TOLB_WOLPP      --------------MKLFVQLVLFISLFIPYSTKAVLYVDIKKSNIGNIDLVVSKCACKT
TOLB_GEOMG      -------MTRRLFILITIMLCLIPALLHSQEG-----YREVTAAGTHKLTLTVDSPRRLG
TOLB_PELCD      --------MRRFVTLLIALLCLSATAVQAQV--------EIRAPGQQTIAVANTQLVPLS
TOLB_DESOH      ------MVKRSLLVLALL--ICLPATLFAQYD-----YVRISNPFLHKIPIAVPLFQALT
TOLB_SYNAS      ----MCGVRRGMGVLLLFCAVALCAMPFVVRSVWGKVYIDIDSPAFQKIPIAVADFAPLN
TOLB_ANASK      --------MIVRRALALAALALAASPALAAQE-----RPTIVVGSPDFRPLPIAVAAFQG
TOLB_MYXXD      -----------MKALLLSLLLLLPVVALAQA-------PTIEISGANFRPLPVAVPAPLT
TOLB_WOLSU      -----------------MRILVFLWLGLS-SLFAVDATLEVVKKFANMPSIIVEDSSTRE
TOLB_HELHP      -----------------MRFIGLVLLLLSVKLFGIDATLEIVKNTNKIPYIVVERLDSEN
TOLB_HELPY      -----------------MRYL-WLFLIHTIGLFATDKTLDIIKTIQKLPKIEVRYSIDND
TOLB_CAMJE      -----------------MKKIVAIFLVFLGSLWAEDPVIDVVNSGVVLPKIIVKD-NSNL
TOLB_BDEBA      ----------MMKQILALALIIGLFPLFSHAQNNNGIYIKLGEARTKKSLMAFPPLQYTG
TOLB_DESPS      MITMKNILKLRATGLLLLLLLMISVLGNGIGQAMAADRVYLDITAPETRKIKVAVPWFTN
TOLB_FRATT      -----------MRNGMRKIIAGVFIFVFLISNLYADLVAEVTTGVIQKPLVTVVSDNVVD
TOLB_DESVH      --------MRHRSCFSLFAGLALVFCLAVGTAAAGPVQVDIYGPGQGSLNLAMAAPLGPT
                                                                            

TOLB_SHEPA      QGT--------GPMPSQISDVVMSDLARSGTFSPADELSLPQRG--------ISTLAQFN
TOLB_IDILO      KGE--------GKAPNELTDVIAADLMRSGKFNPIPVSAMPQR---------PAADDEID
TOLB_VIBPA      EGS--------QPLPTDISAVIASDLQRSGKFSPVPTNKMPQT---------PFNESEVN
TOLB_ECOLI      AGP--------GAAPEDIGGIVAADLRNSGKFNPLDRARLPQQ---------PGSAQEVQ
TOLB_EDWI9      MGP--------GTAPENIGGIIAADLRNSGKFNPIDASRMPQQ---------PSAAAEVS
TOLB_HISS2      NGS--------DSMPIDVADIISADLRNSGKFNPIAVSKMPQK---------PTSASEVI
TOLB_HAEIE      ------------SAPEDISKIVADDLRNSGKFNPIAVSQMPQR---------PTSAAEVN
TOLB_BLOPB      VSNQYN----KSISIEDIASIIAADLRNSSKFNTIPVEYLPHK---------PTKVSDVI
TOLB_COXBU      PSVL-------APGDETIPQVIKNDLQNSGQFRVTGSGNLDQT---------AASLEQID
TOLB_XANOR      QGSG-------TAPQTDVSAVVGADLDRSGQFRTLPAAQIVEK---------PTRGTEVQ
TOLB_POLSJ      EVQA-------PQK---IGNIVRADLERSGMFRPVDTAGIV-----------ADENTRPD
TOLB_BURVG      EAGL-------PQQ---VTSIVRADLARSGKFTNIDAGSTP-----------VPETASVD
TOLB_METFK      QGVI-------PGQQDTIANVIGADLRRSGLFRVLETRGVANQ---------PSDISQVN
TOLB_VESOH      VGDAS--------QGKVIADIMRNNFNRSGEFSVVNANYIIRS--------------KPS
TOLB_BRUA2      ----------ADQLGSNITSVIAADLERSGLFAPIDKGAFIEKI--------SNPDAAPR
TOLB_JANSC      V-------GGAEDAAADVSRVIAADLRGTGLFRQIPPDAYISQI--------TNFGAPVA
TOLB_SPHWW      PAVANTPAGDTAALGQRVADVVTNDLKNSGLFSPLPKSALQTVT--------HPQVTAPD
TOLB_SPHAL      ASVQTVAGLRTDALGRQLADVIAADLERSGLFEPIGPNGVRAIG--------RAEVQAPR
TOLB_GLUOX      EPIPIVVPNFGAGLGEQISGVITSDLNGTGLFKVMSGS--------------VPPGSTPD
TOLB_RICPR      DS------SNNDLVGRDVVKVISNDLKISGLFRPISSASFIEEQ--------TGIKYKPL
TOLB_ORITB      KS------NEEHDLSQNIVSIISNDLNISKIFAPISSDLFIETE--------QGVAHIPL
TOLB_WOLWR      AL--------ESELSENIAKVIGTNLSNCGLFNVKRGAEAES------------------
TOLB_WOLPM      AL--------ESELSENIAKVIGTNLSNCGLFNVKRSAEAES------------------
TOLB_WOLPP      EV--------ENELSESITKVIETNLSNCGLFNVKRDAKVE-------------------
TOLB_GEOMG      GS-D------APQVARETAEALQFDMVLAGPFTVTAPSAAAASA--------GIRPGEFD
TOLB_PELCD      GT-P------LPAIAAELHDVMAADLELSGLFRQLDPAAFLDDARRP-----GLTSSRVD
TOLB_DESOH      GTEP------EVKAAQSGADLLADTLEFTRYFNLINRAAFLERPDRT-----GVTLADID
TOLB_SYNAS      GNQG------HADLSSWFPGAVRKTLDLTGYFNILNRTGGPRDQSQT-----GAVQAQAA
TOLB_ANASK      EGD-------AGVAATQTAEVVRADLVLSGLFDVLDPRGFLADPSE------GFAAPSIR
TOLB_MYXXD      QNDG------AKALVAPFDSAFSFDLTASGILQVLDRKGFTADAKE------GMAAASIN
TOLB_WOLSU      VERGL---------TLRVYKMLVGDLKVSSHFNVQEGGASSF-------------DMVMD
TOLB_HELHP      ADFG-----------AKVLKMLAADLKVSGHFQVYDGSVNK--------------NSEVA
TOLB_HELPY      ANYA-----------LKLHEVLANDLKTSQHFDVSQ---NKD-------------QGAIN
TOLB_CAMJE      SDENL---------KKSFYNIIVNDLKVSSNFEVVANATETS-------------NYIFE
TOLB_BDEBA      SPSTAS---RNQGVGVEIFNTITNDLTVSSYFQFINQSAFLEDTSKTGLMPAPGLPNGFK
TOLB_DESPS      TGEGG----MKARIAKDIADTVAKALKFHGIISIIPTSEYKGR----------------Q
TOLB_FRATT      QF------------PQQVNSVIVADLNHNAKLQANDTIKYEIK--------------QKQ
TOLB_DESVH      PGTPV------SGMGVKLNGFINENLSFLPFLRLVDQRAILGGTVMQ-----GYKSPDID
                                     .   :     :                            

TOLB_SHEPA      ASAWMAQPAEAVVMGSIKPYGGDKYLVSFELIDLVKAQLQSDS----------MSTKDLV
TOLB_IDILO      YSAWAKMGVEAILVGSIEPYSVDRYMVKFEVIDVLRGQITGGNSQML-RNGELVQSNDHV
TOLB_VIBPA      FDSWTSLGVDALLTGSIKQNEQGDYVVNYQLVDVVRGQLTGGQSKALGSDGELVLSKDHV
TOLB_ECOLI      PAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGA-------------------PGTV
TOLB_EDWI9      PAAWTALGIDAVVVGQVQPGADGSYLVSYQLVDTSGN-------------------PGSV
TOLB_HISS2      SDVWSSLGIDAVVVGQVTPNEKG-YSIAYQLVDTIGASG----------------NSGEV
TOLB_HAEIE      PEAWSNIGIDAIVIGQVVPSGNG-YSITYQLIDTVGASG----------------TPGTV
TOLB_BLOPB      PTFWEKLGINIIVLGTVHINYDESYIISYHLIDTSSN-------------------PALI
TOLB_COXBU      YSYWRKQKVNALVVGAINPLGMRRYRVAFTLINVFDS--------------------NNR
TOLB_XANOR      FQTWRTLKQNYIVVGRVMDAGEGAYRVEYELFDVAKG---------------------ER
TOLB_POLSJ      LAIWRQKGADAMVTGSVSPLADGRFDVRLRLWDIVRG---------------------QD
TOLB_BURVG      LGAWKAKGANAFVAGSVNREANGQYKVNFILYDTVKQ---------------------QS
TOLB_METFK      YQDWAAIQAQALTIGNIETLPGNRLKVSFRLLDVYKQ---------------------SQ
TOLB_VESOH      FDKWKAKKIEAIVLGKLEKISKKIFNVEIELLDVYSK---------------------KT
TOLB_BRUA2      FEDWKVINAQALVTGRITKQPDGRLKAEFRLWDTFGG--------------------QQM
TOLB_JANSC      YPDWQAINAQALITGQVEARADGQLVVRFRLFDVFSQ--------------------APL
TOLB_SPHWW      YMFWTQSGAQALIQGFVQANGDGSLTVGCYLYDVLAR--------------------TEL
TOLB_SPHAL      FGEWQARGAENVVHGFVDAGSNGSLIVGCYLYDTALG--------------------SEL
TOLB_GLUOX      FSALKAQGARAAVAGQAV--GAGSVRVEMRLWDVLSG--------------------QQL
TOLB_RICPR      FAAWRQINASLLVNGEVKTLENGKLKISFILWDTFLE--------------------KQL
TOLB_ORITB      FTAWSQINANILINGEITKIDSTDFKVTFVIWDVFSA--------------------KEI
TOLB_WOLWR      ----KSWKSDTVVTVSLSEISGSALELSFRLFDTFTK--------------------REL
TOLB_WOLPM      ----KSWKSDTVVTVSLSEISGSALELSFRLFDAFTK--------------------REL
TOLB_WOLPP      -----SWKSDTVVTISLSEVSNRNLELSFRLSDSFTN--------------------REL
TOLB_GEOMG      FAPWRGAGVDLLVKSGYT-VTGNAMTMEFRLYNVTQG---------------------KE
TOLB_PELCD      FNQWALLGAEILIKGGYQ-LQGERLLVDFRLYDVVHR---------------------RL
TOLB_DESOH      CKNWRDIGAEFLITGGVT-VAGGMMEMELRLFDVFKE---------------------RM
TOLB_SYNAS      YGEWRSLGAEYLIQGGFS-SRGTQLVAEFRLIDIVQG---------------------RQ
TOLB_ANASK      FARWADVGADGLAKARVR-RGPAGLEGELHLYEVRAG---------------------RE
TOLB_MYXXD      FSRWADVGAEALVKVSLA-QDGGVLRGELRLFNVGTG---------------------RE
TOLB_WOLSU      YGAYRQ-KKVDLVAKVKAGREGSGILAELRLYDVNSGDSVF-------------------
TOLB_HELHP      YKDYAD-KKIDLLAQIKVSKSSNSLTGTISLYDINTSKRIY-------------------
TOLB_HELPY      YAELKD-KKVHLVALVSVAVENGNKISRLKLYDVDTGTLKK-------------------
TOLB_CAMJE      YTLNKNGNTLSLNVKIKAG-----------------GSDKS-------------------
TOLB_BDEBA      FQSWSSIGADFLIRAGYSVVGNEVTLETYTYHVPRAA----------------------L
TOLB_DESPS      TADWAKLGADYAVLGSYK-MFPKKIKLEIRLLDVAEN---------------------NI
TOLB_FRATT      NIPWKSLKSDYVVLTKYTNNSYNNYTVEVQILKRNDT--------------------SYL
TOLB_DESVH      LKRFQLAGADLVVTAGWPQGDASGSFVELRVYEALSG--------------------KLV
                                                                            

TOLB_SHEPA      IDSRETVISAAQFRQYGHRISDVVYEKLTGIRGAFLTRVAYVVVNHGEK----SPYKLMI
TOLB_IDILO      LDSRSSVIDGDQFRSYAHRISDVAYEALTGERGAFMTKIAYVTVNHDDR----YPYKLAV
TOLB_VIBPA      LFNKVATVKGPRMREYAHRISDLVYEQLTGERGAFMTRIAYVVVNDKDR----FPYQLRV
TOLB_ECOLI      LAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQ----FPYELRV
TOLB_EDWI9      LVQNQYKVTGQWLRYAAHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQ----FPYELRV
TOLB_HISS2      LSQNQYAVPKNAIRLGAHTISDEVFEKLTAIRGAFRTKIAYVVQKNGGS----KPYQVRI
TOLB_HAEIE      LMQNSYTVTNKWLRYGAHTVSDEVFEKLTAIRGAFRTRIAYVVQKNGGS----QPYEVRV
TOLB_BLOPB      ISENQYSVEKKWLRYVAHAISNEIFEKLTGIKGAFCTRIAYVLRIHNDH----YPYELYI
TOLB_COXBU      LLSESFNVNAKELRNLAHHISDLIYQKLTGVRGVFSTKIAYVLVQASSENT-AAKYTLEV
TOLB_XANOR      MLGLAMTARANAMRDVSHQMADAIYEKITGVRGAFWTRIAYVTASGKGG---AMRYALMV
TOLB_POLSJ      LGGQSYTVAQADLRLSAHRISDFVYEKLTGEKGIFSTRIAYVTKTAQR-------FNLWV
TOLB_BURVG      LGGLSLTANDTTLRTAGHKIADYIYQKLLGVRGVFATRLSYVIKTGNR-------YQLQI
TOLB_METFK      LVGMEYNITPSQLRLTAHKIADVIYQKLTGEQGVFATRIAYVSKSGGR-------YALQV
TOLB_VESOH      LYKDIFTVHNSGIRRIAHYLSDQIYHALLGKRGFFNTRLAYITVINKDKG--EREYRLEI
TOLB_BRUA2      -IGQQFFTTPDNWRRVAHIIADAIYERLTGDKGYFDTRVVFVDESGPAQKR---VKRLAI
TOLB_JANSC      GEGLQFVGPADSWRRMAHTVADQVYSRITGEGGYFDTRVAFIAEEGPKNAR---LKRLAI
TOLB_SPHWW      -TRQGFVVQPAQWRRAAHKCADLVYTRLTGEGPYFDSRVVYVSETGPKTNR---IKRLAI
TOLB_SPHAL      -VRKGFEIQPADWRRAAHKCADAIYSRLSGEAPFFDSRVAYIAESGPKGNR---IKRLAI
TOLB_GLUOX      -QGTAYTASNSNWRRIAHIIADVIYERMLGEKGYFDTRIAYIARTGPRHHQ---ITRLAL
TOLB_RICPR      -TGALFEVPTKLWRRAAHKIADKIYEKITGDPGYFDTKIVYVSES-TVLPK---IKRIAL
TOLB_ORITB      -TRKSFTFPSQLWRSTAHKIADQIYKHVTGSKGNFNTKIVYVSESNSSNRK---IRRIAI
TOLB_WOLWR      -LTQSVVFPAKDWRKIGHLVSDVIHDRLIGEKGHFNTKITYIAEEKDSNYKS--VRKIAV
TOLB_WOLPM      -LTQSVVFPAKDWRKIGHLVSDVIHDRLIGEKGHFNTKITYIAEEKDSNYKS--VRKIAV
TOLB_WOLPP      -LTQSVVFLAKDWRKISHLVSDLIHDRLIGEKGHFNTKITYIAEEKDSNYKS--VRKIAV
TOLB_GEOMG      ILAKRYTGRPGDVRRIAHTFSDDIMAALTGERGPFTGKIAFVSTRAGAK-------AIFL
TOLB_PELCD      LTGRRYAGLRRDVRTMAHKFADQVLKSVTGREGPFSSRIAYIDNRTGHK-------ELYL
TOLB_DESOH      ILGKKYKGKPVDQRKMIRRFCAEVMEQLTGTPGIFESRIAFISTGDGSK-------EIYA
TOLB_SYNAS      LMGKQYTGGFEDRRDMVIRFVQEVLSLLTGGEGFFDTRIAFVVRQGRSS-------SLHT
TOLB_ANASK      VLVKLLRVDGADARSLAHRMADEIVRYYTREPGIFATRIAAIRRGRGTW-------ELVT
TOLB_MYXXD      DLKVSKDAPADNASLLAHRLADALYRHFTREPSPFLSRITYVRKAGTNR-------DVYV
TOLB_WOLSU      -AKSYTVAREDRYPFVAHKMAIDINNYIKAPSIDWMNRFVVLSKYTAPSES-----QIVV
TOLB_HELHP      -VKDYTENDVKRFPFIAHRMCIDVNSYIQAPSIEWMQRLVVLSQYTTSGNS-----EILI
TOLB_HELPY      -TFDYPIVSLDLYPFAAHNMAIVVNDYLKAPSIAWMKRLIVFSKYIGPGIT-----NIAL
TOLB_CAMJE      -EQTYTLNGLEQYPFLAHKSVKASVNALGLAPVDWMDHKILIARNSSSKKS-----QIIM
TOLB_BDEBA      VLGKKYKGPTSSARRIAHTFANDVMKALTGVEGPFLSRVVVSSDKGSGQSK-----EIFT
TOLB_DESPS      ILGKSYKGSMSQQNPMIFKFCDAAIKSLTGTEGIASSRIAFVSYEKRTK-------DVFM
TOLB_FRATT      QAITYKNINVSLMRTLAHKISNYVYQKLTGNQGFFLTKLAYVKVSNPYARY-GRLYELII
TOLB_DESVH      FGKAYSHVEDGLLPNVADRFCSDLMKALTGRGEFFKSTLAFVKHDGKNK------RDVWL
                                                                         :  

TOLB_SHEPA      ADY----DGYNEQMLLRSPEPLMSPSWSPDGQSLAYVSFENRKAE------VFVQNIYTQ
TOLB_IDILO      ADY----DGANEKILLRSPEPLMSPAWSPDGNKLAYVSFENKTAE------IFMQDIYTT
TOLB_VIBPA      ADY----DGYNERLVLRSKQPLMSPAWSPDGQKLAYVSFQNGQAE------IFIMNIYTG
TOLB_ECOLI      SDY----DGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSA------LVIQTLANG
TOLB_EDWI9      ADY----DGYNQFVVHRSAEPLMSPAWSPDGSKLAYVTFESGRSA------LVIQTLSNG
TOLB_HISS2      ADY----DGHNQFIVYSSSQPLMSPAWSPDGSKLAYVSFENRKSQ------LIVHDLQSG
TOLB_HAEIE      ADY----DGYNQFIVNRSAQPIMSPAWSPDGQRLAYVSFENKKSQ------LVVQDLNFG
TOLB_BLOPB      SDY----DGHNQISICRSTEPLMSPAWSPDGKKIAYVTFASGHSE------LVIQALNTG
TOLB_COXBU      ADA----DGFNPQPLLVSDMPIMSPTWSPDGNKIAYVSFEGHRAA------IYLQDLATG
TOLB_XANOR      ADS----DGYNPQTIVRSAEPLLSPNWSPDGKKLAYVSFERGNSS------IYLQDIATG
TOLB_POLSJ      ADS----DGEGAQSALTSPEPIISPSWSPNGSQLAYVSFESRKPV------IYAHDVATG
TOLB_BURVG      SDS----DGQNARIALSSTEPIISPAWSPSGTKVAYVSFERKKPI------VYIHDLPTG
TOLB_METFK      ADS----DGYNPQTVVSSAEPIISPVWSPDGTKLAYVSFEKKKPI------IYVQSLVSG
TOLB_VESOH      SDS----DAQNPQTILKSREPLLSPVWSPKQDKIAYVSFKNSRSE------VFIQYPFIR
TOLB_BRUA2      MDQ----DGANVRFISDGRALSLTPRFSPNRQEVTYMSFEGGSPK------VYLLQLETG
TOLB_JANSC      MDY----DGANVQFLTDSRSIVLAPRFSPQGDRILYTSYESGFPQ------VYIMDVATV
TOLB_SPHWW      MDQ----DGANHRFLTNGQTIVLTPRFAPNQQTITYMSYTNNRAR------VYVYDIGSG
TOLB_SPHAL      MDS----DGGNHRFITNGQALALSPRFSPDYKKIVYVSYLNDRVR------VFIYDVASG
TOLB_GLUOX      MDQ----DGANERMLTGGEWLTLTPRFNPVRDQIAFMSYANNRPR------VYLFDLASG
TOLB_RICPR      MDY----DGANNKYLTNGKSLVLTPRFAHSADKIFYVSYATKSRAL-----VYEKDLKTG
TOLB_ORITB      MDQ----DGANHNYITNGKNHVITPVFSPKNNQILYVSYHNKIPT------VRIHDLNSG
TOLB_WOLWR      MNQ----DGSNIKYLTNGDRFVSTPRFSPNGKGIVYISYANGKSY------IILKNLKDN
TOLB_WOLPM      MNQ----DGSNIKYLTNGDRFVSTPRFSPNGKGIVYISYANGKSY------IILKNLKDN
TOLB_WOLPP      MNQ----DGSNIKYLTNGEKFVSTPRFSPNGKGIVYISYTNGKSY------IILKNLKDN
TOLB_GEOMG      MDY----DGHNVQQLTKNRSINLNPDFSPSGKEIIFTSYRQGNPD-------LFRRELFT
TOLB_PELCD      MDT----DGANALRLTDHRSIVLNPDFSPNGREVIYTSYRRGNPD-------LYRKQLST
TOLB_DESOH      CEF----DGYNPQRITRNSSINLSPAWSSDGQWLAYTSYRKGGPD-------LYITHLTE
TOLB_SYNAS      VGFGSQIDGRDLARVAGSPSLILSPRWSPDGRYLAFSSYRDGKPD-------IFVVSPSG
TOLB_ANASK      QDM----DGGNQQVLLSERSILMSPAWRPDGREILVTSYRSGRPE-------LWAYRFSD
TOLB_MYXXD      ADW----DGGN-ARALTKGGINILPALSQDGSQVAFTTYRKNRPD-------IYVQSPGG
TOLB_WOLSU      ADY----TLTFQNVIIKDGRLNIFPKWANEQQDAIYYTKYLT-KPT-----LFRYNLYTG
TOLB_HELHP      ADY----TLTYQKVVVKGG-LNIFPKWVDSKQESIYYTKYLD-VPT-----ILKHNLTTG
TOLB_HELPY      ADY----TMRYQKEIIKNNRLNIFPKWANAEQTEFYYTQYGERTPM-----ILKYNIQKA
TOLB_CAMJE      ADY----TLTYQKVIVDGG-LNLFPKWGNKEQTLFYYTAYDHDKPT-----LYRYDLNTN
TOLB_BDEBA      MDW----DGANMEQVSNHRSISISPAWSPDGKKIAYTSYVKRVGAKFRNADMLLLDLTTG
TOLB_DESPS      TDI----LGRRIRQVTRHNNLVVSPRFTRDGNFLSYSSYHSGSQK------LYITDLRQA
TOLB_FRATT      SDYD---GYNKHVVLRQTDNPIATPSWSNDGRYIVYSSYSGGSMG------VYTLEIATG
TOLB_DESVH      VKP----VGRDLRKITNLPGEALSPSWSPDGRFVVFSHFDDRSHA------LGVWDRLTR
                                        *                                   

TOLB_SHEPA      QR-TKITSFDG--INGAPVFSPDGKKLAVTLS--KDGQPEVYVVDIATKAIKRVTNHY--
TOLB_IDILO      RR-EKLTSFPG--INGNPVFSPDGKKLAMVLS--KDGNPELYVFDIKTKDLQRVTRNR--
TOLB_VIBPA      ER-EKITSYPR--HNGAPRFSPDGNKLALVLS--KTGTLQVYTFDLKTRKLTQITRSR--
TOLB_ECOLI      AV-RQVASFPR--HNGAPAFSPDGSKLAFALS--KTGSLNLYVMDLASGQIRQVTDGR--
TOLB_EDWI9      AI-RQVASFPR--HNGSPAFSPDGSKLAFALS--KTGSLNLYVMDLASGAIRQVTDGR--
TOLB_HISS2      AR-RVIAAFPG--HNGAPAFSPDGSKIAFASS--KDGVLNIYVMNLGNGTISQLTSGA--
TOLB_HAEIE      AR-KVVASFQG--HNGAPAFSPDGSRLAFASS--RDGVLNIYVMGANGGTPTQLTSGA--
TOLB_BLOPB      LV-NNIVSFPG--HNGAPSFSPDCKKLAFSLS--KTGSLNLYIMDLESGEITQLTKNR--
TOLB_COXBU      RR-QRLSEAPG--INGAPAFSPDGKQLALVLT--KTGNPKIYILNLADGHLREITKGW--
TOLB_XANOR      AR-ELVSSFRG--INGAPSFSPDGRRLALALS--RSGNPEIYVMDLGSKQLTQLTNHF--
TOLB_POLSJ      KR-RLLANFRG--SNSAPAWSPDGKQLVATLS--RDGGSQIYALGLSGGDPKRLTQSS--
TOLB_BURVG      RR-YMVSDQKG--NNSAPAWSPDGNTLAVALS--LTGNTQIYTVNANGGGLRRLTQSS--
TOLB_METFK      QR-TVLANFKG--NNSAPAWSPDGKRLAIVLT--HAANSQIYSINADGTGLQQLTRTT--
TOLB_VESOH      RKIQKLPYFDG--IASSPSWHPNGEILLLTLS--KNGNKDIYSYQLSSKKLTRLTIDM--
TOLB_BRUA2      QR-ELVGNFPG--MTIAPRFSPDGQKVVMSLLQ-DDGSANIYTMDLRNRTTTRLTSSQ--
TOLB_JANSC      QR-RPLEAIPAETMTFSPRFSPSGQSVVFSLV--DGSNTDIYSLDLATGTRRQLTQAP--
TOLB_SPHWW      SQ-RLVVDQPN--MTFAPRFSPDGRTIVFSMA--VGGNTDIYRVSAGGGTPQRLTTSP--
TOLB_SPHAL      TQ-RLVTESRN--PTFAPRWSPDGTQILYSMA--VGGNTDIYRISANGGTPVRLTTAP--
TOLB_GLUOX      RQ-QILGEFAG--ISFAPRFSPTGGSVVLSAT--RGGGSDIFVVDLASRAKRQITNSNG-
TOLB_RICPR      KE-SVVGDFVG--ISFAPRFSPDGKKAVMS-IA-KNGSTHIYEIDLATKQLNKLTNGF--
TOLB_ORITB      NN-KILASFNG--ITFSPRFSPDGNKILVSNSS-TKNVTHIYEINLLTGKIKQLTKGQ--
TOLB_WOLWR      TE-SIISTFEG--VVSAPRFSPDGKSLLISHS--LGGETNILSLDLSSKRTKKITKGS--
TOLB_WOLPM      TE-SIISAFEG--VVSAPRFSPDGKSLLISHS--LGGETNILSLDLSSKRTKKITKGS--
TOLB_WOLPP      TE-SIISAFEG--VISAPRFSPDGKSLFISHS--LSGETNILSLDLSSKRTKKITKGS--
TOLB_GEOMG      GAEARISSYRG--INATGAWSPDGKTIALTLS--KDGNSEIYTISRDGKNPHRLTNTS--
TOLB_PELCD      GQEARLAFKKG--LNIAARFRPDGREIALTQS--ATGNPELMLLGTDGSRRRRLTSHW--
TOLB_DESOH      N-RGTVFSKEG--INIAPSWVPGQFMLAATLS--FEGDQEIYLLTGSGTVVRRLTRSW--
TOLB_SYNAS      SGLKKIVSFQG--LNLPGAWSPDGRSLLLTLS--KDGNEEIYVMDVRSGQVRRLTRNS--
TOLB_ANASK      RAFRPLGRHR---NAFGGVYSPDGSRIAFTVS--EGNVTDLWVMSADGVGARKLTSDP--
TOLB_MYXXD      EAKAVISGGQ---MATGAAFSPDGKRIAYSLA--EGESAQVYVANADGSGARALTDTPY-
TOLB_WOLSU      ES-RKITESEG--MLVASDVSADGKKLLLTMA--PHTQSDIFLFDTQTGTRKQLTRYP--
TOLB_HELHP      HI-EQLVGSEG--IAVVSDVSKNGENLILSLS--PTALSDLYLYNTKSKNLRRLTNYS--
TOLB_HELPY      TH-ENIASSQG--MAVVSSVSSDGSKILMSLA--PDGQPDVYLYDTHKKTKTKITRYP--
TOLB_CAMJE      KA-SKILSSGG--MVVASDVNVDGSKLLVTMA--PKDQPDVYLYDLNTKNLTQLTNYS--
TOLB_BDEBA      KR-SLISYRQG--INSGASFSADGKHIYLTIS--QGNSPDIYKMGLDGTLVGKITNGPAG
TOLB_DESPS      KITKSLSRRKG--MNLAPTWAPDGKSCILTLS--KYGAPDLFRINQQGKILEQLTSRA--
TOLB_FRATT      KV-TRITNYKG--INSSPSFSPDGKEIALALSKGYSDQTNIYIMNLSTKALKRITING--
TOLB_DESVH      QVQRIRFPGNT---VIGPCFLPD-NKVAVSLS--SGRNPDIFLLNHLFKKERELEANP--
                                                       .:            :      

TOLB_SHEPA      AIDTEPSWFP-DGKSLLITSERGGRPQLYRVFLDS---GKISRLTFEGEWNLGGSISPDG
TOLB_IDILO      TIDTEPNWTP-DGESLVFTSERGGRPQLYSVNLSS---GQVRRLTFDGEQNLGGTLVPSG
TOLB_VIBPA      SNNTEPFWHP-DGKSLIFTSDRGGKPQIYQVNLGS---GSIDRLTWQGSQNLGGQITPDG
TOLB_ECOLI      SNNTEPTWFP-DSQNLAFTSDQAGRPQVYKVNING---GAPQRITWEGSQNQDADVSSDG
TOLB_EDWI9      SNNTEPTWFP-DSQNLAFTSDQAGRPQIYKMNING---GVAQRLTWEGSQNQDAEVSPDG
TOLB_HISS2      GNNTEPSWSP-DGQSIIFTSDRAGGPQIYQMDVVG---NGVSLVSA--GRGYSGKISADG
TOLB_HAEIE      GNNTEPAWSP-DGNSILFTSDRSGSPQVYRMDASG---GSATVVG---GRG-SAQISADG
TOLB_BLOPB      NNNTEPSWFP-DNQNIAYTSDQGGSPQIYKINVKT---TEIQRLSWLHTSNQNPNVSSDG
TOLB_COXBU      SIDTEPAWSP-DGKSLLFTSNRDGTPQIYNYSFAD---GSINRVTYRGDYNARPSFMPDG
TOLB_XANOR      GIDTEPTWAP-DGGSIYFTSDRGGRPQIYQVAASG---GSANRVTFQGNYNATASVSFDG
TOLB_POLSJ      SIDTEPAYSP-DGRYIYFVSDRGGAPQIYRMSPGG---GNPERVTFTGGYNISPAISPDG
TOLB_BURVG      SIDTEPFYSP-DGHWIYFTSDRGGAPQIYRMPAQGESAGAAQRVTFTGSYNTSPRVSPDG
TOLB_METFK      AIDTEPTWSP-DGRYIYFTSDRGGSPQIYRMPSSG---GEASRMTFEGSYVVSPRLSPDG
TOLB_VESOH      GIDTEASYSP-DGNKIIFTSNRSGQVQVYIKDLKT---NKINRATFKGRYNAQAVFSPDG
TOLB_BRUA2      AIDTGASYSP-DGSQIVFTSDRGGRPQLYVMGAD---GSNPRRISMGDGSYSTPVWSPRG
TOLB_JANSC      SIETAPSFSP-DGSQIVFESDRSGNQQIYIMPAD---GGEARRVSAGTGRYGTPVWSPRG
TOLB_SPHWW      GIDTGASYSP-DGSKIVFESDRSGTQQLYVMNAD---GSNQNRISFGSGRYGSAAWSPRG
TOLB_SPHAL      GIDVGGSFSP-DGRKIVFESDRSGSQQLYVMNID---GSNQQRISFGGGRYATPEWSPRG
TOLB_GLUOX      AIDTSPCFSP-DGSQIVFNSDRGGSPQLYIMSAS---GGAAKRISYGSGQYGSPVWSPRG
TOLB_RICPR      GINTSPSYSP-DGKKIVFNSDKNGVPQLYIMNSD---GSDVQRISFGVGSYASPSWSPRG
TOLB_ORITB      SINTSPSYSP-DGSKIAFVSDRSGSTQIYIMNDQ---GGNIKRLTSQPGAYTTPAWSPTN
TOLB_WOLWR      AISTSPSFSP-DQKYMAFSSDISGSQQLYVIDFTNK-SKKPKRISFGSGRYATPVWSPKG
TOLB_WOLPM      AISTSPSFSP-DQKYMAFSSDISGSQQLYVIDFTNK-SKKPKRISFGSGRYATPVWSPKG
TOLB_WOLPP      AISTSPSLSP-DQKYMVFSSDISGSQQLYIIDFTKK-SKKPKRISFGNGRYATPVWSPKG
TOLB_GEOMG      AIEVSPAWSP-DVRKIVFVSDRLGKPQIFIMNADG---TGVRRLTTSGNYNVSPRWSPKG
TOLB_PELCD      GIDVDPSWSP-AGDRLAFVSDRQGNPHIFVMDLLG---GQTARLTANGKYNATPAWSPDG
TOLB_DESOH      GIDVSPTFSP-DGKRMAFVSGRAGSPQIFIMDMGS---GRTQRLTFEGGYNTNPSWNPVN
TOLB_SYNAS      AIDVSPVWSP-DGRRIAFVSNISGSPQIYVMNADG---GDVRRLTYSGNYNTTPAWSPRG
TOLB_ANASK      AIDVSPTWSP-DGRRIAFVSDRSGTPQIYVMGADG---SGARRLTFQGNYNQTPQWSPRG
TOLB_MYXXD      GLNTSPTWSP-DGKRIAFVSNRGGSPQVYIMNADG---TGVRRLTFQGNYNQTPDWSPRG
TOLB_WOLSU      GIDVSAHFIE-DERRIMFISDRLGYPNVFATGLDGSE--TVEQMVFHGRNNNAASAFGQY
TOLB_HELHP      GIDVDGKFVN-NEKEIIFVSDRLGYPNIFMMRLDGG---GTEQVVLHGRNNSAVTSNGKY
TOLB_HELPY      GIDVSGVFLE-DDKSMAFVSDRSGYPNIYMKKLGLKE--SAEQLLYEGRSNESIDAYKDS
TOLB_CAMJE      GIDVNGNFIGSDDSKVVFVSDRLGYPNIFMQDLNSN---SAEQVVFHGRNNSAVSTYKDF
TOLB_BDEBA      ALNVEPTVSP--QGLLSFSSDRAGRPMIYTADAAG---NNVKRITFAGVFNSSPSWSPDG
TOLB_DESPS      GVNVSPTYSA-DGRHIVFVSDRSGRPQLYLMELET---KQTKRLTYDGRENAEPNWSPVE
TOLB_FRATT      -INTAPKFSP-NGQSIVFTSDREGRPNIYVASVNSK-YPQSSILSTKIHQAYEPNYTPDG
TOLB_DESVH      SINVSPSFDA-TGTKMAFTSSRMGGPQVFMKDMTT---GQVTRISKTGSYNTEPSISPDG
                  ..           :   *   *   ::                               

TOLB_SHEPA      RSIIFVNRINGK----FNIARMDLET-----RFM--QVLTSTRLDESPSVAPNGTMVIYG
TOLB_IDILO      EDMILVNRTRGN----YHIAKQEFPR-----GNM--QVLTKTSLDESPSVAPNGSMVIYS
TOLB_VIBPA      RFLVMVNRSDSG----FNLAKQDLET-----GAL--QVLTKTLLDESPSIAPNGGMVVYS
TOLB_ECOLI      KFMVMVSSNGGQ----QHIAKQDLAT-----GGV--QVLSSTFLDETPSLAPNGTMVIYS
TOLB_EDWI9      KFLVMVSSSAGA----QHIAKLDLGT-----NAT--QVLTDTFLDETPSIAPNGTMVIYS
TOLB_HISS2      SILVMIY---GD----N-IVKKDLAT-----GVT--EMLSSTFLDESPSISPNGIMIIYS
TOLB_HAEIE      KTLVMIN---GN----NNVVKQDLTT-----GVS--EVLSTSFLGESPSLSPNGIMIIYS
TOLB_BLOPB      TFIIMVNRHQGK----QNIAKLNLLT-----GQE--EILTDTLLADSPSIAPNNTMVLYS
TOLB_COXBU      KSIIMMHRENGL----FGIARQDLST-----GQV--QILSESGTDESPSLAPNGKMAIYA
TOLB_XANOR      KKIAVAQGSGNT----YRIAMMDRSL-----GSPSWSTLSPGSLDESPSFAPNASMVLYA
TOLB_POLSJ      RWLAYVSRVGGA----FKLHVMELAS-----GTA--TPITDTTADESPSFAPNSRLIVYA
TOLB_BURVG      KLLAYISRTGGG----FKLYVQDLQT-----GAA--NAITNTNRDESPSFAANGQYILYA
TOLB_METFK      KSLAYIRRDGGQ----FRVALQDLQT-----GQV--QVLSDGPKDESPSFAPNGRMLLHA
TOLB_VESOH      KSLIMVHKIDQD----YRIALLDIAT-----KDL--KVMTNNQLDESPFFSPNGDMIIFA
TOLB_BRUA2      DLIAFTKQSQGQ----FSIGVMKTD-------GSGERLLTSGFHNEGPTWAPNGRVLMFF
TOLB_JANSC      DYIAFTKQENGR----FHIGVMRTD-------GSDERLLTSSFLDEGPTWAPNGRVIMFT
TOLB_SPHWW      DLIAFTKIGGG-----FNVGIMNID-------GSGEKILTNGWQDEGPSWSPNGRVIMFF
TOLB_SPHAL      DLIAFTRMGGGE----FRIGVMTPS-------GGGVRMLTNGWQDEAPTWSPNGRVIQFF
TOLB_GLUOX      DLIAFTRIGSGG----FSLGVMNPD-------GTGERILTQGFTVDGATFCPNGRVLAFC
TOLB_RICPR      DYIAFTKIIRQDGEKTFNIGIMKAYPQD---HGNSERIITSGYLVDSPCWSPNGRVIMFS
TOLB_ORITB      NYIAFTKIEAGE----FSIGVIKLD-------GSNKRIIATKYLVEGPSWAPDGKTIIFS
TOLB_WOLWR      DLIAFTKIQSGK----FYIGVMKPD-------GKEERLLSEGHKIESPAWLPNGREIIFT
TOLB_WOLPM      DLIAFTKIQSGK----FYIGVMKPD-------GKEERLLSEGHKIESPAWLPNGREIIFT
TOLB_WOLPP      DLIAFTKIQSGK----FYIGVMKPD-------GKEERLLSEGHKIESPAWLPNGREIIFT
TOLB_GEOMG      DRIVYSRQ-EGG----FQIYAINPDG-----TNDTRLTS-EG-SNEHPRWSPDGRFITFS
TOLB_PELCD      KRIAFTRL-EKGV---FDIYTVRPDG-----TDERRLTFGPG-NKEHPRWSPDSRFLVYS
TOLB_DESOH      DTIAYCAM-TGGA---FNVRVIDVKT-----GATVALTADQG-DNESPSWSPDGSLIAFS
TOLB_SYNAS      GKIAYEGK-VGSG---YQIFSIDEDG-----GNVRQLTSGAG-DHEFPSWSPDGRFLTFS
TOLB_ANASK      DLIAFTARDERKV---FDVFVVSPDS-----GAINRITQDQGRTNEEPSWAPNGRLMIFR
TOLB_MYXXD      DLIVFTARDERNA---FDLFTVSVET-----GKVTRLTQDQG-SNEEPAFSPNGRLIVFT
TOLB_WOLSU      IVYSSRESSNEFDTNTFNLYLVSTK-------SDYIRRLTANGVNQMPRFSQDGETVMYL
TOLB_HELHP      AVYTSRETNNEFGANTFNLYLISLAP-----GSNYIRRLTASGKNQMPKYSNDGGTIMYL
TOLB_HELPY      IVYVSRENLNEFGKTVFNLNLITLN-------SKYIRRLTVNGSNQMPRFSTDGRNIMYI
TOLB_CAMJE      LVYSSREPNQ---AGVFNIYLMSIN-------SDYIRQLTANGKNLFPRFSSDGGSIVFI
TOLB_BDEBA      KKIAFAGQSDNN----FDIFVMNADGTGMIRLTSAKKPNGRMASNEDPSFSPDGRFVMYT
TOLB_DESPS      NKIAYSSLRDGL----YQIFTLDPFS-----AAPPKQLTSDLTRHESPVWSPDGNQILFT
TOLB_FRATT      KNIVFMNQSSRT----SGTQIADFNL-----ANGSVTNITNGKADSSPTVSPYGDMVAYI
TOLB_DESVH      TLVAFTKMTDTG----HRIFVYDMVTQ------SERQVSFGPGRDEQPSFAPDSYFLAFT
                                                               .          . 

TOLB_SHEPA      TTYQ---GKQVLAA----VSMDGRFKAR-LPAGQGEVKSPSWSPFL-----
TOLB_IDILO      TTHN---NKQVLAL----VSIDGRFKAR-LPATDGEIKSPAWSPFM-----
TOLB_VIBPA      SIYN---KKNVLSM----VSIDGRFKAR-LPATNGRVRAPAWSPFL-----
TOLB_ECOLI      SSQG---MGSVLNL----VSTDGRFKAR-LPATDGQVKFPAWSPYL-----
TOLB_EDWI9      STQG---LGSVLQL----VSIDGRFKAR-LPATDGQVKFPAWSPYL-----
TOLB_HISS2      STQG---LGKVLQL----VSADGRFKAR-LPSSDGQIKFPAWSPYLNKN--
TOLB_HAEIE      STQG---LGKVLQL----VSADGRFKAS-LPGSDGQVKFPAWSPYLTK---
TOLB_BLOPB      NINKDLTTKSNLEL----ISIDGHFKAH-IQGDQGDIRFPTWSPLHLE---
TOLB_COXBU      MEYG---GRGVLAQ----VSIDGQIKLR-LPARNGNVQEPAWSPYLGV---
TOLB_XANOR      AREG---GRGVLYA----VSSDARVRQR-LVLADGDVREPAWGPYRTAH--
TOLB_POLSJ      TQQQ---GREALMT----TTLDGKIKAR-LSGAGGDIREPDWGPFQR----
TOLB_BURVG      TQSG---GRNVLAA----VPTDGSAPPQILSVQGGSVREPSWGPFMQ----
TOLB_METFK      TRVG---GRGALAA----VSADGRVKQR-LSESGGDVREPAWGPIISQ---
TOLB_VESOH      TNQG---GFGVLSV----VSIWGRQIFE-LTSKVGEVREPNWSHYLK----
TOLB_BRUA2      RKAAGA-GGPKLFT----IDLTGRNERQ--IQTPNFASDPAWSPLLE----
TOLB_JANSC      RETPGDDGAPAVYS----VDISGRNLQR--VATPGMASDPAWSPLQS----
TOLB_SPHWW      RTAQG-SGKADLWS----VDLTGVNERP--VPTPLDGSDPAWGPLLP----
TOLB_SPHAL      RTTPGREGRSSLWQ----VDLTGVNLRR--LPTPQDGSDPSWGPVLP----
TOLB_GLUOX      RQSASGAGGAGFASGIGTIDITGFNERP--IRISTGASDPAWSPRNG----
TOLB_RICPR      KGWPSKANAPGKNK-IFTIDLTGHNERE--IITPADASDPEWSGILN----
TOLB_ORITB      RAYKATKSTSTKVK-LYSVDYTGYNERE--IQTPENASDPNWSNEYE----
TOLB_WOLWR      RTESPSNSKLYLVD------LVKKNQKM--VSTPTNASLPDWSYF------
TOLB_WOLPM      RTESPSNSKLYLVD------LVKKNQKM--VSTPTNASLPDWSYF------
TOLB_WOLPP      NAESPSNSKLYLVD------LVKKNQKM--VFTPTNASLPDWSYF------
TOLB_GEOMG      STRGGGEG-IYVMR------ADGSGQTR-VSGGKGRDSHPTWSPRW-----
TOLB_PELCD      SDQDGRKG-IYIMR------ADGTGIRR-ISAGGGQCQHPAWSGQR-----
TOLB_DESOH      STREAGVSRIYVMT------AAGTDPRR-LLILPGEQTGPKWSPAVAAGR-
TOLB_SYNAS      -LRSGGRSRINILN------ANTLEVRT-LYESTDRCLGPAWSPRLKQALR
TOLB_ANASK      TDRNGGIQ-LVVSD------ARGDRQTP-VTSGKTDLAAPAWGPLAP----
TOLB_MYXXD      STRNGGSQ-LYVMT------ADGNNQLP-LRTEKGTYQTPDWSPLPQAQ--
TOLB_WOLSU      KHNGAQSALGVIRL--------NYNKSYLFPLPSGKIQSMDW---------
TOLB_HELHP      KYYKAQSALGIIRI--------DYNTNYFFPLIKMKIQAFDW---------
TOLB_HELPY      KKTPQEYAMGLILL--------DYNQSFLFPLKNVKIQAFDW---------
TOLB_CAMJE      KYLGAQSALGVIRV--------NANKTFYFPLRVGKIQSIDW---------
TOLB_BDEBA      SNRTGKNQIYISTV-------DGTEERR-VTNDNNNYYKPKWSNNID----
TOLB_DESPS      QYDGRRQQIYAIMK-------NGSYQRR-VFSFPGSQSSARWAR-------
TOLB_FRATT      STNTRGYSSLDMVSLD----GDNHFNIETADNGNILIQSPSWSPKNF----
TOLB_DESVH      SNRNGAQQIFLVTR-------HGGDPKR-VPTGPGDASFARWGMIPE----
                                                         *