CLUSTAL format seed alignment for MF_00672

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1670_HAEIE      --------------------------MISLKNF-----------------------GL--
Y4180_HAEIG      --------------------------MISLKNF-----------------------GL--
Y276_HAEIN       --------------------------MISLKNF-----------------------GL--
Y384_HAEI8       --------------------------MISLKNF-----------------------GL--
Y1616_PASMU      -------------------------MNNVLKNA-----------------------GLFL
Y693_HAES1       -------------------------MSNLCRNI-----------------------KVFF
Y1104_HISS2      -------------------------MSNLCRNI-----------------------KVFF
Y1801_AGGAN      -----------------------------MIEW-----------------------KTFC
Y342_ACTSZ       -------------------------MKTAFTPF-----------------------ASFG
Y032_MANSM       ------------------------MRRVVMTQL-----------------------KLLF
Y1950_ACTP2      ----------------------------MSLSQ-----------------------PLFI
Y1376_HAEPS      -----------------------------MKNL-----------------------IFFF
Y3482_PSYIN      ------------------MKFGRKIVMDKVKVT-----------------------YQYL
YIHY_SHIDS       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_SHIF8       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_SHIB3       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOL5       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOL6       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOHS       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO81       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO8A       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOLU       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO5E       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO57       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO24       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOUT       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOSM       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOSE       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOLI       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECODH       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOBW       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOLC       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO55       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_SHIFL       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECOK1       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO45       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_SHIBS       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_SHISS       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ECO27       -----------------MLKTIQDKAKHRTRPL-----------------------WAWL
YIHY_ECO7I       -----------------MLKTIQDKARHRTRPL-----------------------WAWL
YIHY_ESCF3       -----------------MLKTIHEKARHHTRPL-----------------------WAWL
YIHY_SALA4       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALCH       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALTI       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALDC       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALEP       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALG2       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALHS       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALNS       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALSV       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALTY       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALPB       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
YIHY_SALAR       -----------------MLKTVHQKAGRHTRPV-----------------------RAWL
Y3126_CITK8      -----------------MLKNVHQKARHHTRPV-----------------------RAWL
Y4092_ENT38      -----------------MLKNVHQKASHHTRPF-----------------------RAWV
Y5501_KLEP3      -----------------MLKTVQQKLHHHTRPL-----------------------LAWL
Y4136_KLEP7      -----------------MLKTVHQKLLHHTRPL-----------------------LAWL
Y4062_CROS8      -----------------MLKSVHQKVARRTGPL-----------------------LAWL
Y028_YERPE       -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y034_YERPG       -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y3877_YERPP      -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y3514_YERPA      -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y254_YERPN       -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y027_YERPS       -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y030_YERP3       -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y028_YERPB       -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y4186_YERPY      -----------------MASFRRFRLLSPLKPC-----------------------VTFG
Y031_YERE8       -----------------MASFLRFRLSASLKPY-----------------------ITFG
Y4878_SERP5      -----------------MSFFRRKKLPSAIKPG-----------------------VTFG
Y100_ALIF1       ---------------------MEDKIKHKLRIG-----------------------WSYL
Y098_ALIFM       ---------------------MEDKIKHKLRIG-----------------------WSYL
Y2938_ALISL      ---------------------MEEKFKYSLRIS-----------------------WSYF
Y2742_VIBCH      ------------------MKLTHSFIKQQARLG-----------------------LNFF
Y3514_VIBC3      ------------------MKLTHSFIKQQARLG-----------------------LNFF
Y2662_VIBCM      ------------------MKLTHSFIKQQARLG-----------------------LNFF
Y1626_VIBCJ      ------------------MKLTHSFIKQQARLG-----------------------LNFF
Y885_VIBVU       --------------MNQLFGSDKLRLPQRAQAG-----------------------IAFV
Y203_VIBVY       --------------MNQLFGSDKLRLPQRAQAG-----------------------IAFV
Y126_VIBA3       --------------MNELPGSYKLKIKKAATGS-----------------------IQFS
Y593_VIBCB       --------------MNQLSESYKVRLSKLVPGS-----------------------VAFF
Y125_VIBPA       --------------MNQLSESYKARLSNLLPSC-----------------------VAFF
Y3489_PHOPR      --------------MAENKITGKVHFLQCLKQT-----------------------IAYL
Y315_SHEB5       -------------MTKKIELAQIRVLFLGIW--------------------------HFL
Y319_SHEB9       -------------MTKKIELAQIRVLFLGIW--------------------------HFL
Y320_SHEB2       -------------MTKKIELAQIRVLFLGIW--------------------------HFL
Y314_SHEB8       -------------MTKKIELAQIRVLFLGIW--------------------------HFL
Y316_SHESM       -------------MTKKIELAQIQVLFLGIW--------------------------RFL
Y3708_SHESR      -------------MTKKIELAQIQVLFLGIW--------------------------RFL
Y311_SHESA       -------------MTKKIELAQIQVLFLGIW--------------------------RFL
Y4401_SHEON      -------------MTKKIDLAQIRVLLLGIW--------------------------HFL
Y418_SHEPC       -------------MTKKIEVAQIRVLFLGIW--------------------------RFL
Y272_SHESW       -------------MTKKIEVAQIRVLFLGIW--------------------------RFL
Y4618_SHEWM      -------------MKKKINLTQFQTLMLSIW--------------------------HFM
Y302_SHESH       -------------MIKKIDGTQLHTFVLSTW--------------------------HFM
Y3545_SHELP      -------------MINKIDVSLLRSIMLGIW--------------------------QFM
Y3448_SHEDO      -------------MDIQQQTRGFRYFYISVW--------------------------RFI
Y331_SHEFN       -------------MPKKFDYSPIAAFFSGIW--------------------------QFL
Y3404_SHEAM      -------------MKNKIDVSLIQSFFLGVW--------------------------RFV
Y3909_SHEPA      -------------MKNKIAINQVRSFLLSIW--------------------------AFF
Y4118_AERS4      -------------MQQKFGGRLGHALSFLRHDG-----------------------GHFA
Y2447_IDILO      --------------MKQIEWKSYFNHTLG-----------------------------FL
Y3526_ALTMD      ---------------MDLDKV-KTFYNNVAPQL-----------------------RDLF
Y3954_PSEA6      ---------------MESKVIWSDVLRSWLPKA-----------------------NIFV
Y171_PSET1       --------------MNDKLSYYKQQVGSFLRQQ-----------------------PGWW
Y609_COLP3       -------------MLTNMSLFNEKKLISFWHDN-----------------------KELL
Y1325_CHLTE      -------MKENSKEERGRLHGMVWSS------------------------------SAFF
Y1343_CHLP8      ----MSDTKKNSPVSSLLQHERLRVP------------------------------GMYL
Y1013_CHLPB      -------MKASDTGSAGVLAGKLSALL--------------------------SYLRSFL
Y1471_PROA2      -------MPSSEHSFISVPHDALRSV------------------------------RSFL
Y1653_CHLPD      -------MFEGIGGETLWRKEKQRPVKELIDFHMDWLHKKNEHDEWLSDRDGELYIRVFF
Y1623_PELPB      ------------MGEKERRGQNPK--------------TESNAVELVS------CMRVFI
Y1323_PELLD      ---------MAPGSNGIMDGMHRR---------------IGEAGA---------FFRSFV
Y1521_CHLL2      -------MAVGAEPKAAVRETVKRNIM-----------TLQPVDVTWRFAGLQEYFRKLM
Y935_CHLCH       -------MLMKKVPHIIHRANQSG----------------GKRYE---------RMVAFV
Y461_TOLAT       -------MTQDPRRLLALRNQRWAKSRLFCLR-----------------------SRRFS
Y865_STRMK       -------MEPLDTLNLWMERARDRARA-----------------------------ISFG
Y716_STRM5       -------MEPLDTLNLWMERARDRARA-----------------------------ISFG
Y937_XANAC       ----------MNKLHQWKERLRDRART-----------------------------VSFG
Y968_XANC5       -------MSRVNKLHQWKERLRDRART-----------------------------VSFG
Y860_XANCP       -------MSRVNTMHQWKERLRDRART-----------------------------ASFG
Y3370_XANC8      -------MSRVNTMHQWKERLRDRART-----------------------------ASFG
Y3490_XANCB      -------MSRVNTMHQWKERLRDRART-----------------------------ASFG
Y3615_XANOR      -------MSRVKKLHQWKERLRDRART-----------------------------VSFG
Y3417_XANOM      -------MSRVKKLHQWKERLRDRART-----------------------------VSFG
Y4555_XANOP      -------MSRVKKLHQWKERLRDRART-----------------------------VSFG
Y700_NEIMA       --------------MTFLQRLQGLADNKICA---------------------------FA
Y461_NEIM0       --------------MTFLQRLQGLADNKICA---------------------------FA
Y524_NEIMB       --------------MTFLQRLQGLADNKICA---------------------------FA
Y462_NEIMF       --------------MTFLQRLQGLADNKICA---------------------------FA
Y810_CHRVO       --------------MPPLLRGGFGITFAAMQVQ------------------RLEPYFGFA
Y2978_LARHH      --------------MLRLSRLPLPPVLQRLT--------------------------GFS
Y3165_AZOSB      -----------------------MHLHPTRD---------------------------FL
Y4060_AROAE      ----------------------MMPLTAARE---------------------------FM
Y4966_DELAS      ---------MERPEPVVPP---SWR-----ERL------------------RCFPWRNTA
Y3782_VEREI      ---------MSLPFSLSVA---ARRIEALLGDL------------------SRFPWKTTA
Y2991_RHOFT      -------MHMPPHLPASPPLSWPQRLEALLKDL------------------TNFPWKSTA
Y1422_METPP      ----MAGIISSMTVPDLLKAGWRERIALLAETL------------------QTWPWLDTL
Y2179_JANMA      -----------MKLAIVPF----------FREL------------------TWSQVRNLF
Y3042_BORPD      ------MSHSAGPGAAQPATAAAPR----QRTP------------------WITRVGRVF
Y3061_PARXL      ----------------MSR-----------VRF------------------DLDTLKRLA
Y1559_RALSO      -----------MQFDTRVL-----------RQW------------------NVPKLRALQ
Y452_NITMU       ------------------MELFSQSSRPVAKVM------------------KSIRPVDFM
Y578_RHOCS       ------MLTSDRLRGMLRRL----------PGR------------------LPDAVGVVR
Y2625_RHORT      -----MVDDENRRRGLLGRRSHARSWLPVKPRR------------------ILATAGSFT
Y521_ALKEH       -------MANPVGAIRQRCAAIGEQLQGVD---------------------WLRVAVDFP
Y704_HALHL       MHYQLRRRGTKMTELRGRLRAAGDRLRALPTHP------------------GVGEARGFG
Y1635_KANKD      -------------------------MEKRWKWL-----------------------KAFI
Y2650_LEGPC      -------------------MNWKEKVKTKFYSC-----------------------DRFV
Y643_LEGPH       -------------------MNWKDKVKTTFYSC-----------------------DRFV
Y3681_AZOVD      -------------------------MRQRFVDS-----------------------LDFW
Y2988_PSEMY      -------------------------MHRRLKDW-----------------------LGFW
Y2825_PSEU5      -------------------------MHQRIDNT-----------------------FEFG
Y951_PSEAE       -------------------------MREHFNDG-----------------------VEFA
Y4364_PSEA8      -------------------------MREHFNDG-----------------------VEFA
Y5196_PSEAB      -------------------------MREHFNDG-----------------------VEFA
Y4558_PSEA7      -------------------------MREHFNDG-----------------------IEFA
Y3168_ACIAD      -------------MGHYFMLNLLKKLPFYEKTW-----------------------FQFI
Y630_PSYWF       ------------------MEKLLKKLPFYDHTW-----------------------FNFL
Y1543_ALCBS      ----------------MENEQPVIPVQARFNSI-----------------------KAFF
Y901_SACD2       --------------MWDIAKVKAS-IKPFVFAL-----------------------GRFF
Y3006_TERTT      --------------MQKLVKTWLKRSKRIRGVL-----------------------LQFS
Y2282_CELJU      ------------MALSTPVTDFKQGFLQQLNWL-----------------------KGFL
Y1578_COXBU      -----------------------MTIYRFFKRS-----------------------AFTL
Y433_COXB2       -----------------------MTIYRFFKRS-----------------------AFTL
Y1765_COXBR      -----------------------MTIYRFFKRS-----------------------AFTL
Y1808_COXB1      -----------------------MTIYRFFKRS-----------------------AFTL
Y409_COXBN       -----------------------MTIYRFFKRS-----------------------AFTL
Y1895_CHRSD      ------------------MRRPQLLDRRWLTII-----------------------LRSL
                                                                             

Y1670_HAEIE      -LFWKRFSENKLNQVAGALTYSTMLAMVPLVMVIFSIFSAFPVFNEVTGELKEMIFTNFA
Y4180_HAEIG      -LFWKRFSENKLNQVAGALTYSTMLAMVPLVMVIFSIFSAFPVFNEVTGELKEMIFTNFA
Y276_HAEIN       -LFWKRFSENKLNQVAGALTYSTMLAMVPLVMVIFSIFSAFPVFNEVTGELKEMIFTNFA
Y384_HAEI8       -LFWKRFSENKLNQVAGALTYSTMLAIVPLVMVIFSIFSAFPVFNEVTGELKEMIFTNFA
Y1616_PASMU      RLFWLRFQQNKLSQAAGYLTYSTMLALVPLVMVVFSVFSAFPVFNEVTDELKGFIFNNFA
Y693_HAES1       KVFLYRFKQNKLNQAAGYLTYSTTLALVPLIMVFFSVFAAFPVFNEITGELKQFIFTNFA
Y1104_HISS2      KVFLYRFKQNKLNQAAGYLTYSTTLALVPLIMVFFSVFAAFPVFNEITGELKQFIFTNFA
Y1801_AGGAN      TIFWQRFNQNKLTQAAGYLTYSTMLAIVPLIMVVFSIFSAFPVFNEVTGALKEFIFTNFA
Y342_ACTSZ       KIFLQRFGQNKLLLEAGALTYSTMLAIVPLIMVIFSIFSAFPIFNDVTGVLKEFIFTNFA
Y032_MANSM       AVFYCRFQQNKLTQAAGALTYSTMLAIVPLVMVVFAIFSAFPMFNEAAAELKTFIFDNFS
Y1950_ACTP2      KLLLKHWKIHNIPVSAGYLTYSTTLAIVPLVMVVFSIFTAFPIFQEATEQLKTLIYDNFA
Y1376_HAEPS      KLFIHRFQQNKIAVYSGYLTYTTLLSLVPLIMVVFSVFTLLPIFEQATAQLKELVYDNFA
Y3482_PSYIN      LFVWRRSEQDNIKVPAGHLAYVTLLSIVPLLAVIFYMLAAFPVFSDLKGMLEDLIYNNLL
YIHY_SHIDS       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_SHIF8       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_SHIB3       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOL5       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOL6       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOHS       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO81       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO8A       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOLU       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO5E       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO57       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO24       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOUT       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOSM       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOSE       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOLI       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECODH       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOBW       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOLC       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO55       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_SHIFL       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECOK1       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO45       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_SHIBS       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_SHISS       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO27       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ECO7I       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_ESCF3       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFL
YIHY_SALA4       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALCH       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALTI       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALDC       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALEP       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALG2       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALHS       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALNS       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALSV       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALTY       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALPB       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
YIHY_SALAR       KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQLRHFIFANFM
Y3126_CITK8      KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSLQLRHFIFANFI
Y4092_ENT38      KLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVIFALFAAFPMFSEVSVQLRHFVFANFM
Y5501_KLEP3      KLLWRRIDEDHMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSEVSVQIRHFIFANFI
Y4136_KLEP7      KLLWRRIDEDHMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSEVSVQIRHFIFANFI
Y4062_CROS8      KLLWVRIDEDHMTTLAGNLAYVSLLSLVPFVAVIFALFAAFPMFSDVSVQLRHFVFANFM
Y028_YERPE       RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y034_YERPG       RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y3877_YERPP      RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y3514_YERPA      RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y254_YERPN       RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y027_YERPS       RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y030_YERP3       RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y028_YERPB       RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFI
Y4186_YERPY      RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFM
Y031_YERE8       RMLYTRIDKDGLTMLAGHLAYVSLLSLVPLVTVIFALFAAFPMFADISIKLKAFIFTNFM
Y4878_SERP5      RLLIKRVDSDGLTMLAGHLAYVSLLSLVPLVTVVFALFAAFPMFSDISVQLKSFIFSNFM
Y100_ALIF1       LFLKQRVIHDRLTVSAGYMAYITLLSLVPLITVLLSVLSQFPVFSGAGETVQAFVIQNFV
Y098_ALIFM       LFLKQRVIHDRLTVSAGYMAYITLLSLVPLITVLLSVLSQFPVFSGAGDTVQAFVIQNFV
Y2938_ALISL      LFLKQRIIHDRLTVSAGYMAYITLLSLVPLVTVLLSVLSQFPIFSGAGETVQEFVIQNFV
Y2742_VIBCH      RYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAGEVIQDFVITHFV
Y3514_VIBC3      RYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAGEVIQDFVITHFV
Y2662_VIBCM      RYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAGEVIQDFVITHFV
Y1626_VIBCJ      RYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAGEVIQDFVITHFV
Y885_VIBVU       RYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSILSKFSVFENVGSVLQSFIINNFV
Y203_VIBVY       RYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSILSKFSVFENVGSVLQSFIINNFV
Y126_VIBA3       RYLLTRMTHDRVNVNAGYLAYITLLSIVPMLTVLLSILSSFSVFADVGLVIQNFVITNFV
Y593_VIBCB       QYLLKRMTHDRVNVNAGYLAYITLLSIVPMLTVLLSILSKFPVFENVGETLQGYIIDNFV
Y125_VIBPA       KYLLKRLTHDRVNVNAGYLAYITLLSIVPMLTVLLSILSKFPVFANVGEVLQGYIIENFV
Y3489_PHOPR      TYLNRRIKHDRLTIAAGSMAYVTLLSLVPMITVVLAALSAFPVFAGLGELLQNFVIENFV
Y315_SHEB5       LHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEGFVYENFL
Y319_SHEB9       LHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEGFVYENFL
Y320_SHEB2       LHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEGFVYENFL
Y314_SHEB8       LHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEGFVYENFL
Y316_SHESM       LHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEAFVYENFL
Y3708_SHESR      LHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEAFVYENFL
Y311_SHESA       LHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEAFVYENFL
Y4401_SHEON      LHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRGQIEAFVYENFL
Y418_SHEPC       QHLRLRLVEDQINIRAGHLAYVTLLSLVPLVAVTMSMLSAFPVFKGIRGQIEAFVYENFL
Y272_SHESW       QHLRLRLVEDQINIRAGHLAYVTLLSLVPLVAVTMSMLSAFPVFKGIRGQIEAFVYENFL
Y4618_SHEWM      IHLKQRLAEDQINIRAGHLAYVSLLSLVPMVAVTMSMLSAFPVFQGIRGQIEDFIYNNFI
Y302_SHESH       IHLKQRLAEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFSGIRGQIEGFIYNNFL
Y3545_SHELP      IHLKQRITEDQINMRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRSHIETFIYENFI
Y3448_SHEDO      LHLKARLIDDQINIRAGHLAYVTLLSLVPMIAVTMSMLSAFPVFKGIRVNIESLVYSYFL
Y331_SHEFN       LHLKQRLAEDQINIRAGHLAYVTLLSLVPMLAVTMSMLSAFPVFKGIRGNIEGFIYNNFI
Y3404_SHEAM      LHLVSRLKEDQINVRAGHLTYVTLLSLVPMVAVTMSVLSAFPVFQGIRGTIETFVYENMI
Y3909_SHEPA      LHLLSRFKEDQVNIKAGHLAYVTLLSLVPIVAVMFSMLSAFPVFSGIREKLEGFVYDNFL
Y4118_AERS4      QFVWSRFQHDRLTVTAGYLAYVTLLSLVPMIAVVFGMMSAFPVFQTLKQAMEQFVYHNFV
Y2447_IDILO      KYFGQRFNSDNTNITAGHLTYVSMLSLVPLLVVMFTVFSAFPMFDELKENLEQALFANLL
Y3526_ALTMD      GIFIKRCKEDNITISAGHLAYVTLLSLVPFIMVTFTIMSAFPAFASVRSKLEHFVFSNFV
Y3954_PSEA6      RMFVNHCQRDGITVSAGHLAYVSLLSLVPFIMVFFTILSAFPAFSEVRGDIEALIFGNFI
Y171_PSET1       MQYINRCIDDQITVNAGYLAYVTLLSLVPLIAVGVAIFSAFPGFESTRLAIESFLFTNFV
Y609_COLP3       FYFTRRVRREQIQVVAGYLSYVCLMSLVPLIVVMLSVMTAFPLFAELQQSIEQFVYQNFV
Y1325_CHLTE      SFMWRHFVHDRVLMSAGSLAFQTLLSLVPLMAVTLSILKVFPVFASLKQYIGDFLFQNFA
Y1343_CHLP8      SFMARHFVHDNILMSAGSLAFQTLLSLVPLMAVSLSILRVFPVFGSLKQNIGDFLFQNFA
Y1013_CHLPB      PFMWKNFMQDRVLLSAGSLAFQTLLSLIPLMAVVLSVLSVSPVFETFKRYVDDFLFQNFV
Y1471_PROA2      AFFSKSFNRDQVLLSAGSLAFQTLLSIVPLMAVILSVLSVSPVFDSFKQYVEEFIFQNFL
Y1653_CHLPD      PFFWKNFIHDKIFLSAGSLAFQSLLSLVPLLSVTLSILRVFPVFESLNRYLEDYVLQNFI
Y1623_PELPB      PFFWKNFIHDRIFLGAGSLAFQTLLSIVPILAVILSILNVFVVFTPFKRSLEDFLVQNFM
Y1323_PELLD      PFFLQNVRHDRIFLSAGSLAFQTLLSIVPLLAVVLSILNVFAVFAPLQPYVEDFIVHNFV
Y1521_CHLL2      PFFLKNLRHDKIFLSAGSLAFQTLLSIVPFLAVTLSVLRIFSFFASLNRYLEEFIFQNFI
Y935_CHLCH       AFFRTNLLHDRIFISAGSLAFQTLLSIVPVLAVVLSVLNLFEVFTPFQHSLETFLVENFM
Y461_TOLAT       AFFWRRVWHDRLPVLAGHLAYVSLLSIVPLLAVVFSVLSWLPRFSYFRRQFELFMFSNFV
Y865_STRMK       RFLWHRFLDDRLFQAAAALAYTTVFALVPLAIVVFGVLSAFPVFDRWSDQLSDYVFSNFV
Y716_STRM5       RFLWHRFLDDRLFQAAAALAYTTVFALVPLAIVVFGVLSAFPVFDRWSDQLSDYVFSNFV
Y937_XANAC       RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV
Y968_XANC5       RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV
Y860_XANCP       RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV
Y3370_XANC8      RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV
Y3490_XANCB      RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV
Y3615_XANOR      RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFTNFV
Y3417_XANOM      RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFTNFV
Y4555_XANOP      RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFTNFV
Y700_NEIMA       WFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIV
Y461_NEIM0       WFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIV
Y524_NEIMB       WFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIV
Y462_NEIMF       WFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIFPVFDRWSDSFVSFVNQTIV
Y810_CHRVO       RFIARRMSCLRVLQISGSLTFTTLLALVPLFTIALSVISAFPVFSDYSTRFKIMLLSTLV
Y2978_LARHH      LFVWRRAMQNRCLQVAASLTFTTLLSLVPLITITLIVVAAFPVFEELSSQFKEFLLRNLV
Y3165_AZOSB      RLLGERFSATRCPQVAGSLAFTTLLALVPLLTVAIGVFGNLPGMDKLGASLKDFLLENLL
Y4060_AROAE      RLLTGRFLATRCPQVAGSLAFTTLLAIVPLLTVIIALFSNFPAFSRLGESLRTFLLENLL
Y4966_DELAS      HTLRERFREDRLGVTASSLTFTTVLALVPFFTVALALFTAFPIFSRVQIVLERWLIDSLI
Y3782_VEREI      QTLRERFRADHLGLTASSLTFTTILALVPFFTVALAVFTAFPIFGQLQDALQGWLVSSLV
Y2991_RHOFT      RTLRERYSEDRLGLTASSLTFTTTMALVPLVTVALAIFTAFPMFAKLQSVLQKWLVTSLI
Y1422_METPP      KTLRQRFREDRLGLTASSLTFTTTIALVPLATVTLAIFSAFPMFGQFQGALEKYFIQSLV
Y2179_JANMA      HFAARRLTEERLPQVAGSLTFTTVLALVPILTIALAIFTTFPLFNTFRTSLEAYFVHNLM
Y3042_BORPD      RFAAQRADEEKLLQVASSLTFTTVLGIVPMLAVVLSLFTAFPVFQDFRLALEDFLANSLM
Y3061_PARXL      QFAAQRSSEDRIPQVAGSLTFTTMLSLVPLATVAFALFTAFPIFASFQMSLQIFLADHLM
Y1559_RALSO      RYALRRAGEDSLPQVAGSLTFTTVLSLVPILTVAFALFTAFPMFQSFRAAIEGYLFSNLV
Y452_NITMU       HYVLVRFFQHNCTQIAGSLTFTTLLSLVPMLAIGLSVIAAFPAFAEFSDRIKEFILTTMV
Y578_RHOCS       HAVPRFWNNNG-FAIAASLTYTTLLALVPLLTVTFAIFSAFPAYGRLRDTARELIFDSLA
Y2625_RHORT      ILVLRALITHDIPRLAASLAYTSLLALVPLIAIALAILAAFPGFGDERERMVAWIIETFV
Y521_ALKEH       LYVAERFRRDACLQNAATLSYTTLLALVPLLTIGLSIFAAFPVFSGLTEQMLDLLFENLV
Y704_HALHL       EYLIQRIQQDQCAKSAGMLAYVTLLAIVPLMTIGFSVLAAFPVFEGVTDRLREAMVDYLV
Y1635_KANKD      KFVFIQFNQKQTSAMAAELTLSNMLALVPLMTVAVSLMAVFPSFEGVNTQVQALIFDNLM
Y2650_LEGPC      RFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFPVFQGLAEPVQNFIFDNFV
Y643_LEGPH       RFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFPVFQGLAEPVQNFIFDNFV
Y3681_AZOVD      RYLFERFLADQGPKSAAALTYTALFAVVPIMTLIFVVLSVVPDFQGIGEQIQGFIFRNFV
Y2988_PSEMY      LSLYQRFIENRGAGNAAALTYTTLFAVVPMMTVTFAMLSAIPAFQGVGEEIQGFIFNNFV
Y2825_PSEU5      RFLVRRFMADQGPQSAAALTYTTLFAVVPMMTVTFAMLSAIPAFKGVGEQIQFYIFNNFI
Y951_PSEAE       RFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMGESIQTFIFRNFV
Y4364_PSEA8      RFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMGESIQTFIFRNFV
Y5196_PSEAB      RFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMGESIQTFIFRNFV
Y4558_PSEA7      RFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMGESIQTFIFRNFV
Y3168_ACIAD      LFVLRRFEADRCREHAGALTYTTLFAVVPMLTVFLVIISSIKALEPARQQLQQLIYSNFL
Y630_PSYWF       RFLIGNFIKDDGQQKAASLTYTTLLSIVPILTVLLMILSSVPALESVREQISNIIYSNLL
Y1543_ALCBS      VLLVRQFNEDGCRQSAAALTYTTLFAIVPVMTVSFVVLSSVPALQGKSAQLQEWAFEYFV
Y901_SACD2       GNLYKEFVEKGCQKSAAALTYMSLFAMVPLMAVFYSMFSMFPAFDGVAQQLQDMIFSHFV
Y3006_TERTT      KELFFEFNERGCQRSAAALTYMTLFALVPLMTVTYTMFSAIPAFDGVGDQLNGLIFHHFL
Y2282_CELJU      YLIVQQYQAKACQKSAASLTYMTLFATVPMMTVTYAMFSIIPAFQHLGDQLQNLIFTHVL
Y1578_COXBU      AYIYRRFHEEGCAYRATALAYTTLLALVPLTIVAFTLLSFVPAFQGVGVRLQNLIWENFV
Y433_COXB2       AYIYRRFHEEGCAYRATALAYTTLLALVPLTIVAFTLLSFVPAFQGVGVRLQNLIWENFV
Y1765_COXBR      AYIYRRFHEEGCAYRATALAYTTLLALVPLTIVAFTLLSFVPAFQGVGVRLQNLIWENFV
Y1808_COXB1      AYIYRRFHEEGCAYRATALAYTTLLALVPLTIVAFTLLSFVPAFQGVGVRLQNLIWENFV
Y409_COXBN       AYIYRRFHEEGCAYRATALAYTTLLALVPLTIVAFTLLSFVPAFQGVGVRLQNLIWENFV
Y1895_CHRSD      RELIQRFDAHDGLKTASALTYTTLFAVVPFMTVLYAMLSAIPSFQGISEQLQALIFSQFV
                                :  ::    :. :*.  :                         . 

Y1670_HAEIE      P-SASDMVGEYIDQFVSNSKKMSAVGIVSLIAVALMLINNIDRTLNSIWHNSQSRSPLSS
Y4180_HAEIG      P-SASDMVGEYIDQFVSNSKKMSAVGIVSLIAVALMLINNIDRTLNSIWHNSQSRSPLSS
Y276_HAEIN       P-SASDMVGEYIDQFVSNSKKMSAVGIVSLIAVALMLINNIDRTLNSIWHNSQSRSPLSS
Y384_HAEI8       P-SASDMVGEYIDQFVSNSKKMSAVGIVSLIAVALMLINNIDRTLNSIWHNSQSRSPLSS
Y1616_PASMU      P-QASDMVGQYIDEFVSNSKQMSAVGVISLVVVALMLINSIDRTLNSIWHDTTIRPLVFS
Y693_HAES1       P-STGDAVGEYIDQFVNNSKQMSAVGIISLIVVALMLIHSIDRTLNSIWLDTSVRPAIFS
Y1104_HISS2      P-STGDAVGEYIDQFVNNSKQMSAVGIISLIVVALMLIHSIDRTLNSIWLDTSVRPAIFS
Y1801_AGGAN      P-SASDVVGQYIDEFVNNSKQMSAVGIISLIVVALMLINSIDRTLNSIWHDTSTRPIFTS
Y342_ACTSZ       P-SASDVVGQYIDQFVQNSKKMSAVGIISLIVVALMLINSIDNSLNGIWRTPK-RGTLFS
Y032_MANSM       P-SAGDTVGQYIDEFVVNSKSMSAVGIISLIAVALLLINQIDRTINDIWNSKN-RNFIFS
Y1950_ACTP2      P-NAGDMVEEYIDLFVANSKKMGIVSTIGLVVVALMLIQSIDETLNKMWRNHRKRSIFIS
Y1376_HAEPS      P-SAGDMVQQYLEMFVDNSKKMGIISIIGLVVVAVMLISSIDNALNEIWHNTKKRSVILS
Y3482_PSYIN      P-TSGDTIQEHISGFIENTKKMSMMGIGSLIAIALLLISTIDQTINRIWRCTNKRSRIQS
YIHY_SHIDS       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_SHIF8       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_SHIB3       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOL5       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOL6       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOHS       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO81       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO8A       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOLU       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO5E       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO57       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO24       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOUT       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOSM       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOSE       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOLI       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECODH       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOBW       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOLC       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO55       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_SHIFL       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECOK1       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO45       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_SHIBS       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_SHISS       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO27       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYS
YIHY_ECO7I       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNAIWRSKRARPKIYS
YIHY_ESCF3       P-ATGDVIQQYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNAIWRSKRVRPKIYS
YIHY_SALA4       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALCH       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALTI       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALDC       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALEP       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALG2       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALHS       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALNS       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALSV       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALTY       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALPB       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
YIHY_SALAR       P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
Y3126_CITK8      P-ATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAIDSALNTIWRSKRTRPKVYS
Y4092_ENT38      P-ATGDVIQRYIEQFVANSSKMTAVGACGLIVTALLLMYAIDSALNTIWRSKKVRPKVYS
Y5501_KLEP3      P-ATGDVIQGYIEQFVANSSRMTAVGAFGLIVTSLLLMYSIDSALNTIWRSTRSRPKVYS
Y4136_KLEP7      P-ATGDVIQGYIEQFVANSSRMTAVGAFGLIVTSLLLMYSIDSALNTIWRSTRSRPKVYS
Y4062_CROS8      P-ATGDIIQRYIEQFVANSSKMTAVGALGLIVTSLLLMYAIDSALNTIWRSTRQRPKVYS
Y028_YERPE       P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y034_YERPG       P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y3877_YERPP      P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y3514_YERPA      P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y254_YERPN       P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y027_YERPS       P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y030_YERP3       P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y028_YERPB       P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y4186_YERPY      P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFS
Y031_YERE8       P-ATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKVHRSLVFS
Y4878_SERP5      P-AAGNVIQSYLEQFVANSNKMTAVGTCGLIVTALLLISSVDSVLNTIWRSKNKRPIVFS
Y100_ALIF1       P-AASDAVEASLKEFISNTGKMTAVGSGFLFVASVMLISSIDRSLNYIWRVKKKRRPMYS
Y098_ALIFM       P-AASDAVEASLKEFISNTGKMTAVGSGFLFVASVMLISSIDRSLNYIWRVKKKRRPMYS
Y2938_ALISL      P-AASDAVEGSLKEFISNTGKMTAVGSGFLFVASVMLISAIDRSLNYIWRVKKKRRPMYS
Y2742_VIBCH      P-AAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQQKRRAVFS
Y3514_VIBC3      P-AAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQQKRRAVFS
Y2662_VIBCM      P-AAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQQKRRAVFS
Y1626_VIBCJ      P-AAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQQKRRAVFS
Y885_VIBVU       P-ASGDAVHAALQEFIANTGKMTAVGAAFLFVAALMLISNIDKNLNYIWRVKKKRRAVFS
Y203_VIBVY       P-ASGDAVHAALQEFIANTGKMTAVGAAFLFVAALMLISNIDKNLNYIWRVKKKRRAVFS
Y126_VIBA3       P-ASGDAVHGALLEFVANTGKMTAVGSVFLFIAALMLISNIDKNLNYIWRVTEKRRAVLS
Y593_VIBCB       P-ASGDAVRTALQEFVSNTGKMTAVGGAFLFVAALMLISNIDKNLNYIWRVKDKRRPVFS
Y125_VIBPA       P-ASGEAVHTALQEFVANTGKMSAVGGGFLFIAALMLISNIDKNLNYIWRVKDKRRLVFS
Y3489_PHOPR      P-AAGEVVKTYLNEFVANAGKMTAVGIGALFVVAMMLMSSIDHALNYIWRVHEKRRPVIS
Y315_SHEB5       P-AAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y319_SHEB9       P-AAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y320_SHEB2       P-AAGDTVQVYINEFVGNASKGTAVGISALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y314_SHEB8       P-AAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y316_SHESM       P-AAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y3708_SHESR      P-AAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y311_SHESA       P-AAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y4401_SHEON      P-AAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y418_SHEPC       P-AAGDTVQIYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y272_SHESW       P-AAGDTVQIYINEFVGNASKGTAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVA
Y4618_SHEWM      P-SAGDSVQVYINEFVDNASKGTAVGIAALMVVAIMLISSIDKSLNSIWHTKEKRSMVIS
Y302_SHESH       P-AAGDTVQVYINEFVSNASKGTAVGIAALMVVAIMLISAIDKALNNIWRTTEKRSMVVS
Y3545_SHELP      P-SAGDSVQMYINEFVANASKGTAVGIGALVVVAILLISNIDKSLNGIWRTTEKRPMVVS
Y3448_SHEDO      P-AAGDSAQVYINEFVNNASKGTFVGIIALLVVAILLISAIDKALNNIWRTTEKRSLVVS
Y331_SHEFN       P-AAGDTVQVHINEFVANASKGTFVGIIALVFVAIMLISAIDKALNNIWRITEKRSYVVS
Y3404_SHEAM      P-AAGDTVQTYINEFVKNASKGTAVGIGFLVVVAIMLISAIDKSLNAIWRTKEKRRFMVA
Y3909_SHEPA      P-AAGDTVQIYINEFVANASKGTSVGIVALMVVALMLISAIDKALNSIWRTKEKRQAAVS
Y4118_AERS4      P-TAGEMLKEYIDGFVANATNTTAVGIGALIVVALMLISAIDKNLNYIWRSTQGRPLAQA
Y2447_IDILO      P-TSGEQLEEYLNEFVTNASKMTAIGVGFLFIVAIMLMSAIDKALNSIWRDSSSRHWLVS
Y3526_ALTMD      P-TASDVVHKYMTDFVGNASQMSAIGILSLLVVALMLISNVDKTLNRIWRTQSDRPIVYT
Y3954_PSEA6      P-TSGDQIQGYVAEFVGNASKMGAIGILSLVVVALLLISNIDKTLNRIWQAKSERPIIFT
Y171_PSET1       P-TSSDVIKEHISSFAGNANQMTAVGIGFLAAIALLLIRNVDATLNRIWRIKKKRPMMIS
Y609_COLP3       P-AAGDVVQQYLTGFVANASKMSAVAISFLFLAALLLISSIDNTFNKIWRVTDKRRTITS
Y1325_CHLTE      P-AQGSILKGYLWEFIDKTSSLSTVGGLFLIVIVLFLISTIDQTLNDIWEVQTPRRRLQG
Y1343_CHLP8      P-AQGALMKTYLWEFIDKTSSLSTVGGIFLIVIALFLISTIDHTLNGIWEVQAPRKVMQG
Y1013_CHLPB      P-ASGSMIREYFWEFIGNTATVPTVGGIFLLIIALFLISTIDHTINQIWDVRAPRKILQG
Y1471_PROA2      P-ASGVEVQEYLWQFISKTSSVPTIGGLSLFIIALFLISTIDHTLNRIWGVDAPRKFFQG
Y1653_CHLPD      P-GTGTMLREYLNAFIDKTSSVPLLGVVFLFIIALSLISTIDHTLNEIWEVYAPRKIVQG
Y1623_PELPB      P-GAGNVLNHYLTDFIGKTASVPILGGVFLFIIALFLISTVDHTLNEIWEVHAPRKALQG
Y1323_PELLD      P-GTGGMIREYFSGFIGNTFTMPIFGALFLFIVALVLISTVDHTLNEIWEVHSPRKVLQG
Y1521_CHLL2      P-SAGEDLRIHFEAFIGKTSTVPLIGGLLLFIIALSLISTIDRTLNDIWKVRAPRKPIQA
Y935_CHLCH       P-ATGRLLHGYLLEFVGKTGNIPLLGSLLLFVIALSLLSTVDQTLNDIWGIRAPRKALQG
Y461_TOLAT       P-ETEIAFRYHFSLFVKNASKTTSIGLLMLVLLALLLIAAIDENMNHIWRCRGQRKWLKT
Y865_STRMK       P-NAARAAEGYLRQFSASAGQLTAAGFIALVVSLLITLNSVEETFNQIWRVGSTRPKLTR
Y716_STRM5       P-NAARAAEGYLRQFSASAGQLTAAGFIALVVSLLITLNSVEETFNQIWRVGSTRPKLTR
Y937_XANAC       P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y968_XANC5       P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y860_XANCP       P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y3370_XANC8      P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y3490_XANCB      P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y3615_XANOR      P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y3417_XANOM      P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y4555_XANOP      P-GAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR
Y700_NEIMA       PQGADMVFD-YINAFREQANRLTAIGSVMLVVTSLMLIRTIDNTFNRIWRVNSQRPWMMQ
Y461_NEIM0       PQGADMVFD-YINAFREQANRLTAIGSVMLVVTSLMLIRTIDNTFNRIWRVNSQRPWMMQ
Y524_NEIMB       PQGADMVFD-YINAFREQANRLTAIGSVMLVVTSLMLIRTIDNTFNRIWRVNSQRPWMMQ
Y462_NEIMF       PQGADMVFD-YINAFREQANRLTAIGSVMLVVTSLMLIRTIDNTFNRIWRVNSQRPWMMQ
Y810_CHRVO       PEFAGKVITVYMRQFADNAEKLTAAGIVMLGVTALMLMSTIERTFNAIWGVRRGRPWLQQ
Y2978_LARHH      PDFAGRIISVYLKQFTDNAGRLTAVGLALLAFTSLSLMLTIDRTFNAIWQVQRPRKLLHN
Y3165_AZOSB      PDRAGRIITTYALQFSQKAARLTLIGTAMLAVTALMLLATIERVFNQIWGVRHRRPLLMR
Y4060_AROAE      PDRAGQIIATYAFQFSQQAAGLTLIGTVLLVLTALMLLMTIDHVFNHIWGVRRPRPLLTR
Y4966_DELAS      PETIARQVLGYLTQFASKASQLGMAGFSILVITAVALILTIDRTLNNIWRVRQLRPLGQR
Y3782_VEREI      PDSIARQVLGYLTQFAAKASGLGLAGFSVLLVTALALILTIDRTLNDIWRVQRLRPLGQR
Y2991_RHOFT      PDNIARQVLGYLTQFAGQASKLGGAGIALLLVTAVALILTIDHTLNGIWRVRTRRSLGQR
Y1422_METPP      PDGIAKPVLGALTQFAGKAHRLGTVGLVVLVLTALALMLTIDRTLNAIWRVRKPRPIAQR
Y2179_JANMA      PKGIANTILGYLTQFSSKATRLSAFGAVALIVTAVAMMLMIDRVFNQIWRVKTKRPIVQR
Y3042_BORPD      PPAVSDNIMDYLNQFAYQASRLTAIGGAFLVVTSLLLIMTIDKTFNDIWHVTRQRPLPQR
Y3061_PARXL      PAQLNSQIFNYLNQFASKAKGLTTIGMIFLFVTAVMTMMTVESAFNVIWRVRKARPIAQR
Y1559_RALSO      PGNISRPILTYLNQFSHNAKGLTAAGLVGLVVTSVMTMLTVENALNAIWRVRQRRPLAQR
Y452_NITMU       PEAANKVISVYMQQFADNAAKLTAIGIAFLGVTALALMLTIDEALNSIWRVSRLRPLLHR
Y578_RHOCS       P-SVSDEVQAYFDQFISNAAALTGFGVIGLSLTSILLFFSVEAALNVIFRATEPRPLVIR
Y2625_RHORT      P-YRRTEILDQVEHFVGAAAGLTALGVAGLTLTAIILLLTIESSLNAIFRVEKSRHPLAR
Y521_ALKEH       P-ASTAVVQQHLEDFVGRAAGLTVVGLLALMVSALLMMAAIDRAMNDIWRVQQRRRPLHG
Y704_HALHL       P-AASDAIDEHLENFMGRAAELTAVGIAGLTVTALLLLNTIERVLNEIWRVERPRPTLQR
Y1635_KANKD      P-ETGLAVQEHLNEYVSKSKNLSAIGLGFLIVTSLLLMRSIDRSINALWETPTQRKGIHK
Y2650_LEGPC      P-ATGKIVQSYLQQFTSQVSKLSIWGVVFLIFTALLVMFTIERAMNKIWRVSSSRHGVSA
Y643_LEGPH       P-ATGKIVQSYLQQFTSQVSKLSIWGIVFLIFTALLVMFTIERAMNKIWRVSSSRHGVSA
Y3681_AZOVD      P-SSGAVLQDYLRTFIEQARHLTWLGVGVLMVTALLMLMTVEHTFNTIWRVRRPRRGLSS
Y2988_PSEMY      P-STGETVQEYLREFTAQARQLTWFGVGLLAVTAFLMLVTIEKTFNVIWRVRQPRRGMSS
Y2825_PSEU5      P-STGATIQEYLLAFTSQARQLTWFGVGFLMATALMMLLTIEKAFNTIWRVRQPRRGVSS
Y951_PSEAE       P-SAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIWRVRQPRRGVGR
Y4364_PSEA8      P-SAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIWRVRQPRRGVGR
Y5196_PSEAB      P-SAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIWRVRQPRRGVGR
Y4558_PSEA7      P-SAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIWRVRQPRRGVGR
Y3168_ACIAD      P-KSTIAFDRVLNSFTEKSSNLTVIGILFLFVTTVMMLSTIETAFNRIWRVKETRSGIIG
Y630_PSYWF       P-QSGLQVSEYINNFAEKSSNLTAIGALALFVTTIMTLTTIERAFNQIWRVEDRSGGIKS
Y1543_ALCBS      P-SAGNMLLDHLQSFAKQATNLTVLGIVFLVVTSVLMLSTVEQTLNRIWKVQTPRKGLVS
Y901_SACD2       P-ETGSEVQQYLANFSQQARNLSAAGAGLLVVTAYLMLTNIEKTFNAIWGVKAARRGITS
Y3006_TERTT      P-ETGEEVSQYLSDFSSQARRLSGVGVVMLLVTAYLMLRNIETTFNSIWGVKQARSGLSG
Y2282_CELJU      P-NNEQDISRYLKNFSAQARQLTWLGGVFLVVSAYLMLKNIEKNFNAIWGVAQGRRGIAN
Y1578_COXBU      P-TSAGMVAAYLSQLTQNVTGLSIINIFFLGIVALLLMYNINRAFVAIWHTEHHFRLSLH
Y433_COXB2       P-TSAGMVAAYLSQLTQNVTGLSIINIFFLGIVALLLMYNINRAFVAIWHTEHHFRLSLH
Y1765_COXBR      P-TSAGMVAAYLSQLTQNVTGLSIINIFFLGIVALLLMYNINRAFVAIWHTEHHFRLSLH
Y1808_COXB1      P-TSAGMVAAYLSQLTQNVTGLSIINIFFLGIVALLLMYNINRAFVAIWHTEHHFRLSLH
Y409_COXBN       P-TSAGMVAAYLSQLTQNVTGLSIINIFFLGIVALLLMYNINRAFVAIWHTEHHFRLSLH
Y1895_CHRSD      P-ATGSALVEHLRDFSRQARSLTLIGLMFLLVTAVMMMVTVERAFNNIWHVSRSRRGVSS
                 *                            *       :  ::  :  ::           

Y1670_HAEIE      FAIYWMILTLGPLIIGVSIGISSYIKIM----FEQSEHLSLGLKLLSFVPFLFTWFIFTL
Y4180_HAEIG      FAIYWMILTLGPLIIGVSIGISSYIKIM----FEQSEHLSLGLKLLSFVPFLFTWFIFTL
Y276_HAEIN       FAIYWMILTLGPLIIGVSIGISSYIKIM----FEQSEHLSLGLKLLSFVPFLFTWFIFTL
Y384_HAEI8       FAIYWMILTLGPLIIGVSIGISSYIKIM----FEQSEHLSLGLKLLSFVPFLFTWFIFTL
Y1616_PASMU      FAIYWLILTLGPLLIGASIGVSSYIAAM----LNENISLPFGLKILSFVPFFLTWLIFTL
Y693_HAES1       FAIYWLILTLGPIVIATSIGISTYVTKFATYTFEQDFGLSVGIKLLSLMPFFLTWFIFTV
Y1104_HISS2      FAIYWLILTLGPIVIATSIGISTYVTKFATYTFEQDLGLSVGIKLLSLMPFFLTWFIFTV
Y1801_AGGAN      FAIYWLILTLGPLLVGTSIAASAYVKTM----FENASGFSFGLKLLSFVPFLSTWFIFTV
Y342_ACTSZ       FAVYWTILTLGPIIMGVSIAISTYVTNLS--LFRGELNLPFGIKLLGFVPFILTWLSFTL
Y032_MANSM       MTIYWTLLTLGPIFIGMSFAINTYIRSII--AFEGDLGLPFGLKLLSFVPFLLTWLSFSL
Y1950_ACTP2      FLLYAVILFIAPLLAGGSIAISSYIFSMA--IFNENGLLSFSQQLLQYTPFLLIWLLFTT
Y1376_HAEPS      FVVYLAVLIFAPIFAGASIAISSYIFSLE--MFSQDGLFSFSHHLLKFIPFVLTWLLFAL
Y3482_PSYIN      FTIYWTILSLGPVIIGASLALSSYLFSV----FQEHGSLSFGQRLLSLMPFILTWLTFAG
YIHY_SHIDS       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_SHIF8       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_SHIB3       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOL5       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOL6       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOHS       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO81       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO8A       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOLU       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO5E       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO57       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO24       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOUT       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOSM       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOSE       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOLI       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECODH       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOBW       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOLC       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO55       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_SHIFL       FAVYWMILTLGPLLAGASLAISSYLLPLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECOK1       FAVYWMILTLGPLLAGASLAISAYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO45       FAVYWMILTLGPLLAGASLAISAYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_SHIBS       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_SHISS       FAVYWMILTLGPLLAGASLAISSYLFSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO27       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ECO7I       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_ESCF3       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRIFPLLLSWISFWL
YIHY_SALA4       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALCH       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALTI       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALDC       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALEP       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALG2       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALHS       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALNS       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALSV       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALTY       FAVYWMILTLGPLLAGVSLAISSYLLSLR--WASD--LNTVIDNVLHILPLLLSWISFWL
YIHY_SALPB       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRILPLLLSWISFWL
YIHY_SALAR       FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LNTVIDNVLRVLPLLLSWISFWL
Y3126_CITK8      FAVYWMILTLGPLLAGASLAISSYLLSLR--WASE--LNTVIDNVLRVFPLILSWISFWL
Y4092_ENT38      FAVYWMILTLGPLLAGASLAISSYLLSLR--WASE--LNTVIDNVLRIFPLILSWLAFWL
Y5501_KLEP3      FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LDGVIDNLLRLFPLILSWAAFWL
Y4136_KLEP7      FAVYWMILTLGPLLAGASLAISSYLLSLR--WASD--LDGVIDNLLRLFPLILSWAAFWL
Y4062_CROS8      FAVYWMILTLGPLLAGASLVISSYLLSLR--WASG--FNTMIDDVLRIFPLLLSWLSFWL
Y028_YERPE       FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y034_YERPG       FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y3877_YERPP      FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y3514_YERPA      FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y254_YERPN       FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y027_YERPS       FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y030_YERP3       FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y028_YERPB       FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y4186_YERPY      FAVYWMVLTLGPILVGASMVISSYLLSLH--WLAHARVDSMIDEILRVFPLLISWVSFWL
Y031_YERE8       FAVYWMVLTLGPILVGASMVISSYLLSLQ--WLANARVDSMIDETLRLFPLLISWVSFWL
Y4878_SERP5      FAVYWMVLTLGPLLVGASMAISSYLLSLN--WLAQSGVNSLVDQVLRIFPLILSWISFWL
Y100_ALIF1       FSLYWMILTLGPLLVGASLAATSYVTSLK--IMDDEIVSSFYRTLLGWLPIILSFSAFVG
Y098_ALIFM       FSLYWMILTLGPLLVGASLAATSYVTSLK--IMDDEIVSSFYRTLLGWLPIILSFSAFVG
Y2938_ALISL      FSLYWMILTLGPLLVWASLAATSYVTSLN--IMDDEIVSSFYRTLLGWLPIILSFSAFLG
Y2742_VIBCH      FSMYWMILTLGPILVGASIAATSYITSLK--ILDNEALSGVYNLFLRWLPFVLSYCAFVG
Y3514_VIBC3      FSMYWMILTLGPILVGASIAATSYITSLK--ILDNEALSGVYNLFLRWLPFVLSYCAFVG
Y2662_VIBCM      FSMYWMILTLGPILVGASIAATSYITSLK--ILDNEALSGVYNLFLRWLPFVLSYCAFVG
Y1626_VIBCJ      FSMYWMILTLGPILVGASIAATSYITSLK--ILDNEALSGVYNLFLRWLPFVLSYCAFVG
Y885_VIBVU       FSMYWMVLTLGPILVGASIAATSYITSLR--LLDSEAISTVYDQLLRWLPFILSSSAFVG
Y203_VIBVY       FSMYWMVLTLGPILVGASIAATSYITSLR--LLDSEAISTVYDQLLRWLPFILSSSAFVG
Y126_VIBA3       FSMYWMVLTLGPILIGASIAATSYVTSLN--LLQNEVVSSAFNTVIRKLPLITSFFAFFG
Y593_VIBCB       FSMYWMVLTLGPILVGASIAVTSYVTSLK--LIENETLTGAYNLFLRWLPLLLSFFAFMG
Y125_VIBPA       FSMYWMVLTLGPILVGASIAATSYVTSLQ--ILENETLSGAFNLFLRWLPLLLSFFAFLG
Y3489_PHOPR      FSIYWMVLTLGPILVGSSIAVSSYLGSLN--LLNSEAVNGLFQQTLRALPVIMSSSAFLG
Y315_SHEB5       FSMYWMVLTLGPVLVGASLVASSYVISLK--VFEAEALSGMLPIFIARLPMLFSVAAFLL
Y319_SHEB9       FSMYWMVLTLGPVLVGASLVASSYVISLK--VFEAEALSGMLPIFIARLPMLFSVAAFLL
Y320_SHEB2       FSMYWMVLTLGPVLVGASLVASSYVISLK--VFEAEALSGMLPIFIARLPMLFSVAAFLL
Y314_SHEB8       FSMYWMVLTLGPVLVGASLVASSYVISLK--VFEAEALSGMLPIFIARLPMLFSVAAFLL
Y316_SHESM       FSMYWMVITLGPVLVGASLVATSYVVSLK--LFEGDALSGVMPLFIERLPLFFSVAAFLL
Y3708_SHESR      FSMYWMVITLGPVLVGASLVATSYVVSLK--LFEGDALSGVMPLFIERLPMLFSVAAFLL
Y311_SHESA       FSMYWMVITLGPVLVGASLVATSYVVSLK--LFEGDALSGVMPLFIERLPMLFSVAAFLL
Y4401_SHEON      FSMYWMVITLGPVLVGASLVATSYVVSLK--LFEGDALSGMMPLFIERLPLLFSVAAFLL
Y418_SHEPC       FSMYWMVITLGPVLVGASLVATSYVVSLK--LFEDDTFSGVVPLFIERLPMLFSVAAFLL
Y272_SHESW       FSMYWMVITLGPVLVGASLVATSYVVSLK--LFEDDTFSGVVPLFIERLPMLFSVAAFLL
Y4618_SHEWM      FSMYWMVLTLGPVLMGASLVATSYVVSLK--VFNGSDLSGVVPLLVERLPMLFSVATFLL
Y302_SHESH       FSMYWMVLTLGPVLMGASLVATSYVVSLK--VFNGSDLSGVVPVLVERLPMFFSVATFLL
Y3545_SHELP      FSMYWMVLTLGPVLMGASLVATSYVVSLK--LFSGTDLSGVVPLLVERLPMFFSVATFLL
Y3448_SHEDO      FSMYWMVLTLGPVLMGSSLVATSYVVSLE--LFSQSELSGLLPWLVERLPMLFSVASILL
Y331_SHEFN       FSMYWMVLTLGPVLIGASLVATSYVVSLE--VVAGTELSGLVPWIVERLPLIFSAASILL
Y3404_SHEAM      FSMYWMVLTLGPVLMGASIAVTSYLVSLK--VLSEADVYGVVPMLIEKLPLMFSVAAFLL
Y3909_SHEPA      FSMYWMVLTLGPVLVGASLVATSYIVSLK--LFSETELSGVVPILIERLPMLFSVAAFLL
Y4118_AERS4      FAMYWMILTLGPVLIGGSIAISSYIFSLR--LFGAESLFGIGYLLLRSLPFLFSVLTFLL
Y2447_IDILO      FAVYWMLLTLGPVLIGSGLAATSYLMSLS--QFADEYVSGIQSFVLWFVPIVTSFVFFVL
Y3526_ALTMD      FAIYWMVITLGPMLIGSSVVVSSYLTGLA--AFTEEYTPGLGTFLLSLVPSGAALLAFAI
Y3954_PSEA6      FAIYWMILTLGPLLIGLSVIMSSYLVAFA--NSAEAYTMGATTAMLKIVPFIASVCAFFI
Y171_PSET1       FAVYWMVLSLGPVFLGGSIAVTSYIVSLV--SFADQGIPGFSGFLLKLLPYGISMVGFIM
Y609_COLP3       FAMYWMVLTLGPILVGASIALSSYLVSIV--AVDEYDVLGLSDMFLRMLPLLSSIIAFII
Y1325_CHLTE      FTLYWTVLTLGPVFIGTSVLASSYVWYSVFA-EGA--LLEMKARVLSYVPVLNSVIAFFL
Y1343_CHLP8      FTLYWTVLTLGPLLIGTSVVASSYVWYSVFA-GGE--LLQQKVTVLSYLPLINTAIALFL
Y1013_CHLPB      FTLYWTVLTLGPIIIGSGLVASSYVWYTVFT-EGP--FLELRTRILSYLPLVNSFLAFFL
Y1471_PROA2      FTLYWTVLTLGPIFIGSSLVATSYVWYNFFT-QGA--LADVQAKTLLLLPVMNTFLAFFL
Y1653_CHLPD      FTLYWTVLTLGPVLIGSSLVASSFVWYTVFT-EGP--LLELKTRLLSFLPFLNSVIAFFL
Y1623_PELPB      FTLYWTVLTLGPVLIGSSLAASSYVWYMVFT-DGP--LLELKTRLLSFFPFINSVAAFFL
Y1323_PELLD      FTLYWTVLTLGPVLLATSLAASSFVWYTVFT-EGP--LLELKTRLLSLLPSTITVLALLL
Y1521_CHLL2      FTLYWTVLTLGPVLIGSSLGASSYVWYTVFT-EGP--LLELKIRLISFLPFVNSLLSFLL
Y935_CHLCH       FTLYWTVLTLGPLLIVSSLAASSYVWYTIFTDEGA--LFELKTRLLALFPFINSIVAFFL
Y461_TOLAT       ITMYSIVLGVVPLLVGGSLLLSSQIQGWALWHYEL--VSSLGGGLLELLPYLLSLGGILL
Y865_STRMK       FLVYWTVLTLGAMLAAASLAVSARVFAMPLFGTQE--GRWLAELALRLAPILIEFVCITL
Y716_STRM5       FLVYWTVLTLGAMLAAASLAVSARVFAMPLFGTQE--GRWLADLALRLAPILIEFVCITL
Y937_XANAC       FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFVCIVL
Y968_XANC5       FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFVCIVL
Y860_XANCP       FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFVCIVL
Y3370_XANC8      FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFVCIVL
Y3490_XANCB      FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFVCIVL
Y3615_XANOR      FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFICIVL
Y3417_XANOM      FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFICIVL
Y4555_XANOP      FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTE--GQWLAEFAWRLAPMAVEFICIVL
Y700_NEIMA       FLVYWALLTFGPLSLGVGISFMVGSVQDA-ALASG--APQWSGALRTAATLTFMTLLLWG
Y461_NEIM0       FLVYWALLTFGPLSLGVGISFMVGSVQDA-ALASG--APQWSGALRTAATLTFMTLLLWG
Y524_NEIMB       FLVYWALLTFGPLSLGVGISFMVGSVQDA-ALASG--APQWSGALRTAATLTFMTLLLWG
Y462_NEIMF       FLVYWALLTFGPLSLGVGISFMVGSVQDA-ALASG--APQWSGALRTAATLTFMTLLLWG
Y810_CHRVO       SMVYWTVLTLGPLVLGGSLLSWRWLFKAT-RLEKN--LPLLASVLEAGGTIVLTALVLAL
Y2978_LARHH      MLVYWTVLTLGPLLLGVGISGSAWILNWS-GLART--APGLAGIIQNLGSLTLATVMLTV
Y3165_AZOSB      ITVSWFMLTLGPVILGGSVVATGYLVSTSAEWSDR--LPWIGEIAAATLPPLLLGALFSF
Y4060_AROAE      LMVHWFALTLGPLALGGSVLATGHLVATSIALAGE--GSWVGATFARLVPTVLLGSLFSV
Y4966_DELAS      VLIYWAAITLGPLVLGLSLVLSSYVMSASRGLVN--ALPEGLRFIFDSIEYLALAAGMAG
Y3782_VEREI      VLIYWAAITLGPLLLGASLALTSYVMSASGGLVK--RLPDGVRFLFDSLQFMVLAAGMAL
Y2991_RHOFT      VLVYWAALTLGPLVLGVSLSITSYAISASKGVVG--VMPGGVQFLLDVLQFFMVAWGMAA
Y1422_METPP      VLVYWAAATLGPLLLGVSLTLTSYAISASRGVVG--AMPGSLSVLLNALEFGLLAAAMAG
Y2179_JANMA      ILVYWAIVTLGPLLIGASMTFTSYLFTATDGVVR--GVPFVGAVFYTSISILLSMVAFTS
Y3042_BORPD      ALVYWAVVTLGPVVAGASLWATSFLARESLGLVR--DVPEIVSLAISFLPLILTGLGFAA
Y3061_PARXL      ILVYWAIITLGPILIGVSLSISSYLFTQSMTFTAAQRMTPVIEWALAGAALPLTAAAFTI
Y1559_RALSO      VLVFWALVSFGPVLIGASLSVSSYLVSVSAGYVA--KLPYGLGVVVGLVPILLSAIAFAM
Y452_NITMU       LLIYWSVLTIGPLLIGASLSLTSWLMTASRGFTRD--IPGGDIMLLRLSPLVLTSIAFSA
Y578_RHOCS       LLSFWAVLTIMPLLLGASLSVTSGVVADLQATGRD-AVTVLRFMLPGL----LEAAAFTL
Y2625_RHORT      LLVYWSVLTGGPLLMGLSFSLSSYLVAIRHLVGTD-VMSPFDALTPTLGPPLLSLTAMTL
Y521_ALKEH       FMVYWTVLTLAPILMGASLGISSYVISVTRFGELE-ALSGLQGLLLAGMPFVAETVAFTF
Y704_HALHL       FMVYWTVLTMGPLLLGVSVASTSYMGTVN-LGPLE-PPSDLIAQLLNLAPFVVQAIVFSL
Y1635_KANKD      ILAYWAMLTMAPILIAASLAASSYFATLP-------IVSDLSGILTFGLPFILIVLAFSA
Y2650_LEGPC      FLLYWAIISLAPVLLGLSLAASSYLFSMP-----ILADHRAPYTILHYSPFFLSLIGFTF
Y643_LEGPH       FLLYWAIISLAPVLLGLSLAASSYLFSMP-----ILADHRAPYTILHYSPFFLSLIGFTF
Y3681_AZOVD      FLLHWAILSLGPLLLGTGFALSTYITSLSLVSDPYA--LAGARMLLKVMPLLFSTAAFTL
Y2988_PSEMY      FLLYWAILSLGPLLLGAGFAVSTYIASLSLISGPDA--VVGAKTLLAFTPLLSSIAAFTL
Y2825_PSEU5      FLLYWAILSLGPLLLGAGFATSTYIASLSLISGPYA--LIGVGTLIKVMPLLLSVAAFTL
Y951_PSEAE       FLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDA--LPGAETLLGLMPLAFSVAAFTL
Y4364_PSEA8      FLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDA--LPGAETLLGLMPLAFSVAAFTL
Y5196_PSEAB      FLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDA--LPGAETLLGLMPLAFSVAAFTL
Y4558_PSEA7      FLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDA--LPGAETLLGLMPLAFSVAAFTL
Y3168_ACIAD      FMRYWTIISLGPIILGSAFVISSTVASMNILSNNFAGYELSGAFILWLISFGLTILGFFI
Y630_PSYWF       IVRYWTIITLGPLVLGTAFLVSSAVQSLSFLNQQVAGYGIDWGFWVQVVSFAVTIAGFIG
Y1543_ALCBS      LLMYWALLSLGPICLGLGLAITSYLTSQAIFSDTVS-YLGGVRLWLAVLPFLFTTAMLTL
Y901_SACD2       FLLYWAVLTIGPLLLGAGLAMSTYLLSLKIIVNEYD-AIGVTNLFFSYLPLFTTSAAFTL
Y3006_TERTT      YLLYWAILSVGPILVAAAFLLSTYLLSVQIMLEDLD-GLGVMQLVYRVVPWALTSAAFTL
Y2282_CELJU      FLLYWAILSLGPLLLGVALAMSTYLTSFRLLVGSYD-SLGVLELVFQYVPWLLNWAAFTL
Y1578_COXBU      FLIYFMVLLLSPFLLGAVMLLGTFLVQSPLVTDLIG-WPYLGKGLLFVLPYVLIFITFTL
Y433_COXB2       FLIYFMVLLLSPFLLGAVMLLGTFLVQSPLVTDLIG-WPYLGKGLLFVLPYVLIFITFTL
Y1765_COXBR      FLIYFMVLLLSPFLLGAVMLLGTFLVQSPLVTDLIG-WPYLGKGLLFVLPYVLIFITFTL
Y1808_COXB1      FLIYFMVLLLSPFLLGAVMLLGTFLVQSPLVTDLIG-WPYLGKGLLFVLPYVLIFITFTL
Y409_COXBN       FLIYFMVLLLSPFLLGAVMLLGTFLVQSPLVTDLIG-WPYLGKGLLFVLPYVLIFITFTL
Y1895_CHRSD      FLLYWAVLTLGPLLLGSGFLLSSYLASLTLVRGAAE-VLGGPVAFLRLLPLTLSFTAFVF
                            ..     .                                      :  

Y1670_HAEIE      IYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAFTWYIVTFPSYQLIYGAMATLPIMLLWI
Y4180_HAEIG      IYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAFTWYIVTFPSYQLIYGAMATLPIMLLWI
Y276_HAEIN       IYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAFTWYIVTFPSYQLIYGAMATLPIMLLWI
Y384_HAEI8       IYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAFTWYVVTFPSYQLIYGAMATLPIMLLWI
Y1616_PASMU      IYTVVPNKKVKIMHSAIGALVAAVFFTLGKQAFLWYVTTFPSYQLIYGAMATLPIMLLWI
Y693_HAES1       LYMVVPNKKVSIIHSAAGALIAAVFFTLGKQAFTWYITTFPSYQLIYGAMATLPIMLLWI
Y1104_HISS2      LYMVVPNKKVSIIHSAAGALIAAVFFTLGKQAFTWYITTFPSYQLIYGAMATLPIMLLWI
Y1801_AGGAN      IYMVVPNKKVSIKHSAAGALIAAVFFTLGKQAFAWYIVTFPSYQLIYGAMATLPIMLLWI
Y342_ACTSZ       IYAIVPNKKINIKHAAAGALVAAVFFTLGKKAFMWYITTFPSYQLIYGAMATLPLMLLWL
Y032_MANSM       IYTLVPNTKVNFRYAAVGALVAAIFFTLGKKAFAWYMATFPSYQLIYGAMATLPITLLWI
Y1950_ACTP2      VYWLVPNTKVNILHAMLGAIVAAIFFTLGKQAFVWYISTFPSYQAIYGALAVLPIMLLWI
Y1376_HAEPS      VYLIVPNTQVKFRHAAVGALFAGVFFTLGKQIFIWYITTFPSYQAIYGALATIPIMIVWI
Y3482_PSYIN      VYTLVPHQRVSFRYALIGGLIAAILFFFGTDLFRLYITNFPSQQIIYGALAVIPILFVWI
YIHY_SHIDS       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SHIF8       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SHIB3       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOL5       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOL6       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOHS       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO81       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO8A       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOLU       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO5E       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO57       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO24       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOUT       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOSM       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOSE       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOLI       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECODH       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOBW       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOLC       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO55       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SHIFL       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECOK1       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO45       LYSIVPTIRVPNRDAIVGAFVAALLFEAEKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SHIBS       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SHISS       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO27       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ECO7I       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_ESCF3       LYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALA4       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALCH       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALTI       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALDC       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALEP       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALG2       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALHS       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALNS       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALSV       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALTY       LYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALPB       LYSIVPTTRVPNRDALVGAFVAALLFESGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
YIHY_SALAR       LYSIVPTTRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
Y3126_CITK8      LYSIVPTTRVPNRDAVVGAFVAAVLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWV
Y4092_ENT38      LYSIVPTLRVPNRDAIVGALVAAILFELGKKGFALYITTFPSYQLIYGVLAVVPILFVWV
Y5501_KLEP3      LYSIVPTTQVRNRDAVIGALVAALLFEAGKKAFALYITTFPSYQLIYGVISVVPILFVWV
Y4136_KLEP7      LYSIVPTTQVRNRDAVIGALVAALLFEAGKKAFALYITTFPSYQLIYGVISVVPILFVWV
Y4062_CROS8      LYSVVPTTRVPARDALIGSLVAALLFELGKKGFALYITMFPSYQLIYGVLAVIPILFLWV
Y028_YERPE       LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y034_YERPG       LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y3877_YERPP      LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y3514_YERPA      LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y254_YERPN       LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y027_YERPS       LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y030_YERP3       LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y028_YERPB       LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y4186_YERPY      LYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWV
Y031_YERE8       LYSVVPTVRVPAQDALIGALVAALFFELGKKGFTMYITLFPSYQLIYGVLAVIPILFLWV
Y4878_SERP5      LYCIVPTVRVPPKDALIGALVAGVLFELGKKGFALYITMFPSYQLIYGVLAVIPILFLWV
Y100_ALIF1       LYLLVPNKKVRVTHALIGAMSAGCLFEFSKVGFAQYITQFPSYQVIYGALAAVPILFVWV
Y098_ALIFM       LYLLVPNKKVRVTHALIGAMSAGCLFEFSKVGFAQYITQFPSYQVIYGALAAVPILFVWV
Y2938_ALISL      LYLLVPNKKIRVRHALVGAMSAGCLFEVSKVGFAQYITQFPSYEVIYGALAAVPILFVWI
Y2742_VIBCH      LYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWV
Y3514_VIBC3      LYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWV
Y2662_VIBCM      LYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWV
Y1626_VIBCJ      LYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWV
Y885_VIBVU       LYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWV
Y203_VIBVY       LYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWV
Y126_VIBA3       LYLLVPNKKIHFSHAAAGSLVAALLFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWV
Y593_VIBCB       LYFLVPNKKVYLSHGAIGAAIAAVLFELSKKGFAFYITQFPSYQLIYGALAAIPILFVWV
Y125_VIBPA       LYILVPNKKVHLAHGAVGAAVAAILFELSKKGFALYITQFPSYQLIYGALAAIPILFVWV
Y3489_PHOPR      LYLLVPNLKVKFSHALLGALVASSLFELSKKGFALYISNFPSYQVIYGALAVIPILFVWV
Y315_SHEB5       LYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPSYEAIYGALATIPIVFVWV
Y319_SHEB9       LYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPSYEAIYGALATIPIVFVWV
Y320_SHEB2       LYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPSYEAIYGALATIPIVFVWV
Y314_SHEB8       LYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPSYEAIYGALATIPIVFVWV
Y316_SHESM       LYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPSYEAIYGALATIPILFVWV
Y3708_SHESR      LYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPSYEAIYGALATIPILFVWV
Y311_SHESA       LYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPSYEAIYGALATIPILFVWV
Y4401_SHEON      LYMVVPNQKVKFWHALLGAVVAALLFELGKKGFAFYVTKFPSYEAIYGALATIPILFVWV
Y418_SHEPC       LYMVVPNQKVKFLHALLGALVAALLFELGKKAFALYVTQFPSYEAIYGALATIPILFVWV
Y272_SHESW       LYMVVPNQKVKFLHALLGALVAALLFELGKKAFALYVTQFPSYEAIYGALATIPILFVWV
Y4618_SHEWM      IYMVVPNTKVKFFHALLGAIVAALMFEFGKKGFALYLTKFPTYEAIYGALATIPILFLWV
Y302_SHESH       IYMVVPNIKVKFFHALLGAIVAALLFEFGKKGFAIYLTKFPTYEAIYGALATIPILFMWV
Y3545_SHELP      IYMVVPNTKVKFFHALLGAIVAALLFELGKKGFALYLTEFPAYEAIYGALATIPILFMWV
Y3448_SHEDO      LYMVVPTQKVRFFHALLGAVVAALLFEAGKRAFAYYVTQFPSYEAIYGALATIPILFVWV
Y331_SHEFN       LYMVVPNKKVHFLHALLGAIVAAVLFEAGKKGFAFYVTQFPSYEAIYGALAVVPILFVWV
Y3404_SHEAM      LYMAVPNQKVKFLHALLGALVAALLFEAGKRGFALYVTTFPSYEAIYGTLATIPILFVWV
Y3909_SHEPA      LYMVVPIKKVKFLHALLGALVAAMLFELGKKGFAFYVTQFPSYEAIYGALATIPILFVWV
Y4118_AERS4      VYTVVPNCKVRLVHAFIGALVAATLFELAKRGFAIYITNFPSYQAIYGALATIPVLFVWV
Y2447_IDILO      MYQLVPNRQVKFRYAAFGAVIAALLFELSKQLFSLYITFFPTYQAIYGALATIPILIVWI
Y3526_ALTMD      LYMVVPNRRVYARHAFVGAIVATIAFEITKSGFALYVTNFPSYELIYGALAVVPILFLWV
Y3954_PSEA6      LYMIVPNKRINPRHALVGAFMGALLFELSKKGFSFYITHFPSYQMIYGAMAVIPILFVWV
Y171_PSET1       LYTLVPNTRVSFKAAIPGALFAAMLFELTKKGFALYISHFPSYEVIYGAVATIPILFVWI
Y609_COLP3       LYIAVPNKAVPFRFALSGAIVAGVLFELAKKAFALYITAFPSYQVIYGALATIPIIFLWV
Y1325_CHLTE      LYMLVPNRKVRFTHALAGGVLAAVLFELAKRWFTFYVSSFATFEHIYGALSVVPMLFFWI
Y1343_CHLP8      LYMVVPNRKVRFRHALAGGVLAALLFELAKRWFAFYVANFATFEAIYGALSVVPMLFFWI
Y1013_CHLPB      LYMLVPNHRVRFLHAVSGAFLATWLFELSKQWFSFYVKTFATFEHIYGALSVIPLLFFWI
Y1471_PROA2      LYILVPNRKVKFVHAFSGAILATLLFEFSKRWFAFYVSHVATFEHIYGALSVIPLLFFWI
Y1653_CHLPD      LYMLVPNRRVRFYHAVYGSLLAAVLFELSKKWFVFYVSHFATFEYIYGALSVIPMLFFWI
Y1623_PELPB      LYMLVPNRRVRFVHAFSGALLAALLFELSKRWFTFYITHIATFEHIYGALSVIPMLFFWV
Y1323_PELLD      LYLLVPNRRVRFLHALSGALVATLLFEVSKRWFAFYVANVATFEHIYGALSVIPMLFFWI
Y1521_CHLL2      LYMLVPNRRVKLPHAFSGAVAAALLFELSKKWFVFYVSRFATFEHIYGAISAVPLLFFWI
Y935_CHLCH       LYMLVPKRRVRIAHAFAGALVASLLLELSKRWFLFYVTHVATFEHIYGALSVVPMLFFWV
Y461_TOLAT       LYKVVPNIYVRWQHALLGATLAALLFEVAKEGFGYYIAHFGTYKSIYGALAGIPILMIWL
Y865_STRMK       MFRVVPHHTVKWRHAVPGAILAAVILELVKWGIGAYLGSFQSYQKLYGTVAFVPILLLWI
Y716_STRM5       MFRVVPHHTVKWRHAVPGAILAAVILELVKWGIGAYLGSFQSYQKLYGTVAFVPILLLWI
Y937_XANAC       IYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPILLLWI
Y968_XANC5       IYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPILLLWI
Y860_XANCP       IYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPILLLWI
Y3370_XANC8      IYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPILLLWI
Y3490_XANCB      IYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPILLLWI
Y3615_XANOR      IYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGVYLGNFQTYQRIYGALSALPILLLWI
Y3417_XANOM      IYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGVYLGNFQTYQRIYGALSALPILLLWI
Y4555_XANOP      IYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGVYLGNFQTYQRIYGALSALPILLLWI
Y700_NEIMA       LYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRSIYGAFAAVPFFLLWL
Y461_NEIM0       LYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRSIYGAFAAVPFFLLWL
Y524_NEIMB       LYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRSIYGAFAAVPFFLLWL
Y462_NEIMF       LYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRSIYGAFAAVPFFLLWL
Y810_CHRVO       LYRIVPNRFVPFRHAVWGALVTSVLLELTKMGFGFYIGQVASYQLVYGAFASIPIFLLWV
Y2978_LARHH      LYGLVPNCYVPRWHALIGGALTALTLGVAQAGFGLYVEISRTYQFIYGAFATFPFLLIWL
Y3165_AZOSB      LYYAVPNHPVRLLHALAGGLCAALVFLLMQRGLGLFIAGFPTYTLIYGTFAALPIFLLWL
Y4060_AROAE      LYYAVPNHPVRMLHALAGGIAAAIVFVLMQRLFGLFIVRIPTYTLIYGTFAVLPIFLVWL
Y4966_DELAS      LYHYVPNTAVRWRHAWVGGLFVATCMELAKKALGLYLASVPTYSVIYGTFATLPILLIWI
Y3782_VEREI      LYHYVPNTPVRWRHAWSGGLFVALCIELAKKALALYLGRVPTYSVVYGAFATLPILLVWI
Y2991_RHOFT      MYHFVPNTWVKWSHAWAGGMFVSAGLELAKKLLALYLGKVPTYSVLYGAFATVPILLIWI
Y1422_METPP      LFHYVPNTEVRWRHALAGGLFVSAGFELAKKGLAWYLAQVPTYSTIYGAFATVPIFLIWL
Y2179_JANMA      LYIVVPNRLVEWRDAVVGGLLAAIAFEIVKRLFAAFVIKVPTYTVVYGAVAAFPIFLVWV
Y3042_BORPD      LFVVVPNRHVYWRDALVGGFGTAIVLELMKAAFAYYLTRFPTYTVIYGAFATLPIFLLWI
Y3061_PARXL      LYVYLPNCRVEWRDAVIGGVTAAIAFELAKRGFGYYVRRIPTYTAVYGAFAAVPLFLLWM
Y1559_RALSO      LYVFVPNTLVAWRDAFLAGLVAAVAFEIAKRGFGYYVARFPTYTAVYGTFAALPIFLLWI
Y452_NITMU       SYLIVPNRQVAWRHAIAGGVAAAIGFEIMKEGFAFYITRFPTYQAVYGTFATIPIFLLWL
Y578_RHOCS       MFLMIPNREVQWFDALVGGIAAALLMEVSKVGFGLYIAAFPTYETIYGALSVIPIFLFWL
Y2625_RHORT      LYMLVPNRPVPLFHALAGALVATLASALLRSAFLMVITRGLSYETLYGALAALPAFLVWM
Y521_ALKEH       LYAAVPNFRVPLRHALLGGLLAAALFEAAKGGFGWYVANIPTYEAIYGALAALPIFLIWL
Y704_HALHL       IYSLVPHRSVPVLHAVIGGVVASGLFELAKGGFAAFIARAPTYEVVYGALAALPIFLVWL
Y1635_KANKD      LYMVVPYTQVRFYKALIAAVITAILFEAAKYGFAIFVTKFSSYELIYGAITAIPIFFLWV
Y2650_LEGPC      LYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYELLYGAFATVPIFFIWV
Y643_LEGPH       LYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYALLYGAFATVPIFFIWV
Y3681_AZOVD      LYVAVPNTAVPLRHALLGGLFAAVLFEAAKGLFGLYVALFPTYQLIYGAFAAVPLFLLWM
Y2988_PSEMY      LYAAVPNTRVPLRHALLGGLFSAILFEIAKALFGLYVRLFPGYHLIYGAFATVPLFLVWI
Y2825_PSEU5      IYAAVPNTRVPLRHALVGGVFTAVLFEAAKQMFGVYVSYFPSYQLIYGAFAAVPLFLLWI
Y951_PSEAE       LYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFATVPIFLLWI
Y4364_PSEA8      LYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFATVPIFLLWI
Y5196_PSEAB      LYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFATVPIFLLWI
Y4558_PSEA7      LYSAVPNARVPVRHALMGGMFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFATVPIFLLWI
Y3168_ACIAD      LYWTIPNRTVPMYAAIIAACFSAAIFELLKNIFGFAMSNFTSYELVYGAFAAIPIFLLWI
Y630_PSYWF       MYWFIPKAKVPLKNAAIAGVFVAVTFELLKYSFGIIMSNFTSYEAIYGAFAALPIFLLWI
Y1543_ALCBS      MYTVVPNTTVPFRQGVLGAAMAALLFELAKGAFTFFIKQAPSYQVVYGAFAAVPVFLLWI
Y901_SACD2       LFAAVPNCRVPIKFALIGGILTAVCFELLKIGFGWVVAN-SSFSQIYGAFAVVPLFLLWV
Y3006_TERTT      LFVAVPNCRVPFKFGAIGGVITAFAFEVVKAVFGYIVAN-SSFKLIYGAFAVVPLFLLWV
Y2282_CELJU      LFVAVPNCKVPTRHALVGGLLTTIAFQALKAIFAWIVSH-SSFTLVYGAFAALPLFLLWV
Y1578_COXBU      FNWVLPSAKVKLSHAVIGGLVTTVLFELAKFAFTVYLKFFPTYRVIYGALSVIPIFLVWL
Y433_COXB2       FNWVLPSAKVKLSHAVIGGLVTTVLFELAKFAFTVYLKFFPTYRVIYGALSVIPIFLVWL
Y1765_COXBR      FNWVLPSAKVKLSHAVIGGLVTTVLFELAKFAFTVYLKFFPTYRVIYGALSVIPIFLVWL
Y1808_COXB1      FNWVLPSAKVKLSHAVIGGLVTTVLFELAKFAFTVYLKFFPTYRVIYGALSVIPIFLVWL
Y409_COXBN       FNWVLPSAKVKLSHAVIGGLVTTVLFELAKFAFTVYLKFFPTYRVIYGALSVIPIFLVWL
Y1895_CHRSD      IYMAVPNCRVRFRHAVAGAGLAALALELAKGAFSLYVTYFPSYQVIYGTFAAVPLFLVWV
                     :*   :    .  ..             :   :        :**..: .*  :.*:

Y1670_HAEIE      QISWLVVLVGAQLASTL--------------------------------------DEIGE
Y4180_HAEIG      QISWLVVLVGAQLASTL--------------------------------------DEIGE
Y276_HAEIN       QISWLVVLVGAQLASTL--------------------------------------DEIGE
Y384_HAEI8       QISWLVVLVGAQLASTL--------------------------------------DEIGE
Y1616_PASMU      QLSWVVILIGAQLASVLADYTLCTQGKIRVEELVAADTHEPALQQKMEKTEQTLKTEITQ
Y693_HAES1       QLSWTAVLLGAQLSAVLADIR--------------------------------SLDCGNI
Y1104_HISS2      QLSWTAVLLGAQLSAVLADMR--------------------------------SLDDSNI
Y1801_AGGAN      QLSWTFVLLGAQLAAVLAEVR--------------------------------SEK--MI
Y342_ACTSZ       QLSWLFILLGAQLAAVLDEIQLE------------------------------QNNEIHS
Y032_MANSM       QLSWLFILLGAQLTAVLGDMR--------------------------------LIKSGDL
Y1950_ACTP2      HLSWQVVLFGGLITSTLNVYN--------------------------------EMKKGKL
Y1376_HAEPS      HLSWQVVLLGGQFASVLKDME--------------------------------MIKAGEL
Y3482_PSYIN      YYSWLIVLIGAEVTATLEEFLK-------------------------------QQEDNNV
YIHY_SHIDS       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SHIF8       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SHIB3       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOL5       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOL6       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOHS       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO81       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO8A       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOLU       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO5E       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO57       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO24       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOUT       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOSM       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOSE       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOLI       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECODH       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOBW       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOLC       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO55       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SHIFL       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECOK1       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO45       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SHIBS       YWTWCIVLLGAEITVTLGEYHKLK-----------------------------QAAEQEE
YIHY_SHISS       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO27       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ECO7I       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_ESCF3       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALA4       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALCH       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALTI       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALDC       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALEP       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALG2       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALHS       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALNS       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALSV       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALTY       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALPB       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
YIHY_SALAR       YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
Y3126_CITK8      YWTWCIVLLGAEITVTLGEYRKLK-----------------------------QAAEQEE
Y4092_ENT38      YWTWCIVLLGAEITVTLGEYRKLK-----------------------------LAAEQEE
Y5501_KLEP3      YWTWCIVLLGAEITVTLGEYRKLK---------------------------------TEE
Y4136_KLEP7      YWTWCIVLLGAEITVTLGEYRKLK---------------------------------TEE
Y4062_CROS8      YWTWCIVLLGAEITVTLGDYRKLR-----------------------------QAAREEA
Y028_YERPE       YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVT
Y034_YERPG       YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVT
Y3877_YERPP      YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVT
Y3514_YERPA      YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVT
Y254_YERPN       YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVT
Y027_YERPS       YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVI
Y030_YERP3       YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVI
Y028_YERPB       YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKSVI
Y4186_YERPY      YWSWCIVLLGAEITVTLGEYRAER-----------------------------HHAKNVI
Y031_YERE8       YWSWCIVLLGAEITVTLGEYRAQR-----------------------------HQAITEK
Y4878_SERP5      YWSWCIVLLGAEITVTIGEYRDYR-----------------------------QQKAEQQ
Y100_ALIF1       YLCWIIVLIGAEITASLGEFEGWL-----------------------------TGKVS-V
Y098_ALIFM       YLCWIIVLIGAEITASLGEFEGWL-----------------------------AGKVS-T
Y2938_ALISL      YLCWIIVLIGAEITASLGESDQWL-----------------------------IDKIN-T
Y2742_VIBCH      YLCWLIVLVGAEVTAALGEREHWS-----------------------------DSQ----
Y3514_VIBC3      YLCWLIVLVGAEVTAALGEREHWS-----------------------------DSQ----
Y2662_VIBCM      YLCWLIVLVGAEVTAALGEREHWS-----------------------------DSQ----
Y1626_VIBCJ      YLCWLIVLVGAEVTAALGEREHWS-----------------------------DSQ----
Y885_VIBVU       YLCWLIVLIGAEVTAALGEREHWR-----------------------------PAE----
Y203_VIBVY       YLCWLIVLIGAEVTAALGEREHWR-----------------------------PTE----
Y126_VIBA3       YLCWLIVLVGAEVTAALGEQEQWS-----------------------------DSQ----
Y593_VIBCB       YLCWLIVLIGAEVTAALGEREHWS-----------------------------DDL----
Y125_VIBPA       YLCWMIVLLGAEVTAALGEQEHWS-----------------------------EDL----
Y3489_PHOPR      YLCWCIVLLGAEITASLGERKQWQ-----------------------------LSSGEPI
Y315_SHEB5       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSD-DE
Y319_SHEB9       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSD-DE
Y320_SHEB2       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSD-DE
Y314_SHEB8       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSD-DE
Y316_SHESM       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSDINE
Y3708_SHESR      YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSDINE
Y311_SHESA       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSNINE
Y4401_SHEON      YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSSNAGE
Y418_SHEPC       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSFDKDE
Y272_SHESW       YLSWMIVLLGAEITAAMPEYLDYE-----------------------------SSFDKDE
Y4618_SHEWM      YLSWMIVLLGAVITAAMPEYLDKK-----------------------------QSAVEDK
Y302_SHESH       YLSWIIVLLGAEITAAMPEYLDKR-----------------------------QSGK-DE
Y3545_SHELP      YLSWIIVLIGAEITAAMPEYLDKR-----------------------------LMDLVNK
Y3448_SHEDO      YLSWMIVLVGAEITAALPEYLDD-------------------------------PFEKDG
Y331_SHEFN       YLSWMIVLLGAEITAALPEYLESL-----------------------------AVIAEDL
Y3404_SHEAM      YLSWTIVLFGGVIAAALPEYLDYD-----------------------------DGGDEDA
Y3909_SHEPA      YVSWVIVLVGAEITAGLPEYLHEC-----------------------------KLIRETA
Y4118_AERS4      YLSWLVVLLGAETTACLGEYEKPV-----------------------------SEELA--
Y2447_IDILO      YLSWLIVLIGAVLTVSLEEYQLQQ-----------------------------PEPKSD-
Y3526_ALTMD      YLSWIIVLFGAEFTCSLGEAFENK-----------------------------KAEHAPR
Y3954_PSEA6      YLSWIVVLLGAELTHVIEVFFHEE-----------------------------SKENFTQ
Y171_PSET1       YLSWIVVLLGAELTACISPENIED-----------------------------TPEIELD
Y609_COLP3       YVSWIIVLTGALITVSLQEYEILK-----------------------------EKKVKES
Y1325_CHLTE      YLEWVVVLTGAEFVFSLGYFRPAVC-P---------------AREFDPLQGVPEVVAVLR
Y1343_CHLP8      YLEWVVVLTGAEFVFSLGYFNPEEPDE---------------QQEFDPLQGVPEVLAVLS
Y1013_CHLPB      YLIWVVALSGAEFVYCLGAVRQEVKKE---------------RKEFSTLHGLWDVLAVME
Y1471_PROA2      YLIWVVALSGAEFVYCLGVVHPERAVV---------------R-EFHPLLGISAVLLVIE
Y1653_CHLPD      YLEWVVVLTGAEFVFCLGSLKPKKS-I---------------SEPFDPMRGIDEILVVLG
Y1623_PELPB      YLGWIVVLTGAEFVFCLGALKPVER-I---------------ADVFSPLRGVPEILSVLA
Y1323_PELLD      YLGWVVVLTGAEIVYCLGARRLSGP-A---------------APEFDPLRGVPLMLAVLR
Y1521_CHLL2      YIGWLVVLTGAELVFSIGNVLSSSV-E---------------PVPKRLLPGLTQLFSVLG
Y935_CHLCH       YLAWVVVLVGAEFVYCLGAFAPSTP-T---------------AEAQGSLRYLSLPLAVLA
Y461_TOLAT       YMSWLVVLLGAEFTATLGEWQLNRT-----------------------LRGRKPRLPG--
Y865_STRMK       YLCWVAVLLGASLSSSMAAFRYQPV-----------------ELRLPQGYEFYGLLRLLG
Y716_STRM5       YLCWVAVLLGASLSSSMAAFRYQPV-----------------ELRLPQGYEFYGLLRLLG
Y937_XANAC       YLSWVSVLLGASLASSMSAFRYQPE-----------------AMRLPPGFEIYGLLRLLG
Y968_XANC5       YLSWVSVLLGASLASSMSAFRYQPE-----------------AMRLPPGFEIYGLLRLLG
Y860_XANCP       YLSWVSVLLGASLASSMSAFRYQPE-----------------AMRLPPGFEIYGLLRLLG
Y3370_XANC8      YLSWVSVLLGASLASSMSAFRYQPE-----------------AMRLPPGFEIYGLLRLLG
Y3490_XANCB      YLSWVSVLLGASLASSMSAFRYQPE-----------------AMRLPPGFEIYGLLRLLG
Y3615_XANOR      YLSWVSVLLGASLASSMAAFRYQPE-----------------AMRLPTGFEIYGLLRLLG
Y3417_XANOM      YLSWVSVLLGASLASSMAAFRYQPE-----------------AMRLPTGFEIYGLLRLLG
Y4555_XANOP      YLSWVSVLLGASLASSMAAFRYQPE-----------------AMRLPTGFEIYGLLRLLG
Y700_NEIMA       NLLWTLVLGGAVLTSSLSYWQGEAFRR---------------GFDSR--GRFDDVLKILL
Y461_NEIM0       NLLWTLVLGGAVLTSSLSYWQGEAFRR---------------GFDSR--GRFDDVLKILL
Y524_NEIMB       NLLWTLVLGGAVLTSSLSYWQGEAFRR---------------GFDSR--GRFDDVLKILL
Y462_NEIMF       NLLWTLVLGGAVLTSSLSYWRGEAFRR---------------GFDSR--GRFDDVLKILL
Y810_CHRVO       YCLWLVVLAGAVFTSALSYWEGDAWRR---------------RNEPH--RRFQDALEVLL
Y2978_LARHH      QLMWLTVLIGAELTASLSYWKGDVWRR---------------EGDSQ--RRFCDALDTLV
Y3165_AZOSB      YLSWTVILLGALITATLPAFLERQRML---------------PAFPG--DRAWAAVEMLA
Y4060_AROAE      YLSWVVILLGAALSATLPSFFERARIL---------------RAFPG--DRAWAAVTMLI
Y4966_DELAS      YMAWIIVLLGAVVTAYLPIVMAGVQRM---------------PGQQG--WQFEMAVEILQ
Y3782_VEREI      YMAWVIVLLGAVVTAYLPSLLAGVARR---------------GTVAG--WTFQLALEVLQ
Y2991_RHOFT      YVAWIIVLLGAVIAAYLPSLTSGIQHR---------------GRSHG--LQFQLALETLQ
Y1422_METPP      YLGWVIVLLGAVIAAYAPSLSMHIVRQ---------------PNTPG--YRFQAAVQLLR
Y2179_JANMA      YLGWLITLAGAVVTAALPIVKYERWWH---------------VPQPG--SAFVDAMALIA
Y3042_BORPD      YLSWLAVLFGATVAASAPLIRLGRWEI---------------NRSPG--APFIDALAVLR
Y3061_PARXL      YLCWFITLAGAMIASALPAIRIGQFHR---------------PTFEG--SNLFDSLELLA
Y1559_RALSO      YVSWLVTLLGATIAATLPIIRQGYWQR---------------RAFPG--SEFFDALGILL
Y452_NITMU       YLSWLMVLLGAVIAASLSSWRFREWRDD--------------PNARG--KQFFDALRLLG
Y578_RHOCS       YTVWSVVLFGAEITATLPEWR-AGKITQ--------------VGPEGLLSAQRIVVAVAI
Y2625_RHORT      YLSWAVVLMGAVTAAEIPNWKMARRLTR--------------AGQDERAARLRIAVEIMV
Y521_ALKEH       YLSWVVVLVGAEFTQALASYSVARHRAA--------------GTGRD---AFRLAVRVLG
Y704_HALHL       YISWLVILIGAEVTQALRGYRWRTGGDL--------------ARNRW---ALVLAVHILG
Y1635_KANKD      YLSWSILLLGVIVCFGLHRFEVESE----------------------KHEHEFISVLKIL
Y2650_LEGPC      YWVWIITLLGAEISYAFSVHHQRRGGKS---------------------LDGFSHALLWL
Y643_LEGPH       YWVWIITLLGAEISYAFSVHHQRRGGKS---------------------LDGFSHALLWL
Y3681_AZOVD      YLSWMIVLLGAELVCNLSASRRWRR----------------------NPLPRLLVLLGVL
Y2988_PSEMY      YLSWLIVLLGAELVYGLSQPRRWRR----------------------QPLPRALILLVVL
Y2825_PSEU5      YLSWMIVLFGAELVCGLSSSQQWRR----------------------RPLPRLLVMLMLL
Y951_PSEAE       YLSWMIVLFGAVLVCNLSSSRLWRR----------------------RSLPKLIVLLGVL
Y4364_PSEA8      YLSWMIVLFGAVLVCNLSSSRLWRR----------------------RSLPKLIVLLGVL
Y5196_PSEAB      YLSWMIVLFGAVLVCNLSSSRLWRR----------------------RSLPKLIVLLGVL
Y4558_PSEA7      YLSWMIVLFGAVLVCNLSSSRLWRR----------------------RSLPKPIVLLGVL
Y3168_ACIAD      FLSWNIVLLGVEVSYALTAFHSDKI----------------------QTRHPVLMLLDVL
Y630_PSYWF       YLSWNLILLGVEISYTLTIFATSEV----------------------YPRHPLLSLLDML
Y1543_ALCBS      YISWTIVLGGAELVRALVVFQEHQR----------------------QVPR-MHALVRLL
Y901_SACD2       NLLWMIILGGAVFVRTLAERGYAHSS---------------------SRYTDLMAVLQIL
Y3006_TERTT      NLLWTIILGGAVFVRTLAEHSYASRI---------------------SRLSDMIVVLICL
Y2282_CELJU      NMTWMVILGGAVFVHSIKFYQIGLRD---------------------RAYPDVFASLLVI
Y1578_COXBU      YVSWTIILLGAVVSNVIACGIPEKYK----------------------------------
Y433_COXB2       YVSWTIILLGAVVSNVIACGIPEKYK----------------------------------
Y1765_COXBR      YVSWTIILLGAVVSNVIACGIPEKYK----------------------------------
Y1808_COXB1      YVSWTIILLGAVVSNVIACGIPEKYK----------------------------------
Y409_COXBN       YVSWTIILLGAVVSNVIACGIPEKYK----------------------------------
Y1895_CHRSD      FLSWAIVLVGAELAAWLGERRRAEW----------------------RYWAPFWQALGVV
                    *   * *                                                  

Y1670_HAEIE      QIEQ--------------------------------------------------------
Y4180_HAEIG      QIEQ--------------------------------------------------------
Y276_HAEIN       QIEQ--------------------------------------------------------
Y384_HAEI8       QIEQ--------------------------------------------------------
Y1616_PASMU      QKQRLEKQG---------------------------------------------------
Y693_HAES1       QIEKIKEEK---------------------------------------------------
Y1104_HISS2      QIEKMKEEK---------------------------------------------------
Y1801_AGGAN      NLEQIEETK---------------------------------------------------
Y342_ACTSZ       EQVNNKDKK---------------------------------------------------
Y032_MANSM       NLTAIKEKTE--------------------------------------------------
Y1950_ACTP2      NL----------------------------------------------------------
Y1376_HAEPS      ANPLTEDRE---------------------------------------------------
Y3482_PSYIN      TKEYLGADI---------------------------------------------------
YIHY_SHIDS       D--DEP------------------------------------------------------
YIHY_SHIF8       D--DEP------------------------------------------------------
YIHY_SHIB3       D--DEP------------------------------------------------------
YIHY_ECOL5       D--DEP------------------------------------------------------
YIHY_ECOL6       D--DEP------------------------------------------------------
YIHY_ECOHS       D--DEP------------------------------------------------------
YIHY_ECO81       D--DEP------------------------------------------------------
YIHY_ECO8A       D--DEP------------------------------------------------------
YIHY_ECOLU       D--DEP------------------------------------------------------
YIHY_ECO5E       D--DEP------------------------------------------------------
YIHY_ECO57       D--DEP------------------------------------------------------
YIHY_ECO24       D--DEP------------------------------------------------------
YIHY_ECOUT       D--DEP------------------------------------------------------
YIHY_ECOSM       D--DEP------------------------------------------------------
YIHY_ECOSE       D--DEP------------------------------------------------------
YIHY_ECOLI       D--DEP------------------------------------------------------
YIHY_ECODH       D--DEP------------------------------------------------------
YIHY_ECOBW       D--DEP------------------------------------------------------
YIHY_ECOLC       D--DEP------------------------------------------------------
YIHY_ECO55       D--DEP------------------------------------------------------
YIHY_SHIFL       D--DEP------------------------------------------------------
YIHY_ECOK1       D--DEP------------------------------------------------------
YIHY_ECO45       D--DEP------------------------------------------------------
YIHY_SHIBS       D--DEP------------------------------------------------------
YIHY_SHISS       D--DEP------------------------------------------------------
YIHY_ECO27       D--DEP------------------------------------------------------
YIHY_ECO7I       D--DEP------------------------------------------------------
YIHY_ESCF3       D--DEP------------------------------------------------------
YIHY_SALA4       A--DQP------------------------------------------------------
YIHY_SALCH       A--DQP------------------------------------------------------
YIHY_SALTI       A--DQP------------------------------------------------------
YIHY_SALDC       A--DQP------------------------------------------------------
YIHY_SALEP       A--DQP------------------------------------------------------
YIHY_SALG2       A--DQP------------------------------------------------------
YIHY_SALHS       A--DQP------------------------------------------------------
YIHY_SALNS       A--DQP------------------------------------------------------
YIHY_SALSV       A--DQP------------------------------------------------------
YIHY_SALTY       A--DQP------------------------------------------------------
YIHY_SALPB       A--DQP------------------------------------------------------
YIHY_SALAR       A--DQP------------------------------------------------------
Y3126_CITK8      A--DQS------------------------------------------------------
Y4092_ENT38      A--DQP------------------------------------------------------
Y5501_KLEP3      T--EQP------------------------------------------------------
Y4136_KLEP7      T--EQP------------------------------------------------------
Y4062_CROS8      E--SV-------------------------------------------------------
Y028_YERPE       T--QSPEM----------------------------------------------------
Y034_YERPG       T--QSPEM----------------------------------------------------
Y3877_YERPP      T--QSPEM----------------------------------------------------
Y3514_YERPA      T--QSPEM----------------------------------------------------
Y254_YERPN       T--QSPEM----------------------------------------------------
Y027_YERPS       T--QSPEM----------------------------------------------------
Y030_YERP3       T--QSPEM----------------------------------------------------
Y028_YERPB       T--QSPEM----------------------------------------------------
Y4186_YERPY      T--QSPEM----------------------------------------------------
Y031_YERE8       SPSQSQEI----------------------------------------------------
Y4878_SERP5      A--QPPEGQL--------------------------------------------------
Y100_ALIF1       NILESDIKALTEQQGLIESDSTDPESK---------------------------------
Y098_ALIFM       NILESDIKALTEQQGLIESDSTDPESK---------------------------------
Y2938_ALISL      HVFDAENTVLTESKGLTESDSTDPKSK---------------------------------
Y2742_VIBCH      DMLHFAPLPKNEKE----------------------------------------------
Y3514_VIBC3      DMLHFAPLPKNEKE----------------------------------------------
Y2662_VIBCM      DMLHFAPLPKNEKE----------------------------------------------
Y1626_VIBCJ      DMLHFAPLPKNEKE----------------------------------------------
Y885_VIBVU       DVIQSLPNNDTELEKDTQRDRFDSES----------------------------------
Y203_VIBVY       DVIQSLPNNDTELEKDTQRDRFDSES----------------------------------
Y126_VIBA3       EMVHSSD-KDKITEQGNNSDSTDPESK---------------------------------
Y593_VIBCB       EMIHSTAELQLTDEGSESRDSANSTSQ---------------------------------
Y125_VIBPA       DMIHSSAESQLANEGSESSDSANSTSQ---------------------------------
Y3489_PHOPR      TSKDCDVKVMAKNEQEKSSEAENNKGTK--------------------------------
Y315_SHEB5       TALNAKPLADAS----QGDSSSVLTSAEVTALKAVAKSE---------------------
Y319_SHEB9       TALNAKPLADAS----QGDSSSVLTSAEVTALKAVAKSE---------------------
Y320_SHEB2       TALNAKPLADAS----QGDSSSVLTSAEVTALKAVAKSE---------------------
Y314_SHEB8       TALNAKPLADAS----QGDSPSVLTSAEVTALKAVAKSE---------------------
Y316_SHESM       TNLDGQPLAAQDTPAAQPETTSGQSTQVLETTGELAATAPQSTTLDKP------------
Y3708_SHESR      TNLDGQPLAAQDTPAAQPETTSAQSSQVLETTDELAATAPQSSTLDKP------------
Y311_SHESA       TNLDGEPLAAQNTPAVEPETISAQSSQEVDTMGELAANAPQSTTLDKP------------
Y4401_SHEON      T----QPLAE--------------------------------------------------
Y418_SHEPC       ASTKT-------------------------------------------------------
Y272_SHESW       ASTKT-------------------------------------------------------
Y4618_SHEWM      NGEKEVVSQVPDVSFSISELPQEQSQEQSQEPSLKPVEESIKESRVK-------------
Y302_SHESH       ESEKKAEAHDPQISFSISTAVNESKKENRQ------------------------------
Y3545_SHELP      ELAD-----------DESEIHLDEHKR---------------------------------
Y3448_SHEDO      TKATTALTENKEVDE-SEPNQGNDTIA---------------------------------
Y331_SHEFN       KAEIFAETEDEHVNNVHDPIVVDKSVPSDKS-----------------------------
Y3404_SHEAM      QGCQDAPSGEALSSPKENPSSSSSTKPKTDNDPG--------------------------
Y3909_SHEPA      LAESQAETKTEEPVTESKNDGPNSSNDSGQDNVRGSEKTDEPAQDKQDKLD---------
Y4118_AERS4      ------------------------------------------------------------
Y2447_IDILO      ------------------------------------------------------------
Y3526_ALTMD      KVPKE-------------------------------------------------------
Y3954_PSEA6      VDEDDPQSPA--------------------------------------------------
Y171_PSET1       EQENTKDTL---------------------------------------------------
Y609_COLP3       DRAQVKDEEIS-------------------------------------------------
Y1325_CHLTE      SVWRAQLSG-SFMTGKKLLASENSGDRSKLGHVVDFLKQNGILHKTADGG----------
Y1343_CHLP8      AVWQAQISG-SFLTGKKLLTSEIIADRSKLGLIVEFLERNHFVHQTADGG----------
Y1013_CHLPB      QIWKGQQCG-QYVRYKKHALSGKGIDAARVRSIVAVLKENRLIHVTEDGE----------
Y1471_PROA2      RISAAQSSG-GFLTMNTLEDLCRSVTRMQLRRITDFLLQQNIIHKTEEGS----------
Y1653_CHLPD      WIWEGQKTG-TPLSMKSIMKKKRALQPSRARSIVDLLLQAGIVHGTANAG----------
Y1623_PELPB      HIWNGQKSG-NAMNMKKMLKVIEGLTPSGLRKVIDILLQNGLLHVTVNGD----------
Y1323_PELLD      MVWRAGGEG-VVLDMKKILREFHRENPSSLRKIVDILLECRFMHLTASGG----------
Y1521_CHLL2      TIWRAQQDG-SPVHIGTRV-VRGALSATAADRIVDLLLQKGVVHETSGGE----------
Y935_CHLCH       TLHNAIEKG-APLSLKSLSRELSTLPFNLLRDMVDLLLDRQVLHLSTRGE----------
Y461_TOLAT       ------------------------------------------------------------
Y865_STRMK       RFHHARAKG-KGLADDEILRLEPMLTDSLLQDLACNLQEIGLLRRDERGE----------
Y716_STRM5       RFHHARAKG-KGLADDEILRLEPMLTDSLLQDLACNLQEIGLLRRDERGE----------
Y937_XANAC       RFSQARVHG-DGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGQ----------
Y968_XANC5       RFRQARVHG-DGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGQ----------
Y860_XANCP       RFRQARLHG-NGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGN----------
Y3370_XANC8      RFRQARLHG-NGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGN----------
Y3490_XANCB      RFRQARLHG-NGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERSN----------
Y3615_XANOR      RFRQARIHG-EGLDEDRILALEPMLTDTLMQELLCELKRMRLLRRDERGQ----------
Y3417_XANOM      RFRQARIHG-EGLDEDRILALEPMLTDTLMQELLCELKRMRLLRRDERGQ----------
Y4555_XANOP      RFRQARIHG-EGLDEDRILALEPMLTDTLMQELLCELKRMRLLRRDERGQ----------
Y700_NEIMA       LLDAAQKE--GKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQG-----------
Y461_NEIM0       LLDAAQKE--GKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQG-----------
Y524_NEIMB       LLDAAQKE--GKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQG-----------
Y462_NEIMF       LLDAAQKE--GKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQG-----------
Y810_CHRVO       LLDAAHAR--GEALTPRQLRQQVKVGYDELGLVLDRLAQRGYVQKGHGDA----------
Y2978_LARHH      RLSQAQVH--GRALGQADLRHHIDTGYDEIGRILDELARLGLVQRSAEGL----------
Y3165_AZOSB      ALAEAQYD--GRPVGFAALRRRTNLAEHAAEALLESLRECGIASRTEGGD----------
Y4060_AROAE      ALADAQHA--GTTLPFATLQAGARVSSNEGEALLGEMRDAGWVAHTEEGN----------
Y4966_DELAS      YLEQERESPAKG-LYASDLARRLHVDWQQIDPVLQALSVLDWVGTVQAPG-----VAAGS
Y3782_VEREI      QLHRVRHDAGKG-LRAGQLAQLLRVDVLQLEPVLESLTALDWVGQVSAVV-----VAA-S
Y2991_RHOFT      QLERVRSDAVKG-LTMQQLAQLLRVDALQLEPVLETLSELDWIGLLNEEF-----KGE--
Y1422_METPP      ELAAARARGERG-LGLVGLASTLRTDPLQIEPSLERLVELDWVGRLDEAG-----EKR--
Y2179_JANMA      VLYEARASADSAVVDTKLLRDRTQLGFDESEALLEKMLDAGWVARLKSEGPKRMQWGKRI
Y3042_BORPD      ALHAAQGMRPAG-RSASALAKRLHLHHDELNAVLEKLENLGLAARTAEQR----------
Y3061_PARXL      RLSEARDAGKRG-YTVPELSRMLRRDMGTTINLLEKLEEIEWIARLQEDG----------
Y1559_RALSO      LLHRARDHAPRT-LGELDIGRRLQLEADYVADLLIQLKTLHLVGKLQQDR----------
Y452_NITMU       ILGEALKA--GKVETALSLQQQLMLSPEEVERILELMVKANFVRQVQEGG----------
Y578_RHOCS       LHELQRAARLGVGIRRGTLSTRVPVGANVIDGMLEQLQAAHWVARTRDGA----------
Y2625_RHORT      AAARAYGEGQGDGASRRALSALTATPDRRQAGVLRDLDKAGLLIRDEDGA----------
Y521_ALKEH       HLWRAQREG-RGLSTRALSRLEPAAGEMGVLQVLRPLRRARAIQLNGEGE----------
Y704_HALHL       HLYQAQRRG-AGVTFAELLEQEPDAGEPALAEALETLRRHHVIERSADGA----------
Y1635_KANKD      QFFIQAQDKESSLSLEQLKSKFSYLHEQTLRGYLEQLLRLNFLAKLEGEQ----------
Y2650_LEGPC      HQLWIAQQHGKGLSFNDLVDASKQPFAVDVDEMINALIYHELIHATADGH----------
Y643_LEGPH       HQLWLAQQHGKGLSFNDLVDASKQPFAVDVDEMINALIYHELIHATADGH----------
Y3681_AZOVD      RVFHQSQQSGQAVRQPDLQRAGWALPDSVWDEMLDFLEREQLICRVSDGG----------
Y2988_PSEMY      RLLLARQQKGEALHYAEMQRGGWSLPEDEWSEVLDFLEREHLACRASGGG----------
Y2825_PSEU5      RNLHERQQEGRELHLRDLHKAGLRLPEDEWDDILGFFEQEQLVCRTGSGG----------
Y951_PSEAE       RVFLQRQQLGQSLRLTHLHRAGWLLPEDEWEELLDFLEKEQFVCRAGGGE----------
Y4364_PSEA8      RVFHQRQQLGQSLRLTHLHRAGWLLPEDEWEELLDFLEKEQFVCRAGGGE----------
Y5196_PSEAB      RVFHQRQQLGQSLRLTHLHRAGWLLPEDEWEELLDFLEKEQFVCRAGGGE----------
Y4558_PSEA7      RVFHQRQQLGQSMRLVHLHRAGWLLPEDEWEELLDFLEKEQFVCRVGGGE----------
Y3168_ACIAD      ELFYKKQKLGQSVTDLEALDIMGRGEIGRWPSYIELLEKQNLIKRTDKDE----------
Y630_PSYWF       NLVHDRYQQGKDTSEEDLRSVLGRKELPKWFTYLNYLKDAHLITETDEGN----------
Y1543_ALCBS      NVFWQRQQSGKVLRSKEIRQVMQESGISQWDEFRNLLVNANLIRRTDEGG----------
Y901_SACD2       AIFKEKSRTGESVT--DGDCVRAGVGLVHWQQLRSKLTEKNWIAVTDSGF----------
Y3006_TERTT      ALFREKAALGESVS--DRDCVRLGIGLVHWQRMRSLMVEHRWIAVTESGD----------
Y2282_CELJU      WHLHQASLRGQSMS--EWQILLLGLSTQQWQRLSKRLLGRHVIAQTQQGD----------
Y1578_COXBU      ------------------------------------------------------------
Y433_COXB2       ------------------------------------------------------------
Y1765_COXBR      ------------------------------------------------------------
Y1808_COXB1      ------------------------------------------------------------
Y409_COXBN       ------------------------------------------------------------
Y1895_CHRSD      SHLYDAHRRGQAVYDRELAMRLG----ARYSDVMAPLQTLGVAVQLDNDR----------
                                                                             

Y1670_HAEIE      ------------------------------------------------------------
Y4180_HAEIG      ------------------------------------------------------------
Y276_HAEIN       ------------------------------------------------------------
Y384_HAEI8       ------------------------------------------------------------
Y1616_PASMU      ------------------------------------------------------------
Y693_HAES1       ------------------------------------------------------------
Y1104_HISS2      ------------------------------------------------------------
Y1801_AGGAN      ------------------------------------------------------------
Y342_ACTSZ       ------------------------------------------------------------
Y032_MANSM       ------------------------------------------------------------
Y1950_ACTP2      ------------------------------------------------------------
Y1376_HAEPS      ------------------------------------------------------------
Y3482_PSYIN      ------------------------------------------------------------
YIHY_SHIDS       ------------------------------------------------------------
YIHY_SHIF8       ------------------------------------------------------------
YIHY_SHIB3       ------------------------------------------------------------
YIHY_ECOL5       ------------------------------------------------------------
YIHY_ECOL6       ------------------------------------------------------------
YIHY_ECOHS       ------------------------------------------------------------
YIHY_ECO81       ------------------------------------------------------------
YIHY_ECO8A       ------------------------------------------------------------
YIHY_ECOLU       ------------------------------------------------------------
YIHY_ECO5E       ------------------------------------------------------------
YIHY_ECO57       ------------------------------------------------------------
YIHY_ECO24       ------------------------------------------------------------
YIHY_ECOUT       ------------------------------------------------------------
YIHY_ECOSM       ------------------------------------------------------------
YIHY_ECOSE       ------------------------------------------------------------
YIHY_ECOLI       ------------------------------------------------------------
YIHY_ECODH       ------------------------------------------------------------
YIHY_ECOBW       ------------------------------------------------------------
YIHY_ECOLC       ------------------------------------------------------------
YIHY_ECO55       ------------------------------------------------------------
YIHY_SHIFL       ------------------------------------------------------------
YIHY_ECOK1       ------------------------------------------------------------
YIHY_ECO45       ------------------------------------------------------------
YIHY_SHIBS       ------------------------------------------------------------
YIHY_SHISS       ------------------------------------------------------------
YIHY_ECO27       ------------------------------------------------------------
YIHY_ECO7I       ------------------------------------------------------------
YIHY_ESCF3       ------------------------------------------------------------
YIHY_SALA4       ------------------------------------------------------------
YIHY_SALCH       ------------------------------------------------------------
YIHY_SALTI       ------------------------------------------------------------
YIHY_SALDC       ------------------------------------------------------------
YIHY_SALEP       ------------------------------------------------------------
YIHY_SALG2       ------------------------------------------------------------
YIHY_SALHS       ------------------------------------------------------------
YIHY_SALNS       ------------------------------------------------------------
YIHY_SALSV       ------------------------------------------------------------
YIHY_SALTY       ------------------------------------------------------------
YIHY_SALPB       ------------------------------------------------------------
YIHY_SALAR       ------------------------------------------------------------
Y3126_CITK8      ------------------------------------------------------------
Y4092_ENT38      ------------------------------------------------------------
Y5501_KLEP3      ------------------------------------------------------------
Y4136_KLEP7      ------------------------------------------------------------
Y4062_CROS8      ------------------------------------------------------------
Y028_YERPE       ------------------------------------------------------------
Y034_YERPG       ------------------------------------------------------------
Y3877_YERPP      ------------------------------------------------------------
Y3514_YERPA      ------------------------------------------------------------
Y254_YERPN       ------------------------------------------------------------
Y027_YERPS       ------------------------------------------------------------
Y030_YERP3       ------------------------------------------------------------
Y028_YERPB       ------------------------------------------------------------
Y4186_YERPY      ------------------------------------------------------------
Y031_YERE8       ------------------------------------------------------------
Y4878_SERP5      ------------------------------------------------------------
Y100_ALIF1       ------------------------------------------------------------
Y098_ALIFM       ------------------------------------------------------------
Y2938_ALISL      ------------------------------------------------------------
Y2742_VIBCH      ------------------------------------------------------------
Y3514_VIBC3      ------------------------------------------------------------
Y2662_VIBCM      ------------------------------------------------------------
Y1626_VIBCJ      ------------------------------------------------------------
Y885_VIBVU       ------------------------------------------------------------
Y203_VIBVY       ------------------------------------------------------------
Y126_VIBA3       ------------------------------------------------------------
Y593_VIBCB       ------------------------------------------------------------
Y125_VIBPA       ------------------------------------------------------------
Y3489_PHOPR      ------------------------------------------------------------
Y315_SHEB5       ------------------------------------------------------------
Y319_SHEB9       ------------------------------------------------------------
Y320_SHEB2       ------------------------------------------------------------
Y314_SHEB8       ------------------------------------------------------------
Y316_SHESM       ------------------------------------------------------------
Y3708_SHESR      ------------------------------------------------------------
Y311_SHESA       ------------------------------------------------------------
Y4401_SHEON      ------------------------------------------------------------
Y418_SHEPC       ------------------------------------------------------------
Y272_SHESW       ------------------------------------------------------------
Y4618_SHEWM      ------------------------------------------------------------
Y302_SHESH       ------------------------------------------------------------
Y3545_SHELP      ------------------------------------------------------------
Y3448_SHEDO      ------------------------------------------------------------
Y331_SHEFN       ------------------------------------------------------------
Y3404_SHEAM      ------------------------------------------------------------
Y3909_SHEPA      ------------------------------------------------------------
Y4118_AERS4      ------------------------------------------------------------
Y2447_IDILO      ------------------------------------------------------------
Y3526_ALTMD      ------------------------------------------------------------
Y3954_PSEA6      ------------------------------------------------------------
Y171_PSET1       ------------------------------------------------------------
Y609_COLP3       ------------------------------------------------------------
Y1325_CHLTE      ------LAISADLHAVTLYDLYTKLPRELFNG-DGCVD---------------EGPASRE
Y1343_CHLP8      ------LAVNVDLHSMTLYELYSQMPRELFSS-EPGRE---------------EVADGEI
Y1013_CHLPB      ------FALHCDIHEVTLFDLYSILPPEILVGSDAAVS---------------GKRFEQ-
Y1471_PROA2      ------FALSADLHTLTLYDLYAILPADLVQPKDPETS---------------DSHFGQD
Y1653_CHLPD      ------FAVSSDLYETTLFDLYTKIPGGFGANESETRG---------------NGG-AIL
Y1623_PELPB      ------LAISRDLYTMTLYDLYAIIPSGFWGDENGLLI---------------SGGNSVH
Y1323_PELLD      ------MAAASDLHVMTLYDLFIKLPPDFGAEDFGQAG---------------PAWDGIE
Y1521_CHLL2      ------LVVSADLYQMTLFDLYGLIPWELAVHEDLEGY---------------DDDGSET
Y935_CHLCH       ------LALSRNLHAMSLYELYQIIPQPINATEKSLLF---------------SESKSVH
Y461_TOLAT       ------------------------------------------------------------
Y865_STRMK       ------WLLSRDLDQVSLADLYECTQLRIPVAEQHLPYR--------------DDSLGRA
Y716_STRM5       ------WLLARDLEQVSLSDLYECTQLRIPVAEQHLPYR--------------DDTLGRV
Y937_XANAC       ------WLLARDLDVVPLAELYENCQLRVPIEDRPLPCR--------------DDAFGQA
Y968_XANC5       ------WLLARDLDVVPLAELYENCQLRVPIEDRPLPCR--------------DDAYGQA
Y860_XANCP       ------WLLARDLDVVPLAELYESCQLRVPVEDRPLPCR--------------DDPYGQA
Y3370_XANC8      ------WLLARDLDVVPLAELYESCQLRVPVEDRPLPCR--------------DDPYGQA
Y3490_XANCB      ------WLLARDLDVVPLAELYESCQLRVPVEDRPLPCR--------------DDPYGQA
Y3615_XANOR      ------WLLARDLDLVPLAELYENCQLRVPIEDRPLPCR--------------DDAYGQA
Y3417_XANOM      ------WLLARDLDLVPLAELYENCQLRVPIEDRPLPCR--------------DDAYGQA
Y4555_XANOP      ------WLLARDLDLVPLAELYENCQLRVPIEDRPLPCR--------------DDAYGQA
Y700_NEIMA       ------WVLKTGADSIELNELFKLFVYRPLPV----------------ERDHVNQAVDAV
Y461_NEIM0       ------WVLKTGADSIELNELFKLFVYRPLPV----------------ERDHVNQAVDAV
Y524_NEIMB       ------WVLKTGADSIELNELFKLFVYRPLPV----------------ERDHVNQAVDAV
Y462_NEIMF       ------WVLKTGADSIELNELFKLFVYRPLPV----------------ERDHVNQAVDAV
Y810_CHRVO       ------WVLMRRAAAINLSDLFQIFVYRRDAS----------------AGDALDATLAEL
Y2978_LARHH      ------WALLYRPESVSLLRLWHHFVLDLNASP---------------ADDAISHSLTEL
Y3165_AZOSB      ------WVLTRAASDIRLSAVLQRFALDLTAWS---------------ALSPG-RGGRIV
Y4060_AROAE      ------WLLSRQAAQIGLAAVVNRFALSPAAWR---------------EASDGDEASRRI
Y4966_DELAS      EGTEPRYMLLVDPQHTPLAPLVERLLLAPS----------------------------AA
Y3782_VEREI      DPPEPRYVLLADPQSTLLEPLVHKLLLERS----------------------------ES
Y2991_RHOFT      ---AARYVMLANPDATALAPLLDTLLLRRE----------------------------ES
Y1422_METPP      ------YVLLCDPNTTPAQPLLAALLLDPS----------------------------PG
Y2179_JANMA      TDGLDRWVLLANPEYLTLADVYRVFVFDAGGNEMLAKKVECAVEQGLY----------QS
Y3042_BORPD      ------WILACDPRSTTLEPVFDNFLLDRHQPRLRDDPQVVQAAAAVLGQDGGQAPTLEE
Y3061_PARXL      --ARPHFLLLANPAQITVERLFGLFVIDRAELGYQLELASTRVDGEMLLAALENDKLKVT
Y1559_RALSO      --GQAHWALLCDAHTTTLRPLYEKLVLSLPRLS-RTAFAHQLGDTRVLEAQLHNPALDCT
Y452_NITMU       ------WVQILDPAEIRIADVYRLFAFRPEALR-------------------GTAGGDTR
Y578_RHOCS       ------WVATRNLSDATVDDLRHSLGMAIRGNLRSV--------------GHLSAGWQNR
Y2625_RHORT      ------VLPGRDPRRITLAEILHALTLAPPTGTVG------------------GPGWPDL
Y521_ALKEH       ------WMLARDPSHYTLLDLYRSEAFPLPSVAALR---------------KDGDDWDQR
Y704_HALHL       ------WLLARDTSTFTLAELHRMLAYPLPPAAGL----------------ETGAPWDRR
Y1635_KANKD      ------YCLKLTGHSLTIEEVYRRGNWRLPNNNQALS-----------------DEKNDS
Y2650_LEGPC      ------YMLSRDLSHVTLYDLTQLLPYRLPTHLELQYS---------------KASLSEQ
Y643_LEGPH       ------YMLSRDLSHVTLYDLTQLLPYRLPTHLELQYS---------------KASLAEQ
Y3681_AZOVD      ------WVLCRDLNRYSLESLLSRSPWPLPHLDQLPESL---DEPWFPALRSALERLQRE
Y2988_PSEMY      ------WVLCRDLHNFSLHQLLECSPWPLPNLSQLPAQL---DEPWYPALRQALERLQNE
Y2825_PSEU5      ------WVLCRDLNHYSLDQLLRCNPWPLSARVELPEQL---NEPWYPTLRRSLELLQQE
Y951_PSEAE       ------WVLCRDLGAYSLHRLLNRCPWPMPSRERMPASL---DEAWYPPFQQAMERLQVE
Y4364_PSEA8      ------WVLCRDLGAYSLHRLLNRCPWPMPSRERMPASL---DEAWYPPFQQAMERLQVE
Y5196_PSEAB      ------WVLCRDLGAYSLHRLLNRCPWPMPSRERMPANL---DEAWYPPFQQAMERLQVE
Y4558_PSEA7      ------WVLCRDLGSYSLHRLLNRCPWPMPSRERMPAQL---DEAWYPAFQQAMERLQAE
Y3168_ACIAD      ------YVLVRNLSQVDFWTFFTALPYPLPLRKDVGNIHPDDE--WMQKIGPALIEADDY
Y630_PSYWF       ------YVLKKDLDNITLWEFYRTLPYPLPIKDELDEVCANARTPWLSLLVQRFVQTEKH
Y1543_ALCBS      ------YILSRDLRNISLGQLVAMLPWPAHTQLRVRQQP--ESLPWEQALKSRMDEAREG
Y901_SACD2       ------YVLCRDLSDVTVWDAACLVGATLAELEKTPRKR-SRDGEWREEFSKRKDLLADD
Y3006_TERTT      ------YVLSRDLRRANIWEVASMVRMPVSEELSSLRENIAGRAPWFADFLERQSELRSH
Y2282_CELJU      ------FVLCYDLSLLTLSTLAEWIG---QRPDWPGVDELTRELPWGQASEQVLGAVDNA
Y1578_COXBU      ------------------------------------------------------------
Y433_COXB2       ------------------------------------------------------------
Y1765_COXBR      ------------------------------------------------------------
Y1808_COXB1      ------------------------------------------------------------
Y409_COXBN       ------------------------------------------------------------
Y1895_CHRSD      ------WMLGRDLGALSLWDFQRAMPWAVPLGESS-------PAPEMQAIHAALQEAERH
                                                                             

Y1670_HAEIE      ------------------------------------------------------------
Y4180_HAEIG      ------------------------------------------------------------
Y276_HAEIN       ------------------------------------------------------------
Y384_HAEI8       ------------------------------------------------------------
Y1616_PASMU      ------------------------------------------------------------
Y693_HAES1       ------------------------------------------------------------
Y1104_HISS2      ------------------------------------------------------------
Y1801_AGGAN      ------------------------------------------------------------
Y342_ACTSZ       ------------------------------------------------------------
Y032_MANSM       ------------------------------------------------------------
Y1950_ACTP2      ------------------------------------------------------------
Y1376_HAEPS      ------------------------------------------------------------
Y3482_PSYIN      ------------------------------------------------------------
YIHY_SHIDS       ------------------------------------------------------------
YIHY_SHIF8       ------------------------------------------------------------
YIHY_SHIB3       ------------------------------------------------------------
YIHY_ECOL5       ------------------------------------------------------------
YIHY_ECOL6       ------------------------------------------------------------
YIHY_ECOHS       ------------------------------------------------------------
YIHY_ECO81       ------------------------------------------------------------
YIHY_ECO8A       ------------------------------------------------------------
YIHY_ECOLU       ------------------------------------------------------------
YIHY_ECO5E       ------------------------------------------------------------
YIHY_ECO57       ------------------------------------------------------------
YIHY_ECO24       ------------------------------------------------------------
YIHY_ECOUT       ------------------------------------------------------------
YIHY_ECOSM       ------------------------------------------------------------
YIHY_ECOSE       ------------------------------------------------------------
YIHY_ECOLI       ------------------------------------------------------------
YIHY_ECODH       ------------------------------------------------------------
YIHY_ECOBW       ------------------------------------------------------------
YIHY_ECOLC       ------------------------------------------------------------
YIHY_ECO55       ------------------------------------------------------------
YIHY_SHIFL       ------------------------------------------------------------
YIHY_ECOK1       ------------------------------------------------------------
YIHY_ECO45       ------------------------------------------------------------
YIHY_SHIBS       ------------------------------------------------------------
YIHY_SHISS       ------------------------------------------------------------
YIHY_ECO27       ------------------------------------------------------------
YIHY_ECO7I       ------------------------------------------------------------
YIHY_ESCF3       ------------------------------------------------------------
YIHY_SALA4       ------------------------------------------------------------
YIHY_SALCH       ------------------------------------------------------------
YIHY_SALTI       ------------------------------------------------------------
YIHY_SALDC       ------------------------------------------------------------
YIHY_SALEP       ------------------------------------------------------------
YIHY_SALG2       ------------------------------------------------------------
YIHY_SALHS       ------------------------------------------------------------
YIHY_SALNS       ------------------------------------------------------------
YIHY_SALSV       ------------------------------------------------------------
YIHY_SALTY       ------------------------------------------------------------
YIHY_SALPB       ------------------------------------------------------------
YIHY_SALAR       ------------------------------------------------------------
Y3126_CITK8      ------------------------------------------------------------
Y4092_ENT38      ------------------------------------------------------------
Y5501_KLEP3      ------------------------------------------------------------
Y4136_KLEP7      ------------------------------------------------------------
Y4062_CROS8      ------------------------------------------------------------
Y028_YERPE       ------------------------------------------------------------
Y034_YERPG       ------------------------------------------------------------
Y3877_YERPP      ------------------------------------------------------------
Y3514_YERPA      ------------------------------------------------------------
Y254_YERPN       ------------------------------------------------------------
Y027_YERPS       ------------------------------------------------------------
Y030_YERP3       ------------------------------------------------------------
Y028_YERPB       ------------------------------------------------------------
Y4186_YERPY      ------------------------------------------------------------
Y031_YERE8       ------------------------------------------------------------
Y4878_SERP5      ------------------------------------------------------------
Y100_ALIF1       ------------------------------------------------------------
Y098_ALIFM       ------------------------------------------------------------
Y2938_ALISL      ------------------------------------------------------------
Y2742_VIBCH      ------------------------------------------------------------
Y3514_VIBC3      ------------------------------------------------------------
Y2662_VIBCM      ------------------------------------------------------------
Y1626_VIBCJ      ------------------------------------------------------------
Y885_VIBVU       ------------------------------------------------------------
Y203_VIBVY       ------------------------------------------------------------
Y126_VIBA3       ------------------------------------------------------------
Y593_VIBCB       ------------------------------------------------------------
Y125_VIBPA       ------------------------------------------------------------
Y3489_PHOPR      ------------------------------------------------------------
Y315_SHEB5       ------------------------------------------------------------
Y319_SHEB9       ------------------------------------------------------------
Y320_SHEB2       ------------------------------------------------------------
Y314_SHEB8       ------------------------------------------------------------
Y316_SHESM       ------------------------------------------------------------
Y3708_SHESR      ------------------------------------------------------------
Y311_SHESA       ------------------------------------------------------------
Y4401_SHEON      ------------------------------------------------------------
Y418_SHEPC       ------------------------------------------------------------
Y272_SHESW       ------------------------------------------------------------
Y4618_SHEWM      ------------------------------------------------------------
Y302_SHESH       ------------------------------------------------------------
Y3545_SHELP      ------------------------------------------------------------
Y3448_SHEDO      ------------------------------------------------------------
Y331_SHEFN       ------------------------------------------------------------
Y3404_SHEAM      ------------------------------------------------------------
Y3909_SHEPA      ------------------------------------------------------------
Y4118_AERS4      ------------------------------------------------------------
Y2447_IDILO      ------------------------------------------------------------
Y3526_ALTMD      ------------------------------------------------------------
Y3954_PSEA6      ------------------------------------------------------------
Y171_PSET1       ------------------------------------------------------------
Y609_COLP3       ------------------------------------------------------------
Y1325_CHLTE      FEPLRAEVREALRSAMQTPLITLVNDSTEKDS----------------------------
Y1343_CHLP8      FEQMRSGIRAALQNTMQTPLIELVNDSTQRDP----------------------------
Y1013_CHLPB      LYELEAAVAACLRESLDKPLALYIKQEEGLPE----------------------------
Y1471_PROA2      LSGLEQNIIQCLQHAMHQPLAAFLNTATRTL-----------------------------
Y1653_CHLPD      PESIGHNVTAGIKSAMTIPLATVLQDKIY-------------------------------
Y1623_PELPB      LKTISKGVTECLKNSMDLPLAPLLEDINQQPE----------------------------
Y1323_PELLD      LQGVRERLGACFEESMHVPLIQLMDGSNEGQV----------------------------
Y1521_CHLL2      FASLEKDVTVCLKETMAVPVALLLQDSTNQCI----------------------------
Y935_CHLCH       LAPLSLEVEACLQERMATPIAELLQHSFLKASTVD-------------------------
Y461_TOLAT       ------------------------------------------------------------
Y865_STRMK       ALAALDDLRLPLRERLKRKVSDIYTDS-GDMP----------------------------
Y716_STRM5       ALAALDDLRLPLRERLKRKVSDIYTDS-GDTP----------------------------
Y937_XANAC       AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y968_XANC5       AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y860_XANCP       AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y3370_XANC8      AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y3490_XANCB      AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y3615_XANOR      AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y3417_XANOM      AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y4555_XANOP      AAAALEQLRQPLRSVLAQPVGDLYTHLPGDPP----------------------------
Y700_NEIMA       MMPCLQTLNMTLAEFDAQAKKQQQS-----------------------------------
Y461_NEIM0       MMPCLQTLNMTLAEFDAQAKKQQQS-----------------------------------
Y524_NEIMB       MTPCLQTLNMTLAEFDAQAKKRQ-------------------------------------
Y462_NEIMF       MTPCLQTLNMTLAEFDAQAKKQQQS-----------------------------------
Y810_CHRVO       LGPLTEQLQAVTVADLARRVGRK-------------------------------------
Y2978_LARHH      VRPLEAGLDISLAEFLHRYPPAGPAVTLPAVPRPG-------------------------
Y3165_AZOSB      AERLREGLQAADLSLAELAAANTSAGAVQVG-----------------------------
Y4060_AROAE      AERLATALHSADLPLSALTSAGNR---VQTG-----------------------------
Y4966_DELAS      VQPLWERTGLAGMTLASLLESRPRP-----------------------------------
Y3782_VEREI      LGPLWDKAGLGRLQMADVLAR---------------------------------------
Y2991_RHOFT      TQNLWEKGRWPLLNVRDVL-----------------------------------------
Y1422_METPP      LRGFWQRARFGEMTLQELI-----------------------------------------
Y2179_JANMA      LANYFRESSEGDLPGQHLPVHQP-------------------------------------
Y3042_BORPD      LAGLAHNTPVGLAAIVPLEAGKNSRRGPHAPGESSC------------------------
Y3061_PARXL      LAALLTARAAARAAQAAENESGTSSMPHQAA-----------------------------
Y1559_RALSO      LEAVFASGEPGVVKAAAEAAAAPAAATLAASARA--------------------------
Y452_NITMU       LEQLLDDIAVGIDEKMSLPLSQLFTSAEPEPPAEMSA-----------------------
Y578_RHOCS       LADLFERAEAADREVLGVCFADLFADPPSGQPSGQVETAVRQRTGLQGRI----------
Y2625_RHORT      LRHALETAGGDYDRALGLSLDALVQAEPLGARI---------------------------
Y521_ALKEH       LADSLAQADTGLASGLAESLDDIFTSRPQIRPVVRQANSPSEER----------------
Y704_HALHL       LAERLRRVEERWEQSFDLSLSDLLEPTAEEAGAGRSARAEVA------------------
Y1635_KANKD      FSTPIEQANLEMAKALDVELVSTNSVNS--------------------------------
Y2650_LEGPC      WRAAFKRHNEELKKSLDINLEELFKKTGTILK----------------------------
Y643_LEGPH       WRAAFKRHNEELKKSLDINLEELFKKTGTVIK----------------------------
Y3681_AZOVD      RAALFGDSLANWLQPPLSEP----------------------------------------
Y2988_PSEMY      RKEQFGVSLATWLSGPG-------------------------------------------
Y2825_PSEU5      QANLFGGSLADWLQANGDKKRQ--------------------------------------
Y951_PSEAE       QEALFGESLAHWLADGTSGAKVT-------------------------------------
Y4364_PSEA8      QEALFGESLAHWLADGTSGAKVT-------------------------------------
Y5196_PSEAB      QEALFGKSLAHWLADGTSGAKVT-------------------------------------
Y4558_PSEA7      QERLFGESLAHWLAEGNASAKVT-------------------------------------
Y3168_ACIAD      LAAKLSIPLSTLFEAK--------------------------------------------
Y630_PSYWF       ARQELDIPLAKIFAHSLPREKVEVSHSVFSAQDADAKRTTSQSTTAEGGRQSAAEDGKFD
Y1543_ALCBS      MMAPLDISLDALFSAPSAEKERHPEQQGRND-----------------------------
Y901_SACD2       AKAHYGISLQALFSPQQVEELLEELPDEQSEKSK--------------------------
Y3006_TERTT      AESAFSVSLESLFAAEHEEE--KPLTDQT-------------------------------
Y2282_CELJU      RAQSWDLTLSAFFAVNQALDNAPPLAR---------------------------------
Y1578_COXBU      ------------------------------------------------------------
Y433_COXB2       ------------------------------------------------------------
Y1765_COXBR      ------------------------------------------------------------
Y1808_COXB1      ------------------------------------------------------------
Y409_COXBN       ------------------------------------------------------------
Y1895_CHRSD      RQQVLTQPMEHLLAEGARNDSP--------------------------------------
                                                                             

Y1670_HAEIE      ------------------------------------------------------------
Y4180_HAEIG      ------------------------------------------------------------
Y276_HAEIN       ------------------------------------------------------------
Y384_HAEI8       ------------------------------------------------------------
Y1616_PASMU      ------------------------------------------------------------
Y693_HAES1       ------------------------------------------------------------
Y1104_HISS2      ------------------------------------------------------------
Y1801_AGGAN      ------------------------------------------------------------
Y342_ACTSZ       ------------------------------------------------------------
Y032_MANSM       ------------------------------------------------------------
Y1950_ACTP2      ------------------------------------------------------------
Y1376_HAEPS      ------------------------------------------------------------
Y3482_PSYIN      ------------------------------------------------------------
YIHY_SHIDS       ------------------------------------------------------------
YIHY_SHIF8       ------------------------------------------------------------
YIHY_SHIB3       ------------------------------------------------------------
YIHY_ECOL5       ------------------------------------------------------------
YIHY_ECOL6       ------------------------------------------------------------
YIHY_ECOHS       ------------------------------------------------------------
YIHY_ECO81       ------------------------------------------------------------
YIHY_ECO8A       ------------------------------------------------------------
YIHY_ECOLU       ------------------------------------------------------------
YIHY_ECO5E       ------------------------------------------------------------
YIHY_ECO57       ------------------------------------------------------------
YIHY_ECO24       ------------------------------------------------------------
YIHY_ECOUT       ------------------------------------------------------------
YIHY_ECOSM       ------------------------------------------------------------
YIHY_ECOSE       ------------------------------------------------------------
YIHY_ECOLI       ------------------------------------------------------------
YIHY_ECODH       ------------------------------------------------------------
YIHY_ECOBW       ------------------------------------------------------------
YIHY_ECOLC       ------------------------------------------------------------
YIHY_ECO55       ------------------------------------------------------------
YIHY_SHIFL       ------------------------------------------------------------
YIHY_ECOK1       ------------------------------------------------------------
YIHY_ECO45       ------------------------------------------------------------
YIHY_SHIBS       ------------------------------------------------------------
YIHY_SHISS       ------------------------------------------------------------
YIHY_ECO27       ------------------------------------------------------------
YIHY_ECO7I       ------------------------------------------------------------
YIHY_ESCF3       ------------------------------------------------------------
YIHY_SALA4       ------------------------------------------------------------
YIHY_SALCH       ------------------------------------------------------------
YIHY_SALTI       ------------------------------------------------------------
YIHY_SALDC       ------------------------------------------------------------
YIHY_SALEP       ------------------------------------------------------------
YIHY_SALG2       ------------------------------------------------------------
YIHY_SALHS       ------------------------------------------------------------
YIHY_SALNS       ------------------------------------------------------------
YIHY_SALSV       ------------------------------------------------------------
YIHY_SALTY       ------------------------------------------------------------
YIHY_SALPB       ------------------------------------------------------------
YIHY_SALAR       ------------------------------------------------------------
Y3126_CITK8      ------------------------------------------------------------
Y4092_ENT38      ------------------------------------------------------------
Y5501_KLEP3      ------------------------------------------------------------
Y4136_KLEP7      ------------------------------------------------------------
Y4062_CROS8      ------------------------------------------------------------
Y028_YERPE       ------------------------------------------------------------
Y034_YERPG       ------------------------------------------------------------
Y3877_YERPP      ------------------------------------------------------------
Y3514_YERPA      ------------------------------------------------------------
Y254_YERPN       ------------------------------------------------------------
Y027_YERPS       ------------------------------------------------------------
Y030_YERP3       ------------------------------------------------------------
Y028_YERPB       ------------------------------------------------------------
Y4186_YERPY      ------------------------------------------------------------
Y031_YERE8       ------------------------------------------------------------
Y4878_SERP5      ------------------------------------------------------------
Y100_ALIF1       ------------------------------------------------------------
Y098_ALIFM       ------------------------------------------------------------
Y2938_ALISL      ------------------------------------------------------------
Y2742_VIBCH      ------------------------------------------------------------
Y3514_VIBC3      ------------------------------------------------------------
Y2662_VIBCM      ------------------------------------------------------------
Y1626_VIBCJ      ------------------------------------------------------------
Y885_VIBVU       ------------------------------------------------------------
Y203_VIBVY       ------------------------------------------------------------
Y126_VIBA3       ------------------------------------------------------------
Y593_VIBCB       ------------------------------------------------------------
Y125_VIBPA       ------------------------------------------------------------
Y3489_PHOPR      ------------------------------------------------------------
Y315_SHEB5       ------------------------------------------------------------
Y319_SHEB9       ------------------------------------------------------------
Y320_SHEB2       ------------------------------------------------------------
Y314_SHEB8       ------------------------------------------------------------
Y316_SHESM       ------------------------------------------------------------
Y3708_SHESR      ------------------------------------------------------------
Y311_SHESA       ------------------------------------------------------------
Y4401_SHEON      ------------------------------------------------------------
Y418_SHEPC       ------------------------------------------------------------
Y272_SHESW       ------------------------------------------------------------
Y4618_SHEWM      ------------------------------------------------------------
Y302_SHESH       ------------------------------------------------------------
Y3545_SHELP      ------------------------------------------------------------
Y3448_SHEDO      ------------------------------------------------------------
Y331_SHEFN       ------------------------------------------------------------
Y3404_SHEAM      ------------------------------------------------------------
Y3909_SHEPA      ------------------------------------------------------------
Y4118_AERS4      ------------------------------------------------------------
Y2447_IDILO      ------------------------------------------------------------
Y3526_ALTMD      ------------------------------------------------------------
Y3954_PSEA6      ------------------------------------------------------------
Y171_PSET1       ------------------------------------------------------------
Y609_COLP3       ------------------------------------------------------------
Y1325_CHLTE      ------------------------------------------------------------
Y1343_CHLP8      ------------------------------------------------------------
Y1013_CHLPB      ------------------------------------------------------------
Y1471_PROA2      ------------------------------------------------------------
Y1653_CHLPD      ------------------------------------------------------------
Y1623_PELPB      ------------------------------------------------------------
Y1323_PELLD      ------------------------------------------------------------
Y1521_CHLL2      ------------------------------------------------------------
Y935_CHLCH       ------------------------------------------------------------
Y461_TOLAT       ------------------------------------------------------------
Y865_STRMK       ------------------------------------------------------------
Y716_STRM5       ------------------------------------------------------------
Y937_XANAC       ------------------------------------------------------------
Y968_XANC5       ------------------------------------------------------------
Y860_XANCP       ------------------------------------------------------------
Y3370_XANC8      ------------------------------------------------------------
Y3490_XANCB      ------------------------------------------------------------
Y3615_XANOR      ------------------------------------------------------------
Y3417_XANOM      ------------------------------------------------------------
Y4555_XANOP      ------------------------------------------------------------
Y700_NEIMA       ------------------------------------------------------------
Y461_NEIM0       ------------------------------------------------------------
Y524_NEIMB       ------------------------------------------------------------
Y462_NEIMF       ------------------------------------------------------------
Y810_CHRVO       ------------------------------------------------------------
Y2978_LARHH      ------------------------------------------------------------
Y3165_AZOSB      ------------------------------------------------------------
Y4060_AROAE      ------------------------------------------------------------
Y4966_DELAS      ------------------------------------------------------------
Y3782_VEREI      ------------------------------------------------------------
Y2991_RHOFT      ------------------------------------------------------------
Y1422_METPP      ------------------------------------------------------------
Y2179_JANMA      ------------------------------------------------------------
Y3042_BORPD      ------------------------------------------------------------
Y3061_PARXL      ------------------------------------------------------------
Y1559_RALSO      ------------------------------------------------------------
Y452_NITMU       ------------------------------------------------------------
Y578_RHOCS       ------------------------------------------------------------
Y2625_RHORT      ------------------------------------------------------------
Y521_ALKEH       ------------------------------------------------------------
Y704_HALHL       ------------------------------------------------------------
Y1635_KANKD      ------------------------------------------------------------
Y2650_LEGPC      ------------------------------------------------------------
Y643_LEGPH       ------------------------------------------------------------
Y3681_AZOVD      ------------------------------------------------------------
Y2988_PSEMY      ------------------------------------------------------------
Y2825_PSEU5      ------------------------------------------------------------
Y951_PSEAE       ------------------------------------------------------------
Y4364_PSEA8      ------------------------------------------------------------
Y5196_PSEAB      ------------------------------------------------------------
Y4558_PSEA7      ------------------------------------------------------------
Y3168_ACIAD      ------------------------------------------------------------
Y630_PSYWF       AQPFDPNADVLPDSDSKEATNPPDADIKAAAAKGTVNSAQHSKHTETAKQEHKKTGLLGL
Y1543_ALCBS      ------------------------------------------------------------
Y901_SACD2       ------------------------------------------------------------
Y3006_TERTT      ------------------------------------------------------------
Y2282_CELJU      ------------------------------------------------------------
Y1578_COXBU      ------------------------------------------------------------
Y433_COXB2       ------------------------------------------------------------
Y1765_COXBR      ------------------------------------------------------------
Y1808_COXB1      ------------------------------------------------------------
Y409_COXBN       ------------------------------------------------------------
Y1895_CHRSD      ------------------------------------------------------------
                                                                             

Y1670_HAEIE      ------------------
Y4180_HAEIG      ------------------
Y276_HAEIN       ------------------
Y384_HAEI8       ------------------
Y1616_PASMU      ------------------
Y693_HAES1       ------------------
Y1104_HISS2      ------------------
Y1801_AGGAN      ------------------
Y342_ACTSZ       ------------------
Y032_MANSM       ------------------
Y1950_ACTP2      ------------------
Y1376_HAEPS      ------------------
Y3482_PSYIN      ------------------
YIHY_SHIDS       ------------------
YIHY_SHIF8       ------------------
YIHY_SHIB3       ------------------
YIHY_ECOL5       ------------------
YIHY_ECOL6       ------------------
YIHY_ECOHS       ------------------
YIHY_ECO81       ------------------
YIHY_ECO8A       ------------------
YIHY_ECOLU       ------------------
YIHY_ECO5E       ------------------
YIHY_ECO57       ------------------
YIHY_ECO24       ------------------
YIHY_ECOUT       ------------------
YIHY_ECOSM       ------------------
YIHY_ECOSE       ------------------
YIHY_ECOLI       ------------------
YIHY_ECODH       ------------------
YIHY_ECOBW       ------------------
YIHY_ECOLC       ------------------
YIHY_ECO55       ------------------
YIHY_SHIFL       ------------------
YIHY_ECOK1       ------------------
YIHY_ECO45       ------------------
YIHY_SHIBS       ------------------
YIHY_SHISS       ------------------
YIHY_ECO27       ------------------
YIHY_ECO7I       ------------------
YIHY_ESCF3       ------------------
YIHY_SALA4       ------------------
YIHY_SALCH       ------------------
YIHY_SALTI       ------------------
YIHY_SALDC       ------------------
YIHY_SALEP       ------------------
YIHY_SALG2       ------------------
YIHY_SALHS       ------------------
YIHY_SALNS       ------------------
YIHY_SALSV       ------------------
YIHY_SALTY       ------------------
YIHY_SALPB       ------------------
YIHY_SALAR       ------------------
Y3126_CITK8      ------------------
Y4092_ENT38      ------------------
Y5501_KLEP3      ------------------
Y4136_KLEP7      ------------------
Y4062_CROS8      ------------------
Y028_YERPE       ------------------
Y034_YERPG       ------------------
Y3877_YERPP      ------------------
Y3514_YERPA      ------------------
Y254_YERPN       ------------------
Y027_YERPS       ------------------
Y030_YERP3       ------------------
Y028_YERPB       ------------------
Y4186_YERPY      ------------------
Y031_YERE8       ------------------
Y4878_SERP5      ------------------
Y100_ALIF1       ------------------
Y098_ALIFM       ------------------
Y2938_ALISL      ------------------
Y2742_VIBCH      ------------------
Y3514_VIBC3      ------------------
Y2662_VIBCM      ------------------
Y1626_VIBCJ      ------------------
Y885_VIBVU       ------------------
Y203_VIBVY       ------------------
Y126_VIBA3       ------------------
Y593_VIBCB       ------------------
Y125_VIBPA       ------------------
Y3489_PHOPR      ------------------
Y315_SHEB5       ------------------
Y319_SHEB9       ------------------
Y320_SHEB2       ------------------
Y314_SHEB8       ------------------
Y316_SHESM       ------------------
Y3708_SHESR      ------------------
Y311_SHESA       ------------------
Y4401_SHEON      ------------------
Y418_SHEPC       ------------------
Y272_SHESW       ------------------
Y4618_SHEWM      ------------------
Y302_SHESH       ------------------
Y3545_SHELP      ------------------
Y3448_SHEDO      ------------------
Y331_SHEFN       ------------------
Y3404_SHEAM      ------------------
Y3909_SHEPA      ------------------
Y4118_AERS4      ------------------
Y2447_IDILO      ------------------
Y3526_ALTMD      ------------------
Y3954_PSEA6      ------------------
Y171_PSET1       ------------------
Y609_COLP3       ------------------
Y1325_CHLTE      ------------------
Y1343_CHLP8      ------------------
Y1013_CHLPB      ------------------
Y1471_PROA2      ------------------
Y1653_CHLPD      ------------------
Y1623_PELPB      ------------------
Y1323_PELLD      ------------------
Y1521_CHLL2      ------------------
Y935_CHLCH       ------------------
Y461_TOLAT       ------------------
Y865_STRMK       ------------------
Y716_STRM5       ------------------
Y937_XANAC       ------------------
Y968_XANC5       ------------------
Y860_XANCP       ------------------
Y3370_XANC8      ------------------
Y3490_XANCB      ------------------
Y3615_XANOR      ------------------
Y3417_XANOM      ------------------
Y4555_XANOP      ------------------
Y700_NEIMA       ------------------
Y461_NEIM0       ------------------
Y524_NEIMB       ------------------
Y462_NEIMF       ------------------
Y810_CHRVO       ------------------
Y2978_LARHH      ------------------
Y3165_AZOSB      ------------------
Y4060_AROAE      ------------------
Y4966_DELAS      ------------------
Y3782_VEREI      ------------------
Y2991_RHOFT      ------------------
Y1422_METPP      ------------------
Y2179_JANMA      ------------------
Y3042_BORPD      ------------------
Y3061_PARXL      ------------------
Y1559_RALSO      ------------------
Y452_NITMU       ------------------
Y578_RHOCS       ------------------
Y2625_RHORT      ------------------
Y521_ALKEH       ------------------
Y704_HALHL       ------------------
Y1635_KANKD      ------------------
Y2650_LEGPC      ------------------
Y643_LEGPH       ------------------
Y3681_AZOVD      ------------------
Y2988_PSEMY      ------------------
Y2825_PSEU5      ------------------
Y951_PSEAE       ------------------
Y4364_PSEA8      ------------------
Y5196_PSEAB      ------------------
Y4558_PSEA7      ------------------
Y3168_ACIAD      ------------------
Y630_PSYWF       FSHDKDAPIITEDDNPNK
Y1543_ALCBS      ------------------
Y901_SACD2       ------------------
Y3006_TERTT      ------------------
Y2282_CELJU      ------------------
Y1578_COXBU      ------------------
Y433_COXB2       ------------------
Y1765_COXBR      ------------------
Y1808_COXB1      ------------------
Y409_COXBN       ------------------
Y1895_CHRSD      ------------------