CLUSTAL format seed alignment for MF_00675

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UXAC_THEMA      ------MFLGEDYLLTNR----AAVRLFNE-VKDLPIVDPHNHLDAKDIVENKP-WNDIW
UXAC_THEP1      ------MFLGEDYLLTNR----AAVRLFNE-VKDLPIVDPHNHLDAKDIVENKP-WSDIW
UXAC_LACLM      -----MKFLSEDFLLNNE----SAKLLFHEHAEKMPIIDYHCHLEPAEIYENKK-YENLT
UXAC_LACLS      -----MKFLSEDFLLNNE----NAKLLFHKHAEKMPIIDYHCHLEQEEIYENKK-YENLT
UXAC_LACLA      -----MKFLSEDFLLTNE----SAKMLFHKHAEKMPIIDYHCHLEPAEIYENKK-YENLT
UXAC_LATSS      -----MQLLDDDFLLDND----MAKTLYHDYAAQMPIIDFHCHLNPSEIYQNKN-YTNIT
UXAC_CALS4      ----MRKFMDEDFLLTNE----TAVKLYHQYAKDMSIYDFHCHLSPKEIYEDRR-FKNIT
UXAC_CALS8      ----MKRFMDEDFLLNNQ----TAKVLYEKYAKDMPIIDFHCHLNPKEIYENKK-FRNIT
UXAC_CLOAB      ----MKNFMDEKFMLSTK----VAEDLYNDFAKDMPIIDYHCHISPQEICENKS-FKNIT
UXAC_BACSU      ----MEPFMGKNFLLKNE----TAVSLYHNYAKDMPIIDYHCHLSPKEIYENKT-FQNIT
UXAC_BACVZ      ----MKAFMGDDFLLNSK----TAVKLYREYAENMPIIDYHCHLSPKEIYENKT-FATIT
UXAC_BACLD      ----MKPFLNDDFLLTNE----TSKVLYHQYAKGMPIIDYHCHLSPKEIYENKT-FKNLT
UXAC_BACP2      ----MKAFLNEQFLLNSP----TAEKLYHEFAKDLPIIDYHCHLSPKDIYENKT-FRNIT
UXAC_OCEIH      ----MKKFMDDNFLLSND----TAEELFHHYAKDMPIIDYHCHLSPKEIYMNKR-YSNIT
UXAC_GEOTN      ----MQPFIDDRFLLQNK----HAEVLYHDYAKSLPIIDYHCHLSAKEIAEDRR-FHDMT
UXAC_GEOSE      ----MQPFIHENFLLQNK----HAEVLYHDYAKSLPIIDYHCHLSAKEIAEDRR-FHDMT
UXAC_ALKHC      ----MTNFLSEDFLLMNE----YDRELYYTFAKNMPICDYHCHLSPQEIWENKP-FENMT
UXAC_ECOLI      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_ECOK1      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_ECOL6      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_SHIF8      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_SHIBS      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_ECOL5      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_SHISS      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_SHIFL      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_ECOLC      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_ECOHS      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_ECO24      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_ECO57      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAEDYR-FKNLY
UXAC_CROS8      ----MTPFMTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPQQIAENYR-FKNLY
UXAC_PECAS      ----MPQFLSEDFLLDTE----FARRLYHEYAVDQPIFDYHCHLPPEQIAENYR-FKNLY
UXAC_YERP3      ----MSQFLTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPEQIAENYR-FKNMY
UXAC_YERPA      ----MSQFLTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPEQIAENYR-FKNMY
UXAC_YERPE      ----MSQFLTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPEQIAENYR-FKNMY
UXAC_YERPS      ----MSQFLTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPEQIAENYR-FKNMY
UXAC_YERPP      ----MSQFLTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPEQIAENYR-FKNMY
UXAC_YERPN      ----MSQFLTEDFLLDTE----FARRLYHDYAKDQPIFDYHCHLPPEQIAENYR-FKNMY
UXAC_YERE8      ----MAQFLTEDFLLDTE----FARRLYHDYAKDQPIYDYHCHLPPEQIAENTR-FKNLY
UXAC_SERP5      ----MATFLSEDFLLGNE----FARRLYHDYAADQPIFDYHCHLPPEQIAENTR-FKNLY
UXAC_SALPB      ----MATFMTEDFLLKND----IARTLYHKYAAPMPIYDFHCHLSPQEIADDRR-FDNLG
UXAC_SALCH      ----MATFMTEDFLLKND----IARTLYHKYAAPMPIYDFHCHLSPQEIADDRR-FDNLG
UXAC_SALTY      ----MATFMTEDFLLKND----IARTLYHKYAAPMPIYDFHCHLSPQEIADDRR-FDNLG
UXAC_SALTI      ----MATFMTEDFLLKND----IARTLYHKYAAPMPIYDFHCHLSPQEIADDRR-FDNLG
UXAC_SALPA      ----MATFMTEDFLLKND----IARTLYHKYAAPMPIYDFHCHLSPQEIADDRR-FDNLG
UXAC_SALAR      ----MTTFMTKDFLLKND----IARTLYHKYAAPMPIYDFHCHLSPQEIADDRR-FDNLG
UXAC_PHOLL      ----MKNFMCDDFLLNNE----TARQLYHEHAADMPIYDYHCHLNPREIAENRR-FDNLG
UXAC_VIBVY      ----MKNFLCEDFLLSNE----TARRLYHEHAFHQPIYDYHCHLNPAEVAQNRQ-FDNLG
UXAC_VIBPA      ----MKNFLCEDFLLSNE----TARRLYHEHAFHQPIYDYHCHLNPAEVTQNRQ-FDNLG
UXAC_VIBVU      ----MKNFLCEDFLLSNE----TARRLYHEHACHQPIYDYHCHLNPAEVAQNRQ-FDNLG
UXAC_HAEI8      ----MKQFMDENFLLSTD----TAKILYHDYAKNKPIFDYHCHLNPREVAENRQ-FNDLA
UXAC_HAEIG      ----MKSFMDENFLLSTD----TAKILYHDYAKNKPIFDYHCHLNPREVAENRQ-FNDLA
UXAC_HISS2      ----MMKFMTEDFLLSTS----TAQKLYHDYAEEQPIFDYHCHLNPKEIAENRQ-FNDLA
UXAC_MANSM      ----MKQFMDEDFLLSND----VARTLYYDYAKDQPIFDYHCHLPPKEIAENRQ-FKDLT
UXAC_ACTSZ      ----MKQFMDEDFLLSND----VARTLYFDYAKDQPIFDYHCHLPPKEIAENRL-FKDLT
UXAC_MARMS      ----MKNFMTEDFLLTTE----TAKRLYHEYAADQPIYDYHCHLSPQEIAENRR-FTDLG
UXAC_LACP7      ----MKPFMDKDFLLSTE----TAKTLYHDYAAQVPIIDYHCHINPEEIAKDRS-FDTIT
UXAC_CLOPE      ----MKKFMDKDFLLENE----VAKVLYHNYASKVPVFDYHCHLVPMEIATDHK-FKNLT
UXAC_BACTN      ----MKNFMDENFLLQTE----TAQKLYHEHAAKMPIIDYHCHLIPQMVADDYK-FKSLT
UXAC_PHOV8      ----MKNFMDENFLLQTE----TAQKLYHEHAAKMPIIDYHCHLIPQMVADDYQ-FKSLT
UXAC_BACFN      ----MKNFMDKNFLLQTE----TAQELYHNHAAKMPIIDYHCHLNPQMVADDYR-FKSLT
UXAC_BACFR      ----MKNFMDKNFLLQTE----TAQELYHNHAAKMPIIDYHCHLNPQMVADDYR-FKSLT
UXAC_FLAJ1      --MSANTFIHDNFLLENK----YAEELYHNYSKNQPIIDYHNHLNPQFIAEDKI-FDNIT
UXAC_ALKCK      MISTGKAFIHENFMLQNK----TAETLYHTYAKTLPIIDYHCHVPPQEIAENRQ-FNNIS
UXAC_STRA5      -----MAFNTETFMLKNQ----AAIQLYEEVKRQ-PIFDYHCHLDPKDIFEDHI-FDNIV
UXAC_STRA3      -----MTFNTETFMLKNQ----AAIQLYEEVKRQ-PIFDYHCHLDPKDIFEDRI-FDNIV
UXAC_STRA1      -----MTFNTETFMLKNQ----AALQLYEEVKRQ-PIFDYHCHLDPKDIFEDRI-FDNIV
UXAC_STAHJ      -----MAFINEHFMLNNE----TGKHLYHDFAKDMPIYDYHCHLDPKQISDNVA-CDNIT
UXAC_RHILO      ----MVALTDPDLLFPPEAHSRSLARDLYAGIKDLPIVSPHGHTDPRWYALNEP-FPDPA
UXAC_RHIME      ----MRGLIDPDLLFPAEERTRALARRLYAEVSGLPIVSPHGHTEPRWYALDEA-FPDPA
UXAC_BRUSU      ------MALNPDRLFSAEPGTREIARRLFASVEKLPIISPHGHTEPIWYARNEA-FPDPA
UXAC_BRUC2      ------MALNPDRLFSAEPGTREIARRLFASVEKLPIISPHGHTEPIWYARNEA-FPDPA
UXAC_BRUME      ------MALNPDRLFSAEPGTREIARRLFASVEKLPIISPHGHTEPIWYARNEA-FPDPA
UXAC_BRUSI      ------MALNPDRLFSAEPGTREIARRLFASVEKLPIISPHGHTEPIWYARNEA-FPDPA
UXAC_XANAC      -MRSSVLSLHPDRLLPADPGTRAIARRLYAQVATLPIISPHGHTDPAWFATNAP-FANAT
UXAC_XANOR      -MRSSVLSLHPDRLLPADPGTRAIAGRLYAQIATLPIISPHGHTDPAWFATNAP-FADAT
UXAC_XANCP      --MPTPLILHDDRLLPADPATRAIARRLYAQTAALPIISPHGHTDPAWFATDAP-FANAT
UXAC_XANC8      --MPTPLILHDDRLLPADPATRAIARRLYAQTAALPIISPHGHTDPAWFATDAP-FANAT
UXAC_CAUVC      --MARPLSFHEDRLFPSDPATRSYARGLYALVKDLPIISPHGHTDPSWFATNAP-FQDAT
UXAC_RHIWR      -MTAAPLRLHPDRLFPADPDTRVVARRLYAEVAGLPIVSPHGHTDPRWFAEDAP-FGDAS
UXAC_SPHAL      --MPRPLYLSPDRLFPSDPAQRDIARRLYKAVAGLPIVSPHGHTDPAWFAGDAP-FGNAA
UXAC_NOSP7      -MLTKKPVLSPDRCFSPEPVQRRLAHQFFDSISALPLVCPHGHVDPALLANPAARFGSPT
UXAC_COREF      -MSTSHAAHP-DRLLPADPATRDIARRLLTYVEDLPIISPHGHLEASMFVKDEP-FADPT
UXAC_CUTAK      -MSTPTLTLSEDRLLPRESSALAAAREIYRSTKGLPIISPHGHVPVSWIADDMA-FSDPT
                              :                    .:   * *                 

UXAC_THEMA      EVEGA----TDHYVWELMRRCGVSEEYITG--------SRSNKEKWLALAKVFPRFVGNP
UXAC_THEP1      EVEGA----TDHYVWELMRRCGISEEYITG--------SRSNKEKWLALAKVFPRFVGNP
UXAC_LACLM      QIWLG----GDHYKWRLLRANGIPEKLITG--------DGDDYEKFLAFAKTLEKSLGNP
UXAC_LACLS      QIWLG----GDHYKWRLLRANGIPEKLITG--------DGDDYEKFLAFAKTLEKSLGNP
UXAC_LACLA      QIWLG----GDHYKWRLLRANGIPEKLITG--------DGEDYEKFLAFAKTLEKSFGNP
UXAC_LATSS      RIWLNEGTYGDHYKWRLMRANGVDEKYITG--------DGDDYLKFIEWAKTIENAYGNP
UXAC_CALS4      EVWLY----GDHYKWRLMRANGIDEKYITG--------DADDYEKFVAYAKTIPMAIGNP
UXAC_CALS8      EVWLG----GDHYKWRLMRANGIEEKYITG--------SADDYEKFLAWAKTIPMAIGNP
UXAC_CLOAB      EVWLY----GDHYKWRLMRSSGVDEKYITG--------DSSDYEKFLAYVKAIETAIGNP
UXAC_BACSU      EAWLY----GDHYKWRIMRANGIEETYITG--------DAPDEEKFMAWAKTVPMAIGNP
UXAC_BACVZ      EAWLY----GDHYKWRIMRANGIEERCITG--------NASDEEKFFAWAKTVPMAIGNP
UXAC_BACLD      EVWLY----GDHYKWRAMRANGISEEFITG--------DASDEEKFSAWARTVPMTIGNP
UXAC_BACP2      EAWLY----GDHYKWRAMRANGIPETHVTG--------DASDYDKFLAWAKTVPMTIGNP
UXAC_OCEIH      EVWLY----GDHYKWRAMRAAGVEESLITG--------DANDYDKFMAWAETVPKLIGNP
UXAC_GEOTN      ELWLE----GDHYKWRAMRALGVEEKYITG--------SASPEEKFQAWAKTVPYCIGNP
UXAC_GEOSE      ELWLE----GDHYKWRAMRALGVEEKYITG--------NASPEEKFQAWAKTVPYCIGNP
UXAC_ALKHC      KAWLG----GDHYKWRAMRLNGVREEFITG--------GAPDKEKFLAWAKTVPKTIGNP
UXAC_ECOLI      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_ECOK1      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_ECOL6      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_SHIF8      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_SHIBS      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_ECOL5      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_SHISS      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_SHIFL      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_ECOLC      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_ECOHS      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_ECO24      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_ECO57      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_CROS8      DIWLK----GDHYKWRAMRTNGVPERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_PECAS      DIWLK----GDHYKWRAMRTNGVPERLCTG--------DASDWEKFEAWAATVPHTIGNP
UXAC_YERP3      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_YERPA      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_YERPE      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_YERPS      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_YERPP      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_YERPN      DIWLK----GDHYKWRAMRTNGVAERLCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_YERE8      DIWLK----GDHYKWRAMRTNGVAERFCTG--------DASDREKFDAWAATVPHTIGNP
UXAC_SERP5      EIWLK----GDHYKWRAMRTNGVAERLCTG--------DAGDREKFDAWAATVPHTIGNP
UXAC_SALPB      QIWLE----GDHYKWRALRSAGVDESLITGK-------ETSDYEKYMAWANTVPKTLGNP
UXAC_SALCH      QIWLE----GDHYKWRALRSAGVDESLITGK-------ETSDYEKYMAWANTVPKTLGNP
UXAC_SALTY      QIWLE----GDHYKWRALRSAGVDESLITGK-------ETSDYEKYMAWANTVPKTLGNP
UXAC_SALTI      QIWLE----GDHYKWRALRSAGVDESLITGK-------ETSDYEKYMAWANTVPKTLGNP
UXAC_SALPA      QIWLE----GDHYKWRALRSAGVDESLITGK-------ETSDYEKYMAWANTVPKTLGNP
UXAC_SALAR      QIWLE----GDHYKWRALRSAGVDESLITGK-------ETSDYEKYMAWANTVPKTLGNP
UXAC_PHOLL      QIWLE----GDHYKWRAMRCAGIDESLITGK-------QTRDYEKYQAWAETVPLTLGNP
UXAC_VIBVY      QIWLE----GDHYKWRGMRSAGIEERLITG--------DASDYDKYMAWAKTVPQTLGNP
UXAC_VIBPA      QIWLE----GDHYKWRGMRSAGIEERLITG--------DASDYDKYMAWAKTVPQTLGNP
UXAC_VIBVU      QIWLE----GDHYKWRGMRSAGIEERLITG--------DASDYDKYMAWAKTVPQTLGNP
UXAC_HAEI8      EIWLE----GDHYKWRALRTAGVPEELITG--------KATNYQKYLAWAKTVPLCIGNP
UXAC_HAEIG      EIWLE----GDHYKWRALRTAGVPEELITG--------KATNYQKYLAWAKTVPLCIGNP
UXAC_HISS2      EIWLE----GDHYKWRAMRSAGVEEHLITG--------SADKYSKYLAFANTVPKCIGNP
UXAC_MANSM      EIWLA----GDHYKWRAMRSAGVDENLITG--------NASNYEKYQAWAKTVPLCIGNP
UXAC_ACTSZ      EIWLA----GDHYKWRAMRSAGFDENVITG--------NASAYEKYQAWAKTVPLCIGNP
UXAC_MARMS      EIWLE----GDHYKWRAMRTAGIEERLVTG--------NASFKEKYQAWAKTVPQCIGNP
UXAC_LACP7      QVWLG----GDHYKWRQMRSNGIDEKYITG--------DASDIEKFEKWAETLQKAIGNP
UXAC_CLOPE      EMWLY----HDHYKWRAMRSFGIDEEYITG--------NASDYDKFYQFAKMMPYLIGNP
UXAC_BACTN      EIWLG----GDHYKWRAMRTNGVDERYCTGK-------DTTDWEKFEKWAETVPYTFRNP
UXAC_PHOV8      EIWLG----GDHYKWRAMRTNGVDERYCTGK-------DTTDWEKFEKWAETVPYTFRNP
UXAC_BACFN      EIWLG----GDHYKWRAMRSNGVDECFCTGK-------ETSDWEKFEKWAETVPYTFRNP
UXAC_BACFR      EIWLG----GDHYKWRAMRSNGVDECFCTGK-------ETSDWEKFEKWAETVPYTFRNP
UXAC_FLAJ1      NVWIN----GDHYKWRAMRTLGIDEQFVTGN-------G-SDKDKFLNWAKTVPYTMRNP
UXAC_ALKCK      EIWLH----GDHYKWRAMRAVGVEETFITGD-------G-DDKEKFLKWAETVPYTMGNP
UXAC_STRA5      DLWLG----GDHYKWRLMRANGISEAEITG--------PASNLEKFKAFARTLERAYGNP
UXAC_STRA3      DLWLG----GDHYKWRLMRANGISEAEITG--------PASNLEKFKAFARTLERAYGNP
UXAC_STRA1      DLWLG----GDHYKWRLMRANGISEAEITG--------PASNLEKFKAFARTLERAYGNP
UXAC_STAHJ      DLWLS----GDHYKWRAMRAQGIEEQYITG--------DAAPLDKFKKWTETLENSVGNP
UXAC_RHILO      QLLIV----PDHYIFRMLFSQGVRLEDLGVASLDGAPVETDGRTIWRRFAEHYYLFRGTP
UXAC_RHIME      QLLIV----PDHYVFRMLFSQGIRLEELGVPALDGSPVETDGRAIWRRFCENYHLFRGTP
UXAC_BRUSU      SLFVK----PDHYITRMLYSQGHSLESLGIASRDGRPSETDARKIWRLFATNWYLFRATP
UXAC_BRUC2      SLFVK----PDHYITRMLYSQGHSLESLGIASRDGRPSETDARKIWRLFATNWYLFRATP
UXAC_BRUME      SLFVK----PDHYITRMLYSQGHSLESLGIASRDGRPSETDARKIWRLFATNWYLFRATP
UXAC_BRUSI      SLFVK----PDHYITRMLYSQGHSLESLGIASRDGRPSETDARKIWRLFATNWYLFRATP
UXAC_XANAC      ELLLV----PDHYVFRMLYSQGIDLDALGIPRADGTRATVDPRAAWRVFAEHYTLLRGTP
UXAC_XANOR      ELLLV----PDHYVFRMLYSQGIDLDAIGIPRADGMRAAVDPRAAWRVFAAHYTVLRGTP
UXAC_XANCP      ELLLV----PDHYVFRMLYSQGIDLDQLGIPHADGSRAPVDPREAWRVFASQFALLRGTP
UXAC_XANC8      ELLLV----PDHYVFRMLYSQGIDLDQLGIPHADGSRAPVDPREAWRVFASQFALLRGTP
UXAC_CAUVC      DLLLA----PDHYLFRMLYSQGVSLDALKVRSKAGV-PDTDPREAWRVFASHFYLFRGTP
UXAC_RHIWR      SLLLQ----PDHYVFRMLYSQGVPLEAIGIG------APVDPRAAWRVLADHYHLFRGTP
UXAC_SPHAL      ELLLH----PDHYVFRMLYSQGVSLDALGIGN-----ADADPRESWRLFAENYHLFRATP
UXAC_NOSP7      ELFII----PDHYILRMLYSRGVPLEALGIPTRD-APTETDHRKIWQLFAEHFYLFQGTP
UXAC_COREF      TLLIS----PDHYLTRVLHSAGVDLADLRVGGTEG----KTPREAWRIFASNWDLYTGTA
UXAC_CUTAK      SLLIT----PDHYVNRLLHANGVDLEDLGVGRKTMS--EEDNRRAFRILCEHWRDFAGTA
                          ***  . :   *                       :            ..

UXAC_THEMA      TYEWIHLDLWRRFNIKKVI-SEETAEEIWEETKKKL--PEMTPQKLLRDMKVEILCTTDD
UXAC_THEP1      TYEWIHLDLWRRFNIKKVI-SEETAEEIWEETKKKL--PEMTPQKLLRDMKVEILCTTDD
UXAC_LACLM      IYEWTHLELKRFFHIDKLI-SSETEKEIWDEANQMLATDDFRPRALIKNSNVKVVCTTDD
UXAC_LACLS      IYEWTHLELKRFFHIDKLI-SSETAKEIWDEANQMLATDDFRPRALIKNSNVKVVCTTDA
UXAC_LACLA      IYEWTHLELKRFFHIDKLI-SSETAKEIWDEANQMLATDDFRPRALIKNSQVKVVCTTDD
UXAC_LATSS      LYEWTHLELRRFFHIDERL-TAESAPRIWEKANQLLQTDDFKPRQLIKNSNVQVVCTTDD
UXAC_CALS4      VYHWTHLELQRYFGIYDLL-NEKTAKSIWERANEVISQEDFSARNILKKSNVKVVITTDD
UXAC_CALS8      IYHWTHLELKRYFGIDEIL-NEKSAPIIWEKANKVL--EELGARDIILKSNVEVICTTDD
UXAC_CLOAB      LYHWSHLELQRYFGVYEVI-SEKNAPVIWEKANKVLN-DGLTVREIIKKSNVKAICTTDD
UXAC_BACSU      LYNWTHLELQRFFGIYEIL-NEKSGSAIWKQTNKLLKGEGFGARDLIVKSNVKVVCTTDD
UXAC_BACVZ      LYSWTHLELQRWFGIYDVL-NEKTAAAIWKKTNELLQGDGFGARDLILKSNVKVICTTDD
UXAC_BACLD      LYHWTHLELRRFFGIDDRL-DEKSAPHIWERVNEQLAGGGFGARDLIEKSNVETVVTTDD
UXAC_BACP2      LYHWTHLELRRYFEVQDLL-NEKNADTIWQKVNEKLQEEGFGARDFIMKSNVETVVTTDD
UXAC_OCEIH      LYNWTHLELQRYFGVDEIL-NKESGPSIWEKVNKCLAQDDFGVRELINQSNVQVVCTTDD
UXAC_GEOTN      LYHWTHLELKRYFQVGVLL-NEQTWKEVWDHCNELLQQEGYSARSFMIQSNVEWIGTTDD
UXAC_GEOSE      LYHWTHLELKRYFQVDALL-NERTWREIWNHCNDLLRQEGFSARSFMVKSNVEWIGTTDD
UXAC_ALKHC      LYHWTHMELKTYFHFHQPL-DETNGENVWDACNRLLQQEAFTPRALIERSNVRAIGTTDD
UXAC_ECOLI      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_ECOK1      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_ECOL6      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_SHIF8      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_SHIBS      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_ECOL5      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_SHISS      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_SHIFL      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_ECOLC      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_ECOHS      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_ECO24      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_ECO57      LYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDD
UXAC_CROS8      LYHWTHLELRRPFGITGKLLSPKTADEIWNQCNDLLAQDAFSARGIMQQMNVKMVGTTDD
UXAC_PECAS      LYHWTHLELRRPFGVTGTLLSPSTAKGIWDRCNAMLERDDFTARGIMQQMNVKMVGTTDD
UXAC_YERP3      LYHWTHLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDD
UXAC_YERPA      LYHWTHLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDD
UXAC_YERPE      LYHWTHLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDD
UXAC_YERPS      LYHWTHLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDD
UXAC_YERPP      LYHWTHLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDD
UXAC_YERPN      LYHWTHLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDD
UXAC_YERE8      LYHWTHLELRRPFGITGKLLSPATADEIWQRGNELLAQDSFSARGIMQKMNVKMVGTTDD
UXAC_SERP5      LYHWTHLELRRPFGITGTLLSPTTADDIWQRGNALLAQDDFRARGIMQQMNVKMVGTTDD
UXAC_SALPB      LYHWTHLELRRPFGITGTLFGPDTAESIWTQCNEKLATPAFSARGIMQQMNVRMVGTTDD
UXAC_SALCH      LYHWTHLELRRPFGITGTLFGPDTAESIWTQCNEKLATPAFSARGIMQQMNVRMVGTTDD
UXAC_SALTY      LYHWTHLELRRPFGITGTLFGPDTAESIWTQCNEKLATPAFSARGIMQQMNVRMVGTTDD
UXAC_SALTI      LYHWTHLELRRPFGITGTLFGPDTAESIWTQCNEKLATPAFSARGIMQQMNVRMVGTTDD
UXAC_SALPA      LYHWTHLELRRPFGITSTLFGPDTAESIWTQCNEKLATPAFSARGIMQQMNVRMVGTTDD
UXAC_SALAR      LYHWTHLELRRPFGITDTLFGPDTAESIWTQCNEKLATPAFSARGIMQQMNVRMVGTTDD
UXAC_PHOLL      LYHWTHLELRRPFGISGILFGPQTADEIWHQCNEKLAAPAFSARGIMQQMNVRMVGTTDD
UXAC_VIBVY      LYHWTHLELRRPFGITNALFSPDTADQIWHQCNELLATPEFTARGIMQQMNVVMAGTTDD
UXAC_VIBPA      LYHWTHLELRRPFGITNTLFSPDTADQIWHQCNELLATPEFTARGIMQQMNVVMAGTTDD
UXAC_VIBVU      LYHWTHLELRRPFGITNTLFSPDTADQIWHQCNELLATPEFTARGIMQQMNVVMAGTTDD
UXAC_HAEI8      IYHWTHLELRRPFGITNMLFNPQNAEKIWHQCNEMLQQPEFSARGIMQKMNVKLVGTTDD
UXAC_HAEIG      IYHWTHLELRRPFGITNMLFNPQNAEKIWHQCNEMLQQPEFSARGIMQKMNVKLVGTTDD
UXAC_HISS2      IYHWTHLELRRPFGITDTIFSPETAEKIWHKGKELLQQPEFSARGIMKKMNVNLVGTTDD
UXAC_MANSM      IYHWTHLELRRPFGITNTLFNPQSADKIWQECNELLQQPEFSARGIMRQMNVKFSGTTDD
UXAC_ACTSZ      IYHWTHLELRRPFGITDTLFGPQSADKIWQECNELLQQPEFSARGIMRRMNVKFSGTTDD
UXAC_MARMS      IYHWTHLELRRPFGITDVLFSPKTADAIWDQCNEMLQQPEFSARGIMQQMKVKMVGTTDD
UXAC_LACP7      LYHWSHLELQRYFDYYGTL-SAKTSEEVFKLCNEKLSQPEMSVRGLIKESNVDTICTTDD
UXAC_CLOPE      IYHWSHLELKRFFGVEETL-SEKTASTIWEKCNKVIENNNLTAKKLIEMANVVYIGTTDD
UXAC_BACTN      LYHWTHLELKTAFGIDKIL-SPKTAREIYDECNEKLAQPEYSARGMMRRYHVEVVCTTDD
UXAC_PHOV8      LYHWTHLELKTAFGINKVL-NPKTAREIFDECNEKLAKPEYSARGMMRRYHVETVCTTDD
UXAC_BACFN      LYHWTHLELKTAFGIDKVL-NPKTAREIYDECNEKLSSQEYSARGMMRRYHVETVCTTDD
UXAC_BACFR      LYHWTHLELKTAFGIDKVL-NPKTAREIYDECNEKLSSQEYSARGMMRRYHVETVCTTDD
UXAC_FLAJ1      LYHWTHLELARYFDIYDLL-NEKSAEKIYTETTEKINSQAYSTQNLLKKVNAELVCTTED
UXAC_ALKCK      LYHWTHLELKRYFGIDELL-SSETAEAIWSATKEQLAAPERSVQGIIKESNVKVICTTDD
UXAC_STRA5      VYHWSAMELKNVFGVNEIL-TESNAEEIYHRLNHFLKEHKISPRRLIADSKVMFIGTTDH
UXAC_STRA3      VYHWSAMELKNVFGVNEIL-TESNAEEIYHRLNHFLKEHKISPRRLIADSKVMFIGTTDY
UXAC_STRA1      VYHWSAMELKNVFGVNEIL-TESNAEEIYHRLNHFLKEHKINPRRLIADSKVMFIGTTDH
UXAC_STAHJ      LYHWSQLELKMYFDIEDLL-TSDNAEAIYHRANDYLKQHHTTTQSLITDSNVNLICTTDN
UXAC_RHILO      TRLWFDHVLAHLFGIEE-PLDATTADRHYDTIATVLQWENFRPRALFERFNIEVIATTEG
UXAC_RHIME      TRLWFDYTLSELFGIDE-LPSAASSDPLYDHVAECLTRPDYRPRALYERFNIEVISTTDS
UXAC_BRUSU      SRLWFEHAMETVFGITE-RLSQENADRIFDAIADQLTQPHMRPRALYDRFNIEAISTTDA
UXAC_BRUC2      SRLWFEHAMETVFGITE-RLSQENADRIFDAIADQLTQPHMRPRALYDRFNIEAISTTDA
UXAC_BRUME      SRLWFEHAMETVFGITE-RLSQENADRIFDAIADQLTQPHMRPRALYDRFNIEAISTTDA
UXAC_BRUSI      SRLWFEHAMETVFGITE-RLSQENADRIFDAIADQLTQPHMRPRALYDRFNIEAISTTDA
UXAC_XANAC      SALWLNHVFHDVFDLRI-RLDAGTADHYYDHITAALQTPAFLPRALFERFNIEVIATTES
UXAC_XANOR      SALWLNHVFHDVFDLRL-RLDAGTADHYYDHITAALQTPDFLPRALFERFNIEVIATTES
UXAC_XANCP      SALWLNHVFHQVFDLRI-RLDAGSADHYYDHITAALQTPAFRPRALFERFNIEVIATTES
UXAC_XANC8      SALWLNHVFHQVFDLRI-RLDAGSADHYYDHITAALQTPAFRPRALFERFNIEVIATTES
UXAC_CAUVC      SWVWLNHVFSQVFGFTE-FLEASNADDYFDRITAALATDAFRPRALFDRFNIETLATTEG
UXAC_RHIWR      SRLWLDWVFHSVFGLDV-RLAPETADLTFDSINEQLARPEFRPRALFDRFNIELLATTES
UXAC_SPHAL      SRMWMDWVFAEVFGFDV-QLSAETSDLYYDRITEALAIDAFRPRALFDRFGIEVIATTES
UXAC_NOSP7      SGLWLKDELTNVFGVDE-ALNSRNAGRIYDYLEGLLALPKFSPRALFKRFNIEVLCTTDA
UXAC_COREF      TGYWVEQEFEHVFGINPDRLSAENADDIYDELSEILARPDFRPRALAEQFNLEILATTDD
UXAC_CUTAK      MRYWLVDQLIGIFGITE-RPSPENADRIYDTIAERIAQPDFLPRALMDSFDIAFIATTDD
                   *    :   *          .    :      :       : :          **: 

UXAC_THEMA      PVSTLEHHRKAKEAV----EGVTILPTWRPDRAMNV-DKEGWREYVEKMGERYGEDTSTL
UXAC_THEP1      PVSTLEHHRKAKEVV----EGVTILPTWRPDRAMNV-DKEGWKEYVEKMGERYGEDTSTL
UXAC_LACLM      PVSKLSYHKSLAKEE----KDFKVLPALRPDHLISI-TDGHFAEYLMELSAVSGIKIKDF
UXAC_LACLS      PVSKLSYHKSLAKEE----KDFKVLPALRPDHLISI-TDGHFAEYLTELSAVSGIKIKDF
UXAC_LACLA      PVSTLSYHKLLAKEE----KDFKVLPALRPDHLISI-TDGHFADYLTELSAVSGIEIKGF
UXAC_LATSS      PASDLHYHQLLKPEEA--ANGFKTLPAMRPDQLMQI-DRDGFGDYLKTLGKVAGVEIHDF
UXAC_CALS4      PVDSLEYHIKLKEEK---DFDIKVLPAFRPDKGLNI-EKDDFLSWIKKLESASGIKITTY
UXAC_CALS8      PVDTLEYHLKLKDDK---NFNVKVYPTFRPDKGVNI-ERETFIPWVEKLGEVYGKKIESY
UXAC_CLOAB      PIDSLEYHLKLKEDT---SFNVKVLPAFRPDKALGI-NKDGYTDWVSKLAKVSKKNINSY
UXAC_BACSU      PVDSLEYHLLLKEDK---DFPVSVLPGFRPDKGLEI-NREGFPEWVQALEDAAAISITTY
UXAC_BACVZ      PADALTYHELLKES----DFPVQVLPGFRPDKGLDI-SSPGFADWVRSLESASGMAVSSY
UXAC_BACLD      PTDSLEYHVKLKDE----DFNVSVLPGFRPDKAMEI-NQEGFAAWVRKLETASGMKIANY
UXAC_BACP2      PIDSLQYHQKLREE----GFSVQVLPGFRPDKALDI-ANDLFEKYVHELAEASAISIQSY
UXAC_OCEIH      PIDDLSFHQMLVEDD---DFSVKVLPGFRPDKAIEI-NQEGFIDYVDSLEKVTSHSTKTY
UXAC_GEOTN      PLDDLMDHQKIAQDS---SFSIKVVPSFRPDAVIEI-NRPSFLDYVSKLGEVADLSVDDY
UXAC_GEOSE      PLDDLADHQAIAQDP---SFLVKIVPSFRPDAVIEI-NRPSFLDYVGKLGEALACRFMIT
UXAC_ALKHC      PTDSLLYHQKLQADD---TFHVKVIPTFRPDGALKI-EQDSFADWVAKLSDVTGESLDTL
UXAC_ECOLI      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_ECOK1      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_ECOL6      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_SHIF8      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_SHIBS      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_ECOL5      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_SHISS      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_SHIFL      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_ECOLC      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_ECOHS      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_ECO24      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_ECO57      PIDSLEHHAEIAKDG---SFTIKVLPSWRPDKAFNI-EQATFNDYMAKLGEVSDTDIRRF
UXAC_CROS8      PIDSLEHHATIAKDS---AFTVKVLPSWRPDKAFNI-EQATFADYMAKLAEVSDTDIRRF
UXAC_PECAS      PIDDLRHHKAVAQDS---SFSIKVLPSWRPDKAFNI-ELATFNDYMAKLGEVSDTDIRRF
UXAC_YERP3      PIDDLRHHKAIAADG---SFNIKVLPSWRPDKAFNI-EAAGFNDYMQRLEAAADTSISRF
UXAC_YERPA      PIDDLRHHKAIAADG---SFNIKVLPSWRPDKAFNI-EAAGFNDYMQRLEAAADTSISRF
UXAC_YERPE      PIDDLRHHKAIAADG---SFNIKVLPSWRPDKAFNI-EAAGFNDYMQRLEAAADTSISRF
UXAC_YERPS      PIDDLRHHKAIAADG---SFNIKVLPSWRPDKAFNI-EAAGFNDYMQRLEAAADTSISRF
UXAC_YERPP      PIDDLRHHKAIAADG---SFNIKVLPSWRPDKAFNI-EAAGFNDYMQRLEAAADTSISRF
UXAC_YERPN      PIDDLRHHKAIAADG---SFNIKVLPSWRPDKAFNI-EAAGFNDYMQRLEAAADTSISRF
UXAC_YERE8      PIDDLRHHKAIAADG---SFNIKVLPSWRPDKAFNI-EAAGFNDYMQRLEAAADTSISRF
UXAC_SERP5      PIDDLRHHKAIAADS---SFDIKVLPSWRPDKAFNI-DAPGFNDYLQKLEAAADINIGRF
UXAC_SALPB      PIDSLEYHRQIAADD---SIDIEVAPSWRPDKVFKI-ELDGFVDYLRKLEAAADVSITRF
UXAC_SALCH      PIDSLEYHRQIAADD---SIDIEVAPSWRPDKVFKI-ELDGFVDYLRKLEAAADVSITRF
UXAC_SALTY      PIDSLEYHRQIAADD---SIDIEVAPSWRPDKVFKI-ELDGFVDYLRKLEAAADVSITRF
UXAC_SALTI      PIDSLEYHHQIAADD---SIDIEVAPSWRPDKVFKI-ELDGFVDYLGKLEAAADVSITRF
UXAC_SALPA      PIDSLEYHRQIAADD---SINIEVAPSWRPDKVFKI-ELDGFVDYLGKLEAAADVSITRF
UXAC_SALAR      PIDSLAYHRQIAADD---SFGIEVAPSWRPDKAFKI-ELDGFVDYLGKLEAAADVNITRF
UXAC_PHOLL      PVDSLQYHRQIATDE---SFDIEVLPSWRPDRVFKI-ELAGFIDYIKQLEAVADVSIVAF
UXAC_VIBVY      PIDSLEHHKAIAEDD---TFNVKVLPSWRPDKAFKI-ELDVFADYMHKLGEVADIEIRRF
UXAC_VIBPA      PIDSLEHHKAIAEDD---TFNVKVLPSWRPDKAFKI-ELDLFADYMHKLGEVADIDIRRF
UXAC_VIBVU      PIDSLKHHKTIAEDD---TFNVKVLPSWRPDKAFKI-ELDLFADYMHKLGEVADIEIRRF
UXAC_HAEI8      PIDSLQYHQAIKNDE---SFDIDVVPSWRPDKVFKI-ELPQFNDYLVQLSEIADVDIYTF
UXAC_HAEIG      PIDSLQYHQAIKNDE---SFDIDVVPSWRPDKVFKI-ELPQFNDYLVQLSEIADVDIYTF
UXAC_HISS2      PIDSLEYHKAIAEDN---TFDVEVVPSFRPDRAFKI-ELPLFNDYIEQLGKVADIEINTF
UXAC_MANSM      PIDSLEYHKAIAEDR---DFDIEVAPSWRPDKAVKI-ELPQFNDYIKQLEQVSDTEINGF
UXAC_ACTSZ      PIDSLEYHKAIAEDN---AFDIEVAPSWRPDKAVKI-ELDQFNDYLEQLERVSDTDINSF
UXAC_MARMS      PADSLEHHKFIANDN---SFDIAVTPSWRPDRAFKV-DHVGFKDYLNKLGKAADINITRF
UXAC_LACP7      PIDSLEWHKAIAKDS---TFDVKVLPAWRPDKAMNL-EKPDYLDYLAKLESVSGVKIASF
UXAC_CLOPE      PIDDLRYHKQLKEDI---NFKCSVNPSFRPEKAMKI-QNEGFKEYIGKLAEVSNVEIKSF
UXAC_BACTN      PIDSLEYHIQTR-ES---GFEIKMLPTWRPDKAMAVEVPADFRAYVEKLSAVSGVTISNF
UXAC_PHOV8      PVDSLEYHIKTR-ES---GFEIKMLPTWRPDKAMAVEVPADFRAYMEKLSAVSGVTISSF
UXAC_BACFN      PIDSLEYHIRTR-ES---GFEIKMLPTWRPDKVMAVEVPSDFRTYIEKLSEISEITISDY
UXAC_BACFR      PIDSLEYHIRTR-ES---GFEIKMLPTWRPDKVMAVEVPSDFRTYIEKLSEISEITISDY
UXAC_FLAJ1      PIDSLEFHKKFA-NN---STGIKMSTAFRPDKAILI-ANDGYNAYLDTLGDVSGVAINTF
UXAC_ALKCK      PSDHLEAHQQIRKEG---ACQAAVYPAFRPDKALVA-SAPSFVPYLETLGAAAEVDISSL
UXAC_STRA5      PLDTLEWHKKLAADE---SFKTVVAPTFRPDEAF-IEHRH-FVDFITKLGDITQKEITDF
UXAC_STRA3      PLDTLKWHKKLAADE---SFKTVVAPTFRPDEAF-IEHRH-FVDFITKLGDITQKEITDF
UXAC_STRA1      PLDTLEWHKKLAADE---SFKTVVAPTFRPDEAF-IEHRH-FVDFITKLGDITQKEITDF
UXAC_STAHJ      PTDDLNYHDAIKAKD---GFNTTVLPAFRPDDVFKVGDPA-FTDLLQKLENLTH-PITTP
UXAC_RHILO      ALDDLEWHKMIRDSG----WEGRVVTAYRPDAVVDP-DFEGFSANLDRLGEITGCDTGSW
UXAC_RHIME      ALDDLGWHAKILESG----WKGRVVPAYRPDAVVDP-DFQGFPTNLDKLGDITGADTGTW
UXAC_BRUSU      ATDPLIYHDEVIASG----WHGRIIPAYRPDAAVDA-GRPDFASEVEKLVGVAGTPL-TW
UXAC_BRUC2      ATDPLIYHDEVIASG----WHGRIIPAYRPDAAVDA-GRPDFASEVEKLVGVAGTPL-TW
UXAC_BRUME      ATDPLIYHDEVIASG----WHGRIIPAYRPDAAVDA-GRPDFASEVEKLVGVAGTPL-TW
UXAC_BRUSI      ATDPLIYHDEVIASG----WHGRIIPAYRPDAAVDA-GRPDFASEVEKLVGVAGTPL-TW
UXAC_XANAC      PLDRLQHHAAIAASG----WQGRVVTAYRPDPVVDP-EHEQFAGALQQFGALTGEDVLTW
UXAC_XANOR      PLDPLHHHAAIAASG----WQGRVVTAYRPDPVVDP-EHAQFAGALQQFGALTGEDVLTW
UXAC_XANCP      PLDTLEHHATIRDSG----WTGRVLTAYRPDAVVDP-EHEQFASALQQFAALTGEDVMQW
UXAC_XANC8      PLDTLEHHATIRDSG----WTGRVLTAYRPDAVVDP-EHEQFASALQQFAALTGEDVMQW
UXAC_CAUVC      PHESLQHHAAIRESG----WGGHVITAYRPDAVIDF-EDERSPRAFERFAETSGQDVYSW
UXAC_RHIWR      PLDPLDHHAAIRASG----WTGRVITAFRPDPVVDP-DFEGFAANLDRLGAMTGEDVGSY
UXAC_SPHAL      PLDSLDHHAVIRAANASGEWGGRVITAYRPDPVVDP-EFEGFRDNLARFSNLSGEDAFSY
UXAC_NOSP7      ASDNLENQRSLHEEG-----FTQIRPTFRPDAVVNL-DAPGWRENLTKLESSIGREISSY
UXAC_COREF      PLDDLADHKALAQDPT---FSPRVLPTFRPDAYTKM-YNPGWAEKTTRLIDVAGDGKAGW
UXAC_CUTAK      PCDDLDGHARLAADET---FTRRVAPTFRPDKYLEP-AAGGWTGLLARLSEVSGCDATTL
                . . *  :                 .  **:                 :           

UXAC_THEMA      DGFLNALWKSHEHFKEHGCVASDHALLEPSVYY-VDENRARAVHEKAFSGEKLTQDEIND
UXAC_THEP1      EGFLSALWKSHEHFKEHGCVASDHALLEPSIYY-VDENRARAIHEKAFSGEKLTQDEIND
UXAC_LACLM      KTMIKALEQRFEFFTSLGGRLSDHSLSTYTFAE-TKNVDLDSILQKAKENQTLTDLEYNQ
UXAC_LACLS      KTMIKALEQRFEFFTSLGGRLSDHSLSTYTFAE-TDDVDLDSIIQRAKEKQTLTDLEYNQ
UXAC_LACLA      KTMIKALEQRFEFFTSLGGRLSDHSLSTYTFAE-TKNVDLDSILQKAKENQTLTDLEYNQ
UXAC_LATSS      ATIVTALTQRFEFFNKMGGRLSDHSLLTYHFEE-ATPAELDAIVAKGINNAALSEHEINQ
UXAC_CALS4      DDFLQALEKRIEFFHSVGCRISDHALDYVFYQK-TSKQEAEKVFKKVLTEQHLTKEEIDS
UXAC_CALS8      DEFLDALKSRAEFFHSVGCRASDHAIDNMVFAE-ASFDEVANIFKKALAGEKLTEIEVAK
UXAC_CLOAB      DMFLEALNDRIEFFHSVGGRVSDHALDYVPYLE-ASKEEVNTIFAKALKGEKVSFEEETK
UXAC_BACSU      DEFLKALEKRVRFFHSAGGRVSDHAIDTMVFAE-TTKEEAGRIFSDRLQGTEVSCEDEKK
UXAC_BACVZ      QSYLDALESRVRFFHNAGGRVSDHALDQMVYAE-TTEEEAARIFAAGLSGEHVSFEDEKK
UXAC_BACLD      DDFLKALKNRIDFFHEAGGRISDHAINQMMYTE-TDESEVRPIFAKVMNGESASPEEECK
UXAC_BACP2      QDFLNALRARIDFFHEHGCLISDHAINEMTYEE-TTQEEVETIFHKRMSGYPLTEKEKIK
UXAC_OCEIH      DGFLRALKSRVDYFHQNGCSVADHALNTMMFTE-TTKEKARNYYEKAMNGQKLSPKEESD
UXAC_GEOTN      GQLLQALENRVRYFHEAGCRMADHGLESMPYAE-CTLDEARVIFQKRKEGFALSREEEEK
UXAC_GEOSE      ISCCKPLENRVRYFHEKGCRMADHGLESMPYSE-CGWKEANDIFQKRKNGFVLSREEEEK
UXAC_ALKHC      DAFLHALKERLTFFDEHGCRSSDHDMTEVPFVE-VNEQEAQHIFRKRLANEGLTKVENEK
UXAC_ECOLI      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_ECOK1      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_ECOL6      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_SHIF8      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_SHIBS      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_ECOL5      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_SHISS      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_SHIFL      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_ECOLC      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_ECOHS      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_ECO24      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_ECO57      ADLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ANEAELDSILARRLAGETLSEHEVAQ
UXAC_CROS8      SDLQTALTKRLDHFAAHGCKVSDHALDVVLFAE-ASESELNAILSRRLAGETLSGHEIAQ
UXAC_PECAS      SDLQTALTKRLDHFAAHGCKVSDHALDVVMFAE-ADDATLDKILARRLAGETLSEHEVAQ
UXAC_YERP3      ADLCVALNKRMDHFAAHGCKVSDHALDVVVYGE-ADETTLDAILARRLAGNQPSTEEIAQ
UXAC_YERPA      ADLCVALNKRMDHFAAHGCKVSDHALDVVVYGE-ADETTLDAILARRLAGNQPSTEEIAQ
UXAC_YERPE      ADLCVALNKRMDHFAAHGCKVSDHALDVVVYGE-ADETTLDAILARRLAGNQPSTEEIAQ
UXAC_YERPS      ADLCVALNKRMDHFAAHGCKVSDHALDVVVYGE-ADETTLDAILARRLAGNQPSTEEIAQ
UXAC_YERPP      ADLCVALNKRMDHFAAHGCKVSDHALDVVVYGE-ADETTLDAILARRLAGNQPSTEEIAQ
UXAC_YERPN      ADLCVALNKRMDHFAAHGCKVSDHALDVVVYGE-ADETTLDAILARRLAGNQPSTEEIAQ
UXAC_YERE8      ADLCTALNKRMDHFAAHGCKVSDHALDVVVYGE-ADEATLDGILARRLAGNQPSTEETAQ
UXAC_SERP5      SALCDALKKRMDHFAAHGCKVADHALDVVVYGE-ADESTLDAILTARLSGKLPTPEQSAQ
UXAC_SALPB      DDLRQALTRRLDHFAACGCRASDHGIETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQ
UXAC_SALCH      DDLRQALTRRLDHFAACGCRASDHGIETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQ
UXAC_SALTY      DDLRQALTRRLDHFAACGCRASDHGIETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQ
UXAC_SALTI      DDLRQALTRRLDHFAACGCRASDHGIETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQ
UXAC_SALPA      DDLRQALTRRLDHFAACGCRASDHGIETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQ
UXAC_SALAR      DDLRRALTRRLDHFAACGCRAADHGIETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQ
UXAC_PHOLL      ADVLNALERRLEHFAAHGCRAADHGIENLRYAPIPDETVLNGILQKRLAGGILSELEIAQ
UXAC_VIBVY      DDLLSALDKRLAHFDAHGCRAADHGIEIVRYAPIPSEADLDALLARRLSGEVLSELECAQ
UXAC_VIBPA      DDLLSALDKRLAHFDSHGCRAADHGIEIVRYAPIPSEADLDALLARRLSGEVLSELECAQ
UXAC_VIBVU      DDLLSALDKRLAHFDAHGCRAADHGIEIVRYAPIPSEADLDVLLARRLNGEVLSELECAQ
UXAC_HAEI8      ADLKKALLKRLEYFDAQGCKSADHGMEIVRFSAIPDESVLNSILQKRLQNQPLLEEEVAQ
UXAC_HAEIG      ADLKKALLKRLEYFDAQGCKSADHGMEIVRFSAIPDESVLNSILQKRLQNQPLLEEEVAQ
UXAC_HISS2      DKLKQALSKRIEHFDKYGCKSADHGMEIVRFSPIPDEKTLDQILQKRLNNQPIEEEEIAQ
UXAC_MANSM      DSLKKALSKRLDHFDKRGCKSADQGMEIVRFAPVPDEKELDRILQLRRNEQPLTELQISQ
UXAC_ACTSZ      DALKKALLKRLEHFDQHGCKSADHGMEIVRFAPIPDEKELDRILRLRRSNQALTELQINQ
UXAC_MARMS      SDLIAALAQRLEVFDAHGCRSADHGIEIMRFANEPSETDLDAILTKRINEQALTELEIAQ
UXAC_LACP7      AGLMEALKVRLEFFNSMGCKVSDHALSYVMYKP-ATEEEIEAIFAKRLAGGTISEMEELQ
UXAC_CLOPE      DDLKKALEIRLDYFYENGCMITDHSLERVVFYKFSCEE-INEIFIKALNGENINNEEASK
UXAC_BACTN      DDMIAALRKRHDFFAEQGCRLSDHGIEEFYAED-YTDAEIKAIFNKVYGGAELTKEEILK
UXAC_PHOV8      DDMVAALRKRHDFFAEQGCKLSDHGIEEFYAED-YTDAEINAIFNKVYGGTELTKEEILK
UXAC_BACFN      NDMILALRKRHDYFAEQGCKLSDHGIEEFYAED-YTEGEIKTIFNKIYGGSELTKEEVLK
UXAC_BACFR      NDMILALRKRHDYFAEQGCKLSDHGIEEFYAED-YTEGEIKTIFNKIYGGSELTKEEVLK
UXAC_FLAJ1      ADLQAALRNRIEFFNANGCKLSDHGLDQIYFED-FTESEISSIFKKKRENRIITPEEALK
UXAC_ALKCK      RSLLEALEKRATFFAEEGCVLSDHGLRTLPFVD-TTEKEAEAAFQKALNQETLTPQEEEK
UXAC_STRA5      STFIAAMEERIAYFAQNGCRASDISFTEIVFEQ-TDELELNDLFNKVCEGYIPNQSEISK
UXAC_STRA3      STFIAAMEERIAYFAQNGCRASDISFTEIVFEQ-TDELELNDLFNKVCEGYIPNQSEISK
UXAC_STRA1      STFIAAMEERIAYFAQNGCRASDISFTEIVFEQ-TDELELNDLFNKVCEGYIPNQSEISK
UXAC_STAHJ      SDFIEALYKRIQYFHDKGGRLADHGLEEMHFEA-YTDQAIQDIFKKALNHADISTYERFQ
UXAC_RHILO      AGYLDAHRQRRAFFKSFGATSSDHGHPTAETAN-LSDAAAQELFNRIRRGSQ-DERERKL
UXAC_RHIME      SGYLDAHRTRRAYFKDFGATSTDHGHATADTAN-LPQAEAAALFDKVRLGKA-NADERRL
UXAC_BRUSU      QGYLDAHRNRREYFKRRGATSSDHGHPTAQTAD-LSAGDASRLFDRVIKGNA-STSDAEM
UXAC_BRUC2      QGYLDAHRNRREYFKRRGATSSDHGHPTAQTAD-LSAGDASRLFDRVIKGNA-STSDAEM
UXAC_BRUME      QGYLDAHRNRREYFKRRGATSSDHGHPTAQTAD-LSAGDASRLFDRVIKGNA-STSDAEM
UXAC_BRUSI      QGYLDAHRNRREYFKRRGATSSDHGHPTAQTAD-LSAGDASRLFDRVIKGNA-STSDAEM
UXAC_XANAC      DGYLRAHRQRRAFFAAHGATSTDHGHPSAATAD-LSPAEAQRLFDTVVRGAA-TPEQAEL
UXAC_XANOR      NGYLRAHRQRRAFFAAHGATSTDHGHPSAATAD-LSPAQAQRLFDTVVRGAA-TPEQAEL
UXAC_XANCP      PGYLCAHRQRRAFFAAAGATSTDHGHPSAATAD-LSPAEAQRLFDTVVRGQA-TPAQAEL
UXAC_XANC8      PGYLCAHRQRRAFFAAAGATSTDHGHPSAATAD-LSPAEAQRLFDTVVRGQA-TPAQAEL
UXAC_CAUVC      KSYLEAHRLRRQAFIDAGATSSDHGHPTAATAD-LSDVEAEALFNSLVKGDV-TPEKAEL
UXAC_RHIWR      AGYLAALRARRAAFAAAGATSTDHGHPTAATAD-LDRGEAERLYAQVRGGGA-TAEQAEL
UXAC_SPHAL      SGYLAAHRKRRAFFASMGATSTDHGHPSAATAD-LSETQAEALFARVTGEDM-SAADAEL
UXAC_NOSP7      ATFVQALEERRAFFKKMGATATDQGAATPYTTS-LSDQEAEAIFARALIGKL-NPGDVEQ
UXAC_COREF      EGYLQAMRNRRQYFIDHGATSADHGTHDTDTTP-LSHEDAQRILDKGLAGTA-TLAEMRA
UXAC_CUTAK      DGFTEAMEDRRAYFRQHGAVSSDHSHRDLGTII-LDHDRAASIFDASVAGRA-TVEEMAL
                     .       *   *   :*                                 .   

UXAC_THEMA      YKAFMMVQFGKMNQETNWVTQLHIGALRDYRDSLFKTLGPDSGGDISTNFLRIAEGLRYF
UXAC_THEP1      YKAFMMMQFGRMNQETNWVTQLHIGALRDYRDSLFKTLGPDSGGDISTNFLRIAEGLRYF
UXAC_LACLM      YITALILEIMKLNKKFDWTMQLHVNVNRSINGPALRKIGENTGFDSMGTQANISEELTKL
UXAC_LACLS      YITALILEIMKLNKKFDWTMQLHVNVNRSINGPALRKIGENTGFDSMGTQANISEELTKL
UXAC_LACLA      YITALILEIMKLNKKFEWTMQLHVNVNRSINGPALSKIGENTGFDSMGTQANISEELTKL
UXAC_LATSS      YLTMLLEALMKLNTQFNWTMQFHINSDRDLNRPMFAKIGPDTGYDAVGTQPDIVNHISAL
UXAC_CALS4      FKTYTMIFLGKKYAELNWVMQLHIGAMRNNNTKMYRILGPDTGYDSIGDF-PIAYSLSRL
UXAC_CALS8      YKTYTLRFLGKVYSSLGWAMQLHINALRNNNTRMFNILGPDTGYDSINDG-HIALALVKF
UXAC_CLOAB      FRTFTMKFLGKKYASLGWAMELHMNAKRDNNTRMYNKLGPDTGFDSVNDN-GVAGPLSRF
UXAC_BACSU      FKTYTLQFLCGLYAELDWAMQFHINALRNTNTKMMKRLGPDTGYDSMNDE-EIAKPLYKL
UXAC_BACVZ      FKTRTLQYLCGLYAELDWAMQFHINALRNTNTNKFSSLGPDTGYDSINDE-RIAKPLARL
UXAC_BACLD      FKSLTLHFLGTCYAEKGWAMQLHINALRNNSSKMYRKLGPDTGYDAINDQ-DIAKPLCSF
UXAC_BACP2      FKTETFIMLGQAYCERGWAMQLHINALRNNNTKMFERLGPDTGYDAMNDE-DIAKPLCRI
UXAC_OCEIH      FKSFTLVFLGEQYADKGWVMQYHINALRNNNSRMYNNLGPDTGYDAMNDE-VISKPLVNL
UXAC_GEOTN      YQTFTLCFLARLYYSLGWVMQLHIGSIRNTNQKMFQQLGPNTGYDSINDF-FFAQPLNAF
UXAC_GEOSE      YKTSTLCFLARLYHSLGWVMQLHIGSIRNTNEKMFRRLGPNTGYDSIHDF-FLAQPLNAF
UXAC_ALKHC      YKTFLMTWLGKEYAARGWVMQWHIGVMRNNNSRMLHKLGPDTGFDSIGDG-QIAHATAKL
UXAC_ECOLI      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_ECOK1      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_ECOL6      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_SHIF8      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_SHIBS      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_ECOL5      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_SHISS      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_SHIFL      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_ECOLC      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_ECOHS      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_ECO24      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_ECO57      FKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PMAEELSKL
UXAC_CROS8      FKTAVLVWLGAEYARRGWVQQYHIGALRNNNQRQFRLLGPDVGFDSINDR-PLAEELSKL
UXAC_PECAS      FKTGVLVWLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDR-PLAQELSRL
UXAC_YERP3      FKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQ-PLAQPLSRL
UXAC_YERPA      FKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQ-PLAQPLSRL
UXAC_YERPE      FKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQ-PLAQPLSRL
UXAC_YERPS      FKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQ-PLAQPLSRL
UXAC_YERPP      FKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQ-PLAQPLSRL
UXAC_YERPN      FKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQ-PLAQPLSRL
UXAC_YERE8      FKTAVLLFLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQ-PLAQPLSRL
UXAC_SERP5      FKSAVLLFLAAEYQRREWVQQYHIGALRNNNSRMLASVGPDIGFDSINDR-PLAEALSRL
UXAC_SALPB      FTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFDSIGDN-NISWALSRL
UXAC_SALCH      FTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFDSIGDN-NISWALSRL
UXAC_SALTY      FTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFDSIGDN-NISWALSRL
UXAC_SALTI      FTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFDSIGDN-NISWALSRL
UXAC_SALPA      FTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFDSIGDN-NISWALSRL
UXAC_SALAR      FTTAVLVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGPDTGFDSIGDN-NISWALSRL
UXAC_PHOLL      YTTAILVWLGRQYAARGWVMQMHIGAIRNNNSRMFRLLGADSGFDSIGDN-NIAWPLSRL
UXAC_VIBVY      FSTAVQVWLGKRYAQLGWVMQLHIGAQRNNSTRMFQLLGADAGFDSIGDR-PFAFELAHL
UXAC_VIBPA      FSTAVQVWLGKRYAQLGWVMQLHIGAQRNNSTRMFQLLGADAGFDSIGDR-PFAFELAHL
UXAC_VIBVU      FSTAVQVWLGKRYAQLGWVMQLHIGAQRNNSTRMFQLLGADAGFDSIGDR-PFAFELAHL
UXAC_HAEI8      FSTAILVWLASEYCKRHWVMQMHIGAIRNNNSRMFALLGADSGFDSIGDR-TYAYPLSRL
UXAC_HAEIG      FSTAILVWLASEYCKRHWVMQMHIGAIRNNNSRMFALLGADSGFDSIGDR-AYAYPLSRL
UXAC_HISS2      FSTALLVWLGTEYHKHHWVMQLHIGAIRNNNTRMFKLLGADAGFDSIGDR-AFAESLSRL
UXAC_MANSM      FSTALLVWLGAEYCKRNWVMQMHIGALRNNNTRMFKLLGADSGFDSIADR-TFAEQLSRL
UXAC_ACTSZ      YSTALLVWLGTEYCKRNWAMQMHIGALRNNNTRMFKLLGADAGFDSIADR-TFAEPLSRL
UXAC_MARMS      FSSAVQAWLGKQYAKKGWVMQLHIGARRNNSSRMFKLIGGDSGFDSMDDR-AFAEPLSGF
UXAC_LACP7      FKTAFMVSVGREYNRLGWVMQLHYGTKRDNNVFRFNQLGADTGFDCINTE-GSSAELANF
UXAC_CLOPE      YSVALLISLGKMYAERNMVMQLHIGALRNNNTRMFNRIGADAGFDSIDDG-EIAYSLSRI
UXAC_BACTN      FKSAMLVIFGEMDWEKGWTQQFHYGAIRNNNTKMFKLLGPDTGFDSIGEF-TTAKAMSKF
UXAC_PHOV8      FKSAMLIVFGEMDWEKGWTQQFHYGAIRNNNTKMFKLLGPDTGFDSIGEF-TTAKAMAKF
UXAC_BACFN      FKSAMLIVLGEMDWEKGWTQQFHYGAIRNNNSRMFKQLGPDTGFDSIGEF-ATAKAMSKF
UXAC_BACFR      FKSAMLIVLGEMDWEKGWTQQFHYGAIRNNNSRMFKQLGPDTGFDSIGEF-ATAKAMSKF
UXAC_FLAJ1      FQSAVLIFLSETYHEFGWVQQFHLGALRNNNARMHRILGPDTGWDSIGDY-PQAQKLSSF
UXAC_ALKCK      YQTYVLLFLARLYNKLGWTMQFHLGALRNNNSRMVEQVGPDSGFDSMADD-RFAESLNRF
UXAC_STRA5      WQTAVFMELCRLYKKYGFVTQVHFGALRNNHSTIFEKLGADVGVDSLGDQVALTVNMNRL
UXAC_STRA3      WQTAVFMELCRLYKKYGFVTQVHFGALRNNHSTIFEKLGADVGVDSLGDQVALTVNMNRL
UXAC_STRA1      WQTAVFMELCRLYKKYGFVTQVHFGALRNNHSTIFEKLGADVGVDSLGDQVALTVNMNSL
UXAC_STAHJ      FQSYMLNELSKAYYERGWVMQIHFGAIRNNNTKMFEKVGKDAGFDSIRDQDNLAYHLNAT
UXAC_RHILO      FRAQMLTEMAKMSRDDGLVLQIHPGSWRNHSPSVFQRFGRDKGFDIPTRT-DYVTALKPL
UXAC_RHIME      FRAQMLTEMAKMSLDDGLVMQIHPGSFRNHSPAILAKFGRDKGFDIPTRT-DYVTALKPL
UXAC_BRUSU      FRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIPRQT-GFVDQLKPL
UXAC_BRUC2      FRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIPRQT-GFVDQLKPL
UXAC_BRUME      FRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIPRQT-GFVDQLKPL
UXAC_BRUSI      FRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIPRQT-GFVDQLKPL
UXAC_XANAC      FRAQVLTEMAAMSLDDGLVMQLHPGCFRNHNRQLFEQYGRDKGADIPMRT-DYVHALKPL
UXAC_XANOR      FRAQVLTEMAAMSLDDGLVMQLHPGCFRNHNRPLFERYGRDKGADIPMRT-DYVHALKPL
UXAC_XANCP      FRAQVLTEMAAMSVDDGLVMQLHPGCFRNHNRQLFERYGRDKGADIPMRT-DYVHALKPL
UXAC_XANC8      FRAQVLTEMAAMSVDDGLVMQLHPGCFRNHNRQLFERYGRDKGADIPMRT-DYVHALKPL
UXAC_CAUVC      FRAQMLTEMAKMSLDDGLVMQIHPGSHRNHNVGLLNSHGRDKGADIPMRT-EYVDALKPL
UXAC_RHIWR      FRAHMLTVMAEMSIDDGLVMQIHPGSFRNHNADLFRRFGRDKGADIPTRT-DFVRALRPL
UXAC_SPHAL      FRAHMLTVMAGMSLDDGLVMQIHPGAFRNHNPWLFANHGRDKGADIPTAT-DYVHALRPL
UXAC_NOSP7      FTGHIFMEMARMSVEDGLVMQMHCGVMRNHNPALFERFGSDKGADIPLNI-EWTRNLHPL
UXAC_COREF      FEANTTYRFAEMCQDDGLVMTLHPGVYRNHSASAQKKFGNDIGADIPFQL-EYTRGLRPL
UXAC_CUTAK      LRRHLFTDQARMASEDGLTMTVHPAVHRNHDTAAFHRFGADIGSDVPVTL-EVVDSLHPL
                                  .   *    *.         * : * *               

UXAC_THEMA      LNEFDGK---LKIVLYVLDPTHLPTISTIARAFPN--------VYVGAPW--WFNDSPFG
UXAC_THEP1      LNEFDGK---LKIVLYVLDPTHLPTVATIARAFPN--------VYVGAPW--WFNDSPFG
UXAC_LACLM      FSKAAELEIIPKTILYSLNQNDWLELATLIGCFQG---EGVQQLQLGAGW--WFNDTAKG
UXAC_LACLS      FSKAAELEIIPKTILYSLNQNDWLELATLIGCFQG---EGVQQLQLGAGW--WFNDTAKG
UXAC_LACLA      FSKAAELETIPKTILYSLNQNDWLELVTMIGCFQG---EGVQQLQLGAGW--WFNDTKKG
UXAC_LATSS      YTKMQQTEDVPKSIFYSLNSNDWLELATMMGCFQG---GTTQKLQLGAGW--WFNDTAEG
UXAC_CALS4      LDSLEIEGALPKTILYTLNPAANYVIATMIGNFQD--GKIAGKMQFGAAW--WFNDNKDG
UXAC_CALS8      LDSLEKENSLPKTILYSLNPKDNYVLATIMGSFQD--GSIPGKMQLGAAW--WFNDSKDG
UXAC_CLOAB      LDSLEKEGSLPKTIIYSLNPNDNFVIGTLLGCFQG--TEAFGKIQFGAAW--WFNDHRDG
UXAC_BACSU      LNSVEMKNQLPKTILYSLNPNDNYVIASMINSFQD--GITPGKIQFGTAW--WFNDTKDG
UXAC_BACVZ      LDSAEKKRQLPKTILYSLNPNDNYIIASMINSFQD--GKTPGKIQFGTAW--WFNDTKDG
UXAC_BACLD      LDSLDRKDALPKTILYSLNPRDNVVISSLCGSFQD--GRIPGKIQHGTAW--WFNDTKDG
UXAC_BACP2      LDRLEQEDALPNTILYSLNPRDNVVISTLAGSFQD--GKTPGKMQHGTAW--WFNDTKQG
UXAC_OCEIH      LNELEKKDRLPKTILYSLNPNDNPVIASIIGSFQR--GGVPGKLQFGTAW--WFNDTKSG
UXAC_GEOTN      LNRLERDGQLPKTIVYTLNPAYNYIVASTIGNFPS--EGVKGKVQFGAAW--WFNDHQDG
UXAC_GEOSE      LNELERRDQLPKTIVYTLNPAYNYVVASTVGNFQS--EGVKGKVPIWRSLGGFNDSFKMA
UXAC_ALKHC      LDLLDKQGALPKTILYCVNPNANYILASMIGNFTE--SGVRGKVQFGSAW--WFNDHIDG
UXAC_ECOLI      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_ECOK1      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_ECOL6      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_SHIF8      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_SHIBS      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_ECOL5      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_SHISS      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_SHIFL      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_ECOLC      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_ECOHS      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_ECO24      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_ECO57      LSKQNEENLLPKTILYCLNPRDNEVLGTMSGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_CROS8      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_PECAS      LSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQG--EGMPGKMQFGSGW--WFNDQKDG
UXAC_YERP3      LDAQGLRNALPKTILYCLNPRDNEVIGTMVGNFQG--EGEAGKMQFGSGW--WFNDQKDG
UXAC_YERPA      LDAQGLRNALPKTILYCLNPRDNEVIGTMVGNFQG--EGEAGKMQFGSGW--WFNDQKDG
UXAC_YERPE      LDAQGLRNALPKTILYCLNPRDNEVIGTMVGNFQG--EGEAGKMQFGSGW--WFNDQKDG
UXAC_YERPS      LDAQGLRNALPKTILYCLNPRDNEVIGTMVGNFQG--EGEAGKMQFGSGW--WFNDQKDG
UXAC_YERPP      LDAQGLRNALPKTILYCLNPRDNEVIGTMVGNFQG--EGEAGKMQFGSGW--WFNDQKDG
UXAC_YERPN      LDAQGLRNALPKTILYCLNPRDNEVIGTMVGNFQG--EGEAGKMQFGSGW--WFNDQKDG
UXAC_YERE8      LDAQGLRNALPKTILYCLNPRDNEVIGTMVGNFQG--EGAAGKMQFGSGW--WFNDQKDG
UXAC_SERP5      LDAQARQGGLPKTILYCLNPRDNEVIGTMVGNFQG--EGTPGKMQFGSGW--WFNDQKDG
UXAC_SALPB      LDSMDVTNELPKTILYCLNPRDNEVLATMIGNFQG--PGIAGKVQFGSGW--WFNDQKDG
UXAC_SALCH      LDSMDVTNELPKTILYCLNPRDNEVLATMIGNFQG--PGIAGKVQFGSGW--WFNDQKDG
UXAC_SALTY      LDSMDVTNELPKTILYCLNPRDNEVLATMIGNFQG--PGIAGKVQFGSGW--WFNDQKDG
UXAC_SALTI      LDSMDVTNELPKTILYCLNPRDNEVLATMIGNFQG--PGIAGKVQFGSGW--WFNDQKDG
UXAC_SALPA      LDSMDVTNELPKTILYCLNPRDNEVLATMIGNFQG--PGIAGKVQFGSGW--WFNDQKDG
UXAC_SALAR      LDSMDVTNELPKTILYCLNPRDNEVLATMTGNFQG--PGIAGKVQFGSGW--WFNDQKDG
UXAC_PHOLL      LDSMDVTDELPKTILYCLNPRDNEVIATMASNFQG--GGIAGKVQFGSGW--WFNDQKDG
UXAC_VIBVY      LDEMDQTNELPRTILYCLNPRDNEMMATMIGNFQG--GGIAGKVQFGSGW--WFNDQKDG
UXAC_VIBPA      LDEMDQTNELPRTILYCLNPRDNEMMATMIGNFQG--GGIAGKVQFGSGW--WFNDQKDG
UXAC_VIBVU      LDEMDQTNELPRTILYCLNPRDNEMMATMIGNFQG--GGIAGKVQFGSGW--WFNDQKDG
UXAC_HAEI8      LDAMDKENQLPKTILYCLNPRDNEMIASMIGNFQG--DGIAGKIQFGSGW--WFNDQKDG
UXAC_HAEIG      LDAMDKENQLPKTILYCLNPRDNEMIASMIGNFQG--DGIAGKIQFGSGW--WFNDQKDG
UXAC_HISS2      LDSMDQTDQLPKTILYCLNPRDNEMLGTMIGNFQT--GGIAGKIQFGSGW--WFNDQKDG
UXAC_MANSM      LDAMDQNNQLPKTILYCLNPRDNEMIATMIGNFQT--GGIAGKIQFGSGW--WFNDQKDG
UXAC_ACTSZ      LDTMDQNDELPKTILYCLNPRDNEMIATMIGNFQT--GGVAGKIQFGSGW--WFNDQKDG
UXAC_MARMS      LNTLDQSDELPKTILYCLNPMHNEMLATMAGNFQG--GGVAGKVQFGSGW--WFNDQLDG
UXAC_LACP7      LNALNSSDELPKTIIYSLNPTDNAAIGTVLGCFQD--STAVGKIQQGSAW--WFNDNKTG
UXAC_CLOPE      LDELDKEDKLPKTILYCLNPKDNEVLGTMIGNFQG--GNIAGKIQFGSGW--WFNDQKDG
UXAC_BACTN      LDRLNVNGKLTKTILYNLNPCANEVIATMLGNFQD--GSIAGKIQFGSGW--WFLDQKDG
UXAC_PHOV8      LDRLNTEGKLTKTILYNLNPCANEVIATMLGNFQD--GTIPGKIQFGSGW--WFLDQKDG
UXAC_BACFN      LDRLNSKGKLTKTILYNLNPCANEVIATMIGNFQD--GSIPGKIQFGSGW--WFLDQKDG
UXAC_BACFR      LDRLNSKGKLTKTILYNLNPCANEVIATMIGNFQD--GSIPGKIQFGSGW--WFLDQKDG
UXAC_FLAJ1      LNALDSKDKLTKTIIYNLNPADNEVMATMIGNFND--GSVRGKVQFGSGW--WFLDQKDG
UXAC_ALKCK      LNELERTNELPKTILYTLNPIFNEVIATTIGNFQG--GGIPGKIQFGSGW--WFNDTKDG
UXAC_STRA5      LDSLVKKDSLPKMIWYNLNPAYNIAVANTLANFQANELGVRSYLQFGAGW--WFADTKLG
UXAC_STRA3      LDSLVKKDSLPKMIWYNLNPAYNIAVANTLANFQANELGVRSYLQFGAGW--WFADTKLG
UXAC_STRA1      LDSLVKKDSLPKMIWYNLNPAYNIAVANTLANFQANELGVRSYLQFGAGW--WFADTKLG
UXAC_STAHJ      LDMMEQEGHLPKTILYNLNPIYNDIVGSTIANFQT-EPGIKSKVQHGAGW--WFNDTKRG
UXAC_RHILO      LDCVGLERDLTVILFTLDESSYARELAPLAGVYPA--------LKLGPAW--WFHDSPEG
UXAC_RHIME      LDAVGLERDLTVILFTLDETSYARELAPLAGVYPA--------LKLGPAW--WFHDSAEG
UXAC_BRUSU      LDAFGNDPRLTVILFTLDETAYSRELAPLAGHYPA--------LKLGPAW--WFFDSPEG
UXAC_BRUC2      LDAFGNDPRLTVILFTLDETAYSRELAPLAGHYPA--------LKLGPAW--WFFDSPEG
UXAC_BRUME      LDAFGNDPRLTVILFTLDETALSRELAPLAGHYPA--------LKLGPAW--WFFDSPEG
UXAC_BRUSI      LDGFGNDPRLTVILFTLDETAYSRELAPLAGDYPA--------LKLGPAW--WFFDSPEG
UXAC_XANAC      LDRHGNDPRLRLIVFTLDETSYSRELAPLAGHYPS--------LLLGPAW--WFHDAPEG
UXAC_XANOR      LDRYGNDPRLRLIVFTLDETSYSRELAPLAGHYPS--------LLLGPAW--WFHDAPEG
UXAC_XANCP      LDRFGNDPRFRLIVFTLDETSYSRELAPLAGHYPA--------LLLGPAW--WFHDAPEG
UXAC_XANC8      LDRFGNDPRFRLIVFTLDETSYSRELAPLAGHYPA--------LLLGPAW--WFHDAPEG
UXAC_CAUVC      LTRLGNDPRLSIILFTLDETTYSRELAPLAGHYPV--------LKLGPSW--WFHDSPEG
UXAC_RHIWR      LGRFGNDPRLSLILFTLDESAYARELAPLAGHYPA--------LKLGPAW--WFHDSPEG
UXAC_SPHAL      LGRYGNEADLTIILFTLDETSYARELAPLAGHYPA--------LKLGPAW--WFHDSPEG
UXAC_NOSP7      LSSYGNNQRFRLIIFGMDESTYSREMAPLAGHYPT--------ILLGPPW--WFHDSVNG
UXAC_COREF      LSDFGENKDFHFVMFTIDETVFSREVAPLAGYYPA--------AYVGAPW--WFIDEIDA
UXAC_CUTAK      LDKFG-NTDLKLVVFTIDETLYSREIAPLSGWYRS--------LYIGVPW--WFIDAPES
                             :    :      :      :                   :  .   .

UXAC_THEMA      MEMHLKYLASVDLLYNLAGMVTDSRKLLSFGSRTEMFRRVLSNVVGEMVEKGQIP---IK
UXAC_THEP1      MEMHLKYLASVDLLYNLAGMVTDSRKLLSFGSRTEMFRRVLSSVVGEMVERGQIP---IK
UXAC_LACLM      MEKQLEIFASQSLLPNFVGMLTDSRSFLSY-PRHEYFRRVLCNFVGQLIESGRIP-DDEA
UXAC_LACLS      MEKQLEIFASQSLLPNFVGMLTDSRSFLSY-PRHEYFRRVLCNFVGQLIESGRIP-DDEA
UXAC_LACLA      MENQLEIFASQSLLSNFVGMLTDSRSFLSY-PRHEYFRRVLCNFVGQLIENGRIP-DNEA
UXAC_LATSS      MTQQLQVFAQQSLLPHFVGMLTDSRSFLSY-PRHEYFRRVLCSFYGRLVEQGRVP-NDAA
UXAC_CALS4      IKEQLKTLANVGLLGRFVGMVTDSRSFLSY-ARHEYFRRILCDLIGEWVENGEVP-NDIE
UXAC_CALS8      NLQQMKDLANLGLLSRFVGMVTDSRSFLSY-ARHEYFRRLLCKLIGEWVENGEYP-YDLE
UXAC_CLOAB      MVEQMETLANLGAFSTFIGMLTDSRSFLSY-TRHEYFRRILCDLIGKWVENGEVP-NDME
UXAC_BACSU      MLDQMKALSNVGLFSRFIGMLTDSRSFLSY-TRHEYFRRIVCNLIGEWVENGEVP-RDME
UXAC_BACVZ      MLQQMRALSNMGLFSRFIGMLTDSRSFLSY-PRHEYFRRLVCTLIGGWAEQGEAP-YDME
UXAC_BACLD      MLEQMKSLANIGLLSRFIGMLTDSRSFLSY-TRHEYFRRLLCDVIGTWVENGEAP-DDIE
UXAC_BACP2      MTEQMMTLSSIGLISRFIGMLTDSRSFLSY-TRHEYFRRLLCDIIGDWVEKGEVP-YDLE
UXAC_OCEIH      MIKQMQTLADIGVFSQFIGMLTDSRSFLSY-PRHEYFRRLVCSLIGEWVHNGEVP-YDLK
UXAC_GEOTN      IIRHLNDLANVGVFSTFVGMLTDSRSFLSY-VRHEYFRRIVCNLIGSWIEKGEAP-QDYA
UXAC_GEOSE      FIRHLTDLANVGVFSTFVGMLTDSRSFVSY-VRHEYFRRIVCNLIGSWIEKGEVP-QDYD
UXAC_ALKHC      MRRQLTDLASVGLLSNFIGMLTDSRSFLSY-PRHDYFRRILCQLIGSWIKEGQLP-PDME
UXAC_ECOLI      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_ECOK1      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_ECOL6      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_SHIF8      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_SHIBS      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_ECOL5      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_SHISS      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_SHIFL      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_ECOLC      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_ECOHS      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_ECO24      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_ECO57      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADIN
UXAC_CROS8      MERQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEAGEAP-ADID
UXAC_PECAS      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEDGEAP-ADLP
UXAC_YERP3      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAP-ADIA
UXAC_YERPA      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAP-ADIA
UXAC_YERPE      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAP-ADIA
UXAC_YERPS      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAP-ADIA
UXAC_YERPP      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAP-ADIA
UXAC_YERPN      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVADGEAP-ADIA
UXAC_YERE8      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGRWVEDGEAP-ADIE
UXAC_SERP5      MQRQMTQLAQLGLLSRFVGMLTDSRSFLSY-TRHEYFRRILCQMIGGWVENGEAP-ADIT
UXAC_SALPB      MLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIP-DDEA
UXAC_SALCH      MLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIP-DDEA
UXAC_SALTY      MLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIP-DDEA
UXAC_SALTI      MLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIP-DDEA
UXAC_SALPA      MLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIP-DDEA
UXAC_SALAR      MLRQLEQLSQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNLLGQWAQDGEIP-DDEA
UXAC_PHOLL      MLRQLEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNVLGQWAEKGEIP-NHKA
UXAC_VIBVY      MQRQMEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCDMVGRWAENGEVP-NDLS
UXAC_VIBPA      MQRQMEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCDMVGRWAENGEVP-NDLS
UXAC_VIBVU      MQRQMEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCDMVGRWAENGEVP-NDLS
UXAC_HAEI8      MERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVEKGEAP-NDIS
UXAC_HAEIG      MERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVEKGEAP-NDIS
UXAC_HISS2      MERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGGWVERGEAP-NDLN
UXAC_MANSM      MERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMIGRWVVNGEAP-NDMN
UXAC_ACTSZ      MERQLQQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCEMVGKWVVNGEAP-NDMN
UXAC_MARMS      MQRQLTSVAQMGLLSQFVGMLTDSRSFLSY-TRHEYFRRLLCEMIGGWVERGEAP-ADMA
UXAC_LACP7      MIDQMTSLANLGLLANFVGMLTDSRSFLSY-TRHEYFRRILCELIGNWVENGEYP-NDIE
UXAC_CLOPE      MERQMMALSQLGLISQFVGMVTDSRSFLSY-TRHEYFRRILCNYLGNLVESGQYP-YEEE
UXAC_BACTN      MEKQMNALSVLGLLSRFVGMLTDSRSFLSY-PRHEYFRRTLCNLVGRDVENGEIPVSEMD
UXAC_PHOV8      MEKQMNALSLLGLLSRFVGMLTDSRSFLSY-PRHEYFRRTLCNLLGNDVENGEIPACEIE
UXAC_BACFN      MERQLNALSLLGLLSRFVGMLTDSRSFLSY-PRHEYFRRTLCNLLGCDVENGEIPLSEME
UXAC_BACFR      MERQLNALSLLGLLSRFVGMLTDSRSFLSY-PRHEYFRRTLCNLLGCDVENGEIPLSEME
UXAC_FLAJ1      MTKQLNALSNMGLISCFVGMLTDSRSFLSF-PRHEYFRRILCNLLGDEIKRGELP-NDME
UXAC_ALKCK      MEKQMTDLANNGLLSLFVGMLTDSRSFLSY-TRHEYFRRILCNRIGEWVERGEWP-ADEK
UXAC_STRA5      MISQMNALAEQGMLANFIGMLTDSRSFLSY-QRHDYFRRILCTYLGEWIEEGEVP-EDYQ
UXAC_STRA3      MISQMNALAEQGMLANFIGMLTDSRSFLSY-QRHDYFRRILCTYLGEWIEEGEVP-EDYQ
UXAC_STRA1      MISQMNALAEQGMLANFIGMLTDSRSFLSY-QRHDYFRRILCTYLGEWIEEGEVP-EDYQ
UXAC_STAHJ      MLRQMSSLADQGLLMHFVGMLTDSRSFISY-SRHDYFRRILSSFIGDLVEKGEIP-NDDQ
UXAC_RHILO      MRRFREMTTETAGFYNTVGFNDDTRAFPSIPARHDVARRVDCAFLARLVAEHRLR---ED
UXAC_RHIME      MRRFREMTTETAGFYNTVGFNDDTRAFPSIPARHDIARRVDCAFLARLVAEHRLR---ED
UXAC_BRUSU      ILRYRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLE---ED
UXAC_BRUC2      ILRYRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLE---ED
UXAC_BRUME      ILRYRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLE---ED
UXAC_BRUSI      ILRYRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLE---ED
UXAC_XANAC      MWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLE---ED
UXAC_XANOR      MWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLE---ED
UXAC_XANCP      MWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLD---ED
UXAC_XANC8      MWRFREQTLASAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLAKLVAEHRLD---ED
UXAC_CAUVC      MMRFREQVTETAGFYNTVGFNDDTRAFLSIPARHDVARRVDSAFLARMVAEHRMD---LV
UXAC_RHIWR      MRRFRRQTTETAGFHNLVGFNDDTRAFLSIPARHDVARRIDCGYLAELVVEHQLD---ED
UXAC_SPHAL      MRRFRSQMTETAGFYNTVGFNDDTRAFLSIPARHDVARRIDCGFLAQLVSEHRLE---EW
UXAC_NOSP7      MERYFNQVMETAGIYNTAGFNDDTRAFVSIPARHNVWRRVACNWLAGLVTRGLVD---EE
UXAC_COREF      MNRFRSLTTGTTGFSRYSGFIDDTRAYCSIPARHNTSRRVEANYLARLVAEHRIS---ET
UXAC_CUTAK      VMRFKHAVTEMAGFSRVSGMIDDTRAFCSIPARHDMSRRLDAAHLAELVVLGRLD---LD
                             :    *:  *:*   *   * :  **  .   .              

UXAC_THEMA      EARELVKHVSYDGPKALFFG-----------------
UXAC_THEP1      EARELVKHVSYDGPKALFFG-----------------
UXAC_LACLM      LVGKMIEDISYNNVHDYFGFFKNEDSKQ---------
UXAC_LACLS      LVGKMIEDISYNNVHDYFGFFKNEDSKQ---------
UXAC_LACLA      LVGKMIEDISYNNVHDYFGFFKDEDSNQ---------
UXAC_LATSS      ELGRVVQNIAYNNAHDYFDFF----------------
UXAC_CALS4      LLGKIVQDISFNNAKEYMGV-----------------
UXAC_CALS8      ALSRIVQGVCYYNAKEYFGF-----------------
UXAC_CLOAB      LLGRITKNICFNNANNYFEMGL---------------
UXAC_BACSU      LLGSIVQGICYDNAKHYFQFQEEKANV----------
UXAC_BACVZ      LLGKIVEGICYRNAEEYFRF-----------------
UXAC_BACLD      LLGRIVKGICYENAKHYFQFEVKDRLKA---------
UXAC_BACP2      LLGEIVKGISYENAKQYFQFDRVKQLHHQSKIT----
UXAC_OCEIH      SLGEIVQDISYYNAARYFDFGLLSDE-----------
UXAC_GEOTN      FLGKIVQDICYFNAKQYFDLS----------------
UXAC_GEOSE      FLGKIVQDVCYFNAKQYFQVGVSGG------------
UXAC_ALKHC      RWGQIVQDICYNNVVDYFDMKETVRL-----------
UXAC_ECOLI      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_ECOK1      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_ECOL6      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_SHIF8      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_SHIBS      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_ECOL5      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_SHISS      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_SHIFL      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_ECOLC      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_ECOHS      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_ECO24      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_ECO57      LLGEMVKNICFNNARDYFAIELN--------------
UXAC_CROS8      LLGEMVKNICFNNARDYFAIELH--------------
UXAC_PECAS      LLGEMVKNISFDNAKNYFAIEL---------------
UXAC_YERP3      LLGAMVKNICFDNAQQYFAIEL---------------
UXAC_YERPA      LLGAMVKNICFDNAQQYFAIEL---------------
UXAC_YERPE      LLGAMVKNICFDNAQQYFAIEL---------------
UXAC_YERPS      LLGAMVKNICFDNAQQYFAIEL---------------
UXAC_YERPP      LLGAMVKNICFDNAQQYFAIEL---------------
UXAC_YERPN      LLGAMVKNICFDNAQQYFAIEL---------------
UXAC_YERE8      LLGSMVKNICFDNAKQYFAIEL---------------
UXAC_SERP5      LLGEMVKNICFDNAKNYFAIELA--------------
UXAC_SALPB      MLSRMVQDICFNNAQRYFTIK----------------
UXAC_SALCH      MLSRMVQDICFNNAQRYFTIK----------------
UXAC_SALTY      MLSRMVQDICFNNAQRYFTIK----------------
UXAC_SALTI      MLSRMVQDICFNNAQRYFTIK----------------
UXAC_SALPA      MLSRMVQDICFNNAQRYFTIK----------------
UXAC_SALAR      MLSRMVQDICFNNAQHYFAIK----------------
UXAC_PHOLL      MLGQIVEDICFNNARRYFALPGENL------------
UXAC_VIBVY      LLGPMVEDICFGNAKRYFEERA---------------
UXAC_VIBPA      LLGPMVEDICFGNAKRYFEERA---------------
UXAC_VIBVU      LLGPMVEDICFGNAKRYFEERV---------------
UXAC_HAEI8      LLGKMIEDICFNNAKNYFK------------------
UXAC_HAEIG      LLGKMIEDICFNNAKNYFK------------------
UXAC_HISS2      LLGKMVKDICYDNAKRYFK------------------
UXAC_MANSM      LLGNMVKNICFDNAKAYFK------------------
UXAC_ACTSZ      LLGNMVKNICYNNAKSYFK------------------
UXAC_MARMS      LLGEMVKGICAGNAKKYFGF-----------------
UXAC_LACP7      FLGQMVQDISYYNTKRYFGF-----------------
UXAC_CLOPE      ILGEIVQNICYKNSAKYFKR-----------------
UXAC_BACTN      RVNQMIEDISYNNAKNFFKF-----------------
UXAC_PHOV8      RVNQMVEDICYNNAKKFFQF-----------------
UXAC_BACFN      RVCQMVEDISYFNAKNFFHF-----------------
UXAC_BACFR      RVCQMVEDISYFNAKNFFHF-----------------
UXAC_FLAJ1      WIGKLVADISYNNAKEYFKF-----------------
UXAC_ALKCK      WLGKVVEDISYYNAKRYFAFPK---------------
UXAC_STRA5      ALGSMAKDIAYQNAVNYFKN-----------------
UXAC_STRA3      ALGSMAKDIAYQNAVNYFKN-----------------
UXAC_STRA1      ALGSMAKDIAYQNAVNYFKN-----------------
UXAC_STAHJ      LLKRMIENICYNNAYNYFKLI----------------
UXAC_RHILO      EAHELARELAHTLAKKAYRL-----------------
UXAC_RHIME      EAYELARDLAYGLAKEAYRL-----------------
UXAC_BRUSU      EAYEVAHDLAYRLAKQTYKL-----------------
UXAC_BRUC2      EAYEVAHDLAYRLAKQTYKL-----------------
UXAC_BRUME      EAYEVAHDLAYRLAKQTYKL-----------------
UXAC_BRUSI      EAYEVAHDLAYRLAKQTYKL-----------------
UXAC_XANAC      EATEVAIDLAYRLPKQAYKL-----------------
UXAC_XANOR      EATEVAIDLAYRMPKRAYNL-----------------
UXAC_XANCP      EAMEVAIDLAYRLPKQAYKL-----------------
UXAC_XANC8      EAMEVAIDLAYRLPKQAYKL-----------------
UXAC_CAUVC      EAEELIVDLTYNLPKKAYKLDQRPDWARPATLRAAAE
UXAC_RHIWR      EAADLAVDLTYRLVKSAYRL-----------------
UXAC_SPHAL      EAAELAADLSYNLAKASYKL-----------------
UXAC_NOSP7      EGYDMARALAYDLAKSAYKLD----------------
UXAC_COREF      RASEIIVDLIDASPRRVFKL-----------------
UXAC_CUTAK      EAVEIAHRLVVEQPTQVFGL-----------------
                    :   :