CLUSTAL format seed alignment for MF_00678

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y582_RHIEC       ----------MAAGDFRLCDVVLDD-TIGRSTPDVEHERAVAIFDLIEENRFEPLGHS--
Y614_RHIL3       ----------MAKGEFRLCDVVLDD-TIGRSTPDVEHERAVAIFDLIEENRFEPLGHA--
Y536_AGRFC       ----------MASGDFRLCDVVLDD-SIGRSTPDVEHERAVAIFDLIEENTFEPAGHD--
Y612_RHIME       ---------MKADRNLRLCDVVLDE-TIGRSTPDVEHERAVAIFDLLEENLFEPVGHP--
Y1669_BRUME      -------MT-ADVPNARLVDVELDE-SIGRSTPDVEHERAVAIFDLIEENSFHPVGDQ--
Y251_BRUSU       -------MT-ADVPNARLVDVELDE-SIGRSTPDVEHERAVAIFDLIEENSFHPVGDQ--
Y279_BRUAB       -------MT-ADVPNARLVDVELDE-SIGRSTPDVEHERAVAIFDLIEENSFHPVGDQ--
Y284_BRUA2       -------MT-ADVPNARLVDVELDE-SIGRSTPDVEHERAVAIFDLIEENSFHPVGDQ--
Y325_BRUA4       -------MT-AAVPNARLVDVELDE-SIGRSTPDVEHERAVAIFDLIEENSFHPIGDD--
Y6455_RHILO      -------MTGSDQTRAKLIDIELDE-SIGRSTPDVEHERAVAIFDLIEENSFQPVNDS--
Y189_CHESB       -------MGERSSAKARLIDVELDE-TVGRAPPDVEHERAVAIFDLVEENTFHPVGDQ--
Y898_BRASB       ---MTQHPP-GDDRTNRIVAVTLDEESIGRSGPDIEHERAIAIYDLVEENLFAPEGAD--
Y6636_BRASO      ---MTQHPP-GDDRTNRIVAVTLDEESIGRSGPDIEHERAIAIYDLVEENLFAPEGAD--
Y1257_BRADU      ---MTKPPE-QDDSNNRIVAVTLDEESIGRSGPDIEHERAIAIYDLIEQNLFAPEGAD--
Y287_NITHX       ---MSKTPPKED-SRNRIVAVMLDEDSIGRSGPDIEHERAIAIYDLVEKNLFAPEGA---
Y248_NITWN       ---MSKETPSEDDSRHRIVAVTLDEDSIGRSGPDIEHERAIAIYDLVEKNLFAPEGA---
Y4530_RHOPA      ---MSNPEP--DDSNNRIVAVTLDEESIGRSGPDIEHERAIAIYDLVEKNLFAPEGA---
Y4349_RHOP2      ---MSNPQP--DDSNNRIVAVTLDEESIGRSGPDIEHERAIAIYDLVEKNLFAPEGA---
Y4278_RHOPS      ---MSTSQP--DDSNNRIVAVTLDEESIGRSGPDIEHERAIAIYDLVEKNLFAPEGA---
Y4483_RHOP5      ---MTTAAP--DDSKNCIVAVTLDEESIGRSGPDIEHERAIAIYDLVEKNLFAPEGA---
Y4416_RHOPB      ---MSQQEP--DDSRNCIVAVTLDEESIGRSGPDIEHERAIAIYDLVEKNLFAPQGG---
Y3341_MAGSA      -----------MPHRQKLAKIELVEKYQVRRAAEVEHERAVAVYDLLEENYFAPNGD---
Y2770_RHORT      ------MEEGELKDTDHLIDIQLDEVTFVRRRPEVEHERAVAIFDLLEDNHFGIKG----
YA965_ERYLH      -------MAQ-----HRISHISLDENTILWRNADIEQERRVAIYDLIEENTFKPVRSNA-
Y143_NOVAD       -------MGD-----PRISHIELDEATIIWRNADIEQERRIAIFDLIEENTFKPLRAFE-
Y765_SPHAL       -------MSDADPSLQRIISVELDEGSIVWRNPDVEQERRVAIFDLIEENRFVPQRGHP-
Y1069_ROSDO      --------------MSRISHITLDDSGLPPPTPEIEQERKVAMFDLLEDNTFVLPPREGR
Y4072_RUEPO      ------------MTMSRISHIELDDSNLPPPTPEIEQERKVAIYDLLEENSFALPARDDR
Y3562_RUEST      --------------MSRISQIELDDRNLPPPTPEIEQERKVAIFDLIEENSFVLPKRDER
Y2882_JANSC      --------------MMHICHIEIDTQGLPAPTPEIEQERKVAIFDLLEENTFTLPHED--
Y2236_CERS4      --------------MNRICHIEIDQTSPIPPTAEIEQERQVAIFDLLEENSFALPAREGR
Y2283_RHOS1      --------------MNRICHIEIDQTSPIPPTAEIEQERQVAIFDLLEENSFALPVREGR
Y594_CERS5       --------------MNRICHIEIDQASPIPPTAEIEQERQVAIFDLLEENSFALPPREGK
Y1958_PARDP      ----------MSQSANRLCRIDIDDSALPPPSPEIEQDRRVAVFDLLEDNSFTLPGREGQ
Y2345_CAUVC      -------MSTDARANHRIKSIEIDEESLAAASRDQEQERQVAIFDLLEGNYFEPAEAG--
Y1347_HYPNA      ------------MGANRLVAVHIDEETLGASGPDAEHERRVAIFDLIEENTFGVIGED--
Y1128_MARMM      ----------MSQSDDRIVRIDLDGASMGPGDVNADHERRVAIADLLEGNRFRPDGE---
Y160_ACICJ       ---MADGAAEIRG---RLRRVVLDEDIGGALSPMQEADRNQAIADLAADNRFALGTHPDA
Y1393_GRABC      MSAKQDDTQPIQAASKRLLKVILEGEALTRLSPLQEMDRAQAVADLEAENVFSLERPLPG
Y4UD_SINFN       ----------MTGAEFRLCDVALDC-SFKTRDQRVEREQALAVLDLLEASTFVPVGHH--
                                  :  : :            : ::  *: **   . *        

Y582_RHIEC       ------GGPYRLNISLMDSKLVFAIKTEEG----GDVATHILSLTPFRRIVKDYFMICES
Y614_RHIL3       ------GGPYRLNISLVDSKLVFAITTEEG----GGVATHILSLTPFRRIVKDYFMICES
Y536_AGRFC       ------GGPYRLHISLVDAKLVFAIKTEDD----KDVSTHILSLTPFRRIIKDYFLICES
Y612_RHIME       ------GGPYRLNLSLVDAKLVFRISTDGG----TEVATHILSLTPFRRIVKDYFMICES
Y1669_BRUME      -----KGGPYRLKLSLMESRLIFSITRENG----DAVATHILSLTPLRRVVRDYFMICES
Y251_BRUSU       -----KGGPYRLKLSLMESRLIFSITRENG----DAVATHILSLTPLRRVVRDYFMICES
Y279_BRUAB       -----KGGPYRLKLSLMESRLIFSITRENG----DAVATHILSLTPLRRVVRDYFMICES
Y284_BRUA2       -----KGGPYRLKLSLMESRLIFSITRENG----DAVATHILSLTPLRRVVRDYFMICES
Y325_BRUA4       -----TGGPYRLKLSLMESRLIFAITREAG----EDVATHILSLTPLRRVVRDYFMICES
Y6455_RHILO      -----GAGPYRLKLSLAEQRLVFAVAREDG----TAVVTHILSLTPLRRIVKDYYMICES
Y189_CHESB       -----AGGPYRLKISLIDSRLALSVTREGG----DPVVTHMLSLTPFRRIVKDYFLVCES
Y898_BRASB       -----GQGPFTLHLGITANRLMFDIRKEDG----TPVVTHLLSLSPFRRIVKDYFMICDS
Y6636_BRASO      -----GAGPFTLHLGITANRLMFDIRKEDG----TPVVTHLLSLSPFRRIVKDYFMICDS
Y1257_BRADU      -----GKGPFTLHIGITGNRLMFDIRREDG----APVVVHLLSLGPFRGIVKDYFMICDS
Y287_NITHX       -----GGGPFTLRIAITGNRLMFDIRREDD----APVVTHLLSLTPFRRIVKDYFMICDS
Y248_NITWN       -----EGGPFTLHIAITGNRLMFDIRREDG----APVVTHLLSLTPFRRIVKDYFMICDS
Y4530_RHOPA      -----GEGPFTLHIGITGNRLMFDIRREDG----APVITHLLSLTPFRRIVKDYFMICDS
Y4349_RHOP2      -----GEGPFTLHIGITGSRLMFDIRREDG----TPVVAHLLSLSPFRRIVKDYFMICDS
Y4278_RHOPS      -----GDGPFTLHIGITGSRLMFDIRREDG----APVITHLLSLSPFRRIVKDYFMICDS
Y4483_RHOP5      -----SEGPFTLHLGITGNRLMFDIRREDG----TPVVAHLLSLSPFRRIVKDYFMICDS
Y4416_RHOPB      -----GEGPYTLHIGITGNRLMFDIRREDG----SPVMVHLLSLTPFRRIVKDYFMICDS
Y3341_MAGSA      -----FIGPYALYIKLEDTRLIFDVRKEDE----TPLVQVPLPLKTFQSIVKDYFMICES
Y2770_RHORT      -----FQGPFRLVLSLAENRLLFDIRDGED----KPLRKVILSLRPFRMIVKDYFMICES
YA965_ERYLH      AG---HTGPYRLHLSVQDGRLAMDIRDRDD----EELEMLILGLARFRRPIREYFAICDS
Y143_NOVAD       AG---HEGPYRLKLSVEDGRLALTVSDDDGNGGGQLLETVILGLGRFRRPIREYFAICDS
Y765_SPHAL       DG---YAGPYRLKLRVEDGRLIFEIAREDG----SPLEAVILGLGRFRRPIRDYFAICDS
Y1069_ROSDO      PV---PEGPYHVSLAIRDKRLVFDVNTETA----EKAAEFHLSLGPFRQVVKDYFQICES
Y4072_RUEPO      AV---PEGPYRVNLSIRDKRLVFDIQTEDE----EKAAEFHLSLGPFRQVVKDYFQICES
Y3562_RUEST      DV---PEGPYHLSLSIREKRLVFDVQTEGG----DKAAEFHLSLSPFRQVVKDYYQICES
Y2882_JANSC      -A---PSGPYRLSLAIREKRLVFDIDTEDG----AEAAEFHLSLAPFRQTVKDYWQICEA
Y2236_CERS4      AP---AEGPFRLTLAIREGRLVFDIRSEEE----ETVGEFHLSLGPFRQVVKDYFQICES
Y2283_RHOS1      AP---AEGPFRLTLAIREGRLVFDIRSEEE----EKVGEFHLSLGPFRQVVKDYFQICES
Y594_CERS5       PP---VEGPFRLTLAIREGRLVFDIRSQED----EKVGEFHLSLGPFRQVVKDYFQICES
Y1958_PARDP      DV---PPGPYALALAVREKRLVFDIATESG----SKVAEFHLSLGPFRQTVKDYFQICTS
Y2345_CAUVC      ------DGPYDVRLSLIENRLAFDIAS--A----GHARRHLLSLSPFRGVIKDYFLICDS
Y1347_HYPNA      ------RGPYVLALSQHERRLVFAIRTEPG----EEVHTFILSLSPFRGVIRDYFTICDS
Y1128_MARMM      -----VDGPYALRLAIEHDRLVFDVRLEDD----TPVHGFMFALGPLRRIVKDYFLICES
Y160_ACICJ       VT--------ILHLSVQDGRLVFDVRDEAD----ETLQTLVLAPGPFRSMIRDYQMLLDS
Y1393_GRABC      MTPVSEQGPYVLHLSIQEGRLIFDIRRQDD----TFLTVLALALGPFRRLIKDYHLLVDS
Y4UD_SINFN       ------GGPYRLKISMAAGRLVFHIADDKG----AHIVSHHLSLAPFRRLLNDYSRTCEG
                            : :     :* : :                :    ::  :.:*     .

Y582_RHIEC       YYEAIRSATPSRIEAIDMGRRGIHNEGSQTLKDRLAGKIEVDFDTARRLFTLVCVLYWRG
Y614_RHIL3       YYEAIRSSTPSRIEAIDMGRRGIHNEGSQTLKDRLAGKIEVDFDTARRLFTLVCVLYWRG
Y536_AGRFC       YYEAIRSSTPSQIEAIDMGRRGIHNDGSQTLMDRLSGKIKVDFDTARRLFTLVCVLYWRG
Y612_RHIME       YYQAIRSATPSQIEAIDMGRRGIHNEGSQTLMDRLSGKIRLDFDTARRLFTLVCVLYWRG
Y1669_BRUME      YYQAIRSATPSKIEAIDMGRRGLHNEGSQTLQARLKGKIEVDFDTARRLFTLVCVLHWRG
Y251_BRUSU       YYQAIRSATPSKIEAIDMGRRGLHNEGSQTLQARLKGKIEVDFDTARRLFTLVCVLHWRG
Y279_BRUAB       YYQAIRSATPSKIEAIDMGRRGLHNEGSQTLQARLKGKIEVDFDTARRLFTLVCVLHWRG
Y284_BRUA2       YYQAIRSATPSKIEAIDMGRRGLHNEGSQTLQARLKGKIEVDFDTARRLFTLVCVLHWRG
Y325_BRUA4       YYQAIRSATPSKIEAIDMGRRGLHNEGSQTLQNRLQGKIEVDFNTARRLFTLVCVLHWRG
Y6455_RHILO      YYDAIRSSTPSHIEAIDMGRRGLHNEGSQTLMDRLSGKIDIDFDTARRLFTLVCVLHWRG
Y189_CHESB       YYQAIRSATPSQIEAIDMGRRGLHNEGSQTLMDRLNGKIEVDFNTARRLFTLICVLHWRR
Y898_BRASB       YYNAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLKGKVRVDFETSRRLFTLITVLHWKG
Y6636_BRASO      YYNAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLKGKVRVDFETSRRLFTLITVLHWKG
Y1257_BRADU      YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLKGKVRVDFETSRRLFTLITVLHWKG
Y287_NITHX       YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLNGKVRVDFETARRLFTLISVLHWKG
Y248_NITWN       YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLNGKVHVDFETARRLFTLISVLHWKG
Y4530_RHOPA      YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLAGKVRIDFETARRLFTLISVLHWKG
Y4349_RHOP2      YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLAGKVRIDFETARRLFTLISVLHWKG
Y4278_RHOPS      YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLSGKVRIDFETARRLFTLISVLHWKG
Y4483_RHOP5      YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLAGKVRIDFETARRLFTLISVLHWKG
Y4416_RHOPB      YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLAGKVRIDFETARRLFTLISVLHWKG
Y3341_MAGSA      YFAAIKKSTPSQIEAIDMGRRGLHNEGSELLRERLGGKIDVDFDTARRLFTLICVLHIRG
Y2770_RHORT      YFSAIRSMTPAQIEAIDMGRRGLHNEGGAVLKERLAGKVVVDHDTARRLFTLICVLHARG
YA965_ERYLH      YYQAIRKATPSEIETIDMARRGVHNHAAELLIERLEGKVETDFPTARRLFTLICVLHIKG
Y143_NOVAD       YYQAIRKATATEIETIDMARRGVHNEAAEMLLERLQGKIDTDFATARRLFTLICVLHIRG
Y765_SPHAL       YYQAIKTSTAQQIETVDMARRALHNEAAEMLMDRLDGKIAVDFDTARRLFTLICVLHIKG
Y1069_ROSDO      YFDAVKKLPPSQIETIDMARRGIHNEGSRVLQERLEGKADIDIDTARRLFTLICVLHFGG
Y4072_RUEPO      YFNAVKTLPPSQIETIDMARRGIHNEGSRVLQERLDGKAEIDTDTARRLFTLICVLHFGG
Y3562_RUEST      YFTAVKTLPPSQIETIDMARRGIHNEGSRVLQERLEGKAEVDTDTARRLFTLICVLHFGG
Y2882_JANSC      YFDAVKKLPPSQIEAIDMARRGIHNEGARLLQERLEGKAEIDTDTARRLFTLICVLHFGA
Y2236_CERS4      YFEAVKRLPPSQIEAIDMARRGIHNEGARVLKERLEGKAEVDIDTARRLFTLICVLHWG-
Y2283_RHOS1      YFEAVKRLPPSQIEAIDMARRGIHNEGARVLKERLEGKAEVDIDTARRLFTLICVLHWG-
Y594_CERS5       YFEAVKRLPPSQIEAIDMARRGIHNEGARVLKERLEGKAEVDIDTARRLFTLICVLHWG-
Y1958_PARDP      YFDAVKRLPPAQIEAIDMARRGIHNEGARTLQERLEGKAEVDIDTARRLFTLICALVPG-
Y2345_CAUVC      YYSAIRNSSPQQIEALDMGRRGLHNEGSNLLRERLEGKVKTDLDTARRLFTLICALHWRG
Y1347_HYPNA      YYEAIRMSTPHQIEAIDMARRGIHNEGSELLKERLEGKIDIDFHTARRLFTLICALHAGQ
Y1128_MARMM      YYEAVRDAPLERIEAIDMARRGVHNEGSTLLRERLVGKIDVDFDTARRLFTLICALHRRA
Y160_ACICJ       YATAVAEGREARIQAIDMGRRGLHNEGAELVMARLDGKVLLDFDTARRLFTLICALHRRA
Y1393_GRABC      YVKAVQEAREARIQAIDMGRRGLHNEGAELMRHRLNGKISIDFETARRLFTLVCVLHQRI
Y4UD_SINFN       YYEAMCRSNLERLQAIDMGRRGIHDEAAELLRERLSAKVDIDKDTARRLFTLIYALLARN
                 *  *:      .::::**.**.:*:...  :  ** .*   *  *:******: .*    

Y582_RHIEC       --------
Y614_RHIL3       --------
Y536_AGRFC       --------
Y612_RHIME       --------
Y1669_BRUME      --------
Y251_BRUSU       --------
Y279_BRUAB       --------
Y284_BRUA2       --------
Y325_BRUA4       --------
Y6455_RHILO      --------
Y189_CHESB       --------
Y898_BRASB       EGQ-----
Y6636_BRASO      EGQ-----
Y1257_BRADU      --------
Y287_NITHX       --------
Y248_NITWN       NA------
Y4530_RHOPA      --------
Y4349_RHOP2      --------
Y4278_RHOPS      --------
Y4483_RHOP5      --------
Y4416_RHOPB      --------
Y3341_MAGSA      --------
Y2770_RHORT      --------
YA965_ERYLH      --------
Y143_NOVAD       --------
Y765_SPHAL       --------
Y1069_ROSDO      --------
Y4072_RUEPO      --------
Y3562_RUEST      --------
Y2882_JANSC      --------
Y2236_CERS4      --------
Y2283_RHOS1      --------
Y594_CERS5       --------
Y1958_PARDP      --------
Y2345_CAUVC      --------
Y1347_HYPNA      GRAPGA--
Y1128_MARMM      AS------
Y160_ACICJ       --------
Y1393_GRABC      --------
Y4UD_SINFN       SGHQILLN