CLUSTAL format seed alignment for MF_00679

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HSCA_BUCAI      --------MIFFKKKHDKKLLLGIDLGTTYSLAATVREKSVILLLDKKKRYLLPSVVHYK
HSCA_BUCAP      --------MVFLKNKVKKKLILGIDFGTTYSLLASVQNERVVLLTDDKKRYLLPSIVNFN
HSCA_HAEIN      MALLQIAEPGQAAAPHQHRLAVGIDLGTTNSLVASVRSGQSVILNDEQERSLVPSVVHYG
HSCA_PASMU      MALLQIAEPGQSASPHQHKLAVGIDLGTTNSLIATVRSGQVDILLDEKERPLLPSVVHFE
HSCA_VIBPA      MALLQIAEPGQSSAPHEHKLAAGIDLGTTNSLVASVRSGDATTLNDEQGRSILPSVVNYS
HSCA_VIBVU      MALLQIAEPGQSSAPHEHKRAAGIDLGTTNSLVASVRSGTADTLKDAQGRSLLPSIVNYA
HSCA_VIBCH      MALLQIAEPGQSSAPHQHKLAAGIDLGTTNSLVASVRSGTASTLVDSQGRSILPSVVNYG
HSCA_ECOLI      MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLADHEGRHLLPSVVHYQ
HSCA_SHIFL      MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLADHEGRHLLPSVVHYQ
HSCA_ECOL6      MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLADHEGRHLLPSVVHYQ
HSCA_SALTI      MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLPDHEGRHLLPSVVHYQ
HSCA_SALTY      MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLPDHEGRHLLPSVVHYQ
HSCA_SHEON      MALLQIAEPGQSAAPHQHRLAVGIDLGTTNSLVAAVRSGVTATLPDENGQHSLPSIVRYT
HSCA_PSEPK      MALLQIAEPGQSPQPHQRRLAVGIDLGTTNSMVAALRSGRSEPLPDAQGNVILPSAVRYL
HSCA_PSESM      MALLQIAEPGLSPQPHQRRLAVGIDLGTTNSLVAAVRSGLSEPLADAEGQVILPSAVRYH
HSCA_PSEAE      MALLQIAEPGQSPKPHERRLAVGIDLGTTNSLVAAVRSGVAEPLPDAQGRLILPSAVRYH
HSCA_AZOVI      MALLQIAEPGQSPQPHQRRLAVGIDLGTTNSLVATLRSGLAESLKTPRGND-PASAVRYL
HSCA_RALSO      MALLQISEPGESPAPHQRRLAVGIDLGTTNSLVAAVRSSVPEVLPDEQGRPLLPSVVRYL
HSCA_NEIMA      MALLQISEPGMSAAPHRHRLAAGIDLGTTNSLVATVRSGSAACLPDAEGRVTLPSVVRYL
HSCA_NEIMB      MALLQISEPGMSAAPHRHRLAAGIDLGTTNSLVATVRSGSAACLPDAEGRVTLPSVVRYL
HSCA_ACIAD      MALLQIAEPGQSSAPHEHRIAIGIDLGTTHSLVATVLSGQSKVLQDEKGRVLFPSIVHYA
HSCA_RICPR      MQIIEITEPKQTDFQQKLQIAVGIDFGTTNSLIAIATNRKVKIIKSIGDKELIPTTIDFI
HSCA_RICTY      MQIIEITEPKQTDCQQKLQIAVGIDFGTTNSLIAIATNRKVNIIKSKGDKELIPTTIDFI
HSCA_RICCN      MQIIEIREPEQADFKQERQIAVGIDFGTTNSLIAIAANRQVKVIKSIDDKELIPTTIDFT
                                  :   ***:*** *: *   .     :     .   .: : : 

HSCA_BUCAI      K-NKISVGWKALENITEDPTNTISSVKRLLGRSINFVKKKFPILPYLIEKDIHEGIFFRT
HSCA_BUCAP      K-KKPLIGWEAEKKIIKDPINTITSVKRLIGRSIDFIKKEFPILPYVIEDNKDGGILFHT
HSCA_HAEIN      V-EEKKVGLEAFEQASLDPKNTVISVKRLIGRSLSDVQSRYSSLPYEFVASENGLPLIIT
HSCA_PASMU      Q-DNVIVGYEAAELASQSPQNTIVSVKRLIGRSLADVQQRYPSLPYQFEASENGLPLIRT
HSCA_VIBPA      A-ESTVVGYDAKAKAEFEPENTIISVKRLIGRSLKDIQSRYPSLPYRFKESDNGLPVLQT
HSCA_VIBVU      N-EEAIVGYEAKALSESQPQDTIISVKRLLGRSLTDIQTRYPSLPYRFKASENGLPVLQT
HSCA_VIBCH      A-DATRVGYPAREQAETDPHNTVISVKRLLGRSLQDINQRYPHLPYRFKASEKGLPIVQT
HSCA_ECOLI      Q-QGHSVGYDARTNAALDTANTISSVKRLMGRSLADIQQRYPHLPYQFQASENGLPMIET
HSCA_SHIFL      Q-QGHSVGYDARTNAALDTANTISSVKRLMGRSLADIQQRYPHLPYQFQASENGLPMIET
HSCA_ECOL6      Q-QGHSVGYDARTNAALDTANTISSVKRLMGRSLADIQQRYPHLPYQFQASENGLPMIET
HSCA_SALTI      Q-QGHTVGYAARDNAAQDTANTISSVKRMMGRSLADIQARYPHLPYRFKASVNGLPMIDT
HSCA_SALTY      Q-QGHTVGYAARDNAAQDTANTISSVKRMMGRSLADIQTRYPHLPYRFKASVNGLPMIDT
HSCA_SHEON      Q-EGIEVGYVAAMSSAQDPKNTIVSVKRFMGRSLTDIQSGEQSFPYQFEASENGLPLFVT
HSCA_PSEPK      E-GRNEVGQAARDAASSDPLNTVLSVKRLMGRGLADVKQLGEQLPYRFVGGESHMPFIDT
HSCA_PSESM      A-DRVEVGQAAKAAASQDPFNTVLSVKRLMGRGLSDVKQLGEQLPYRFVGGESHMPFIDT
HSCA_PSEAE      A-ERAEVGESARAAAAEDPFNTVISVKRLMGRGLEDVKQLGEQLPYRFRQGESHMPFIET
HSCA_AZOVI      P-DGRRVGRAAKAAAAVDPLNTVLSVKRLMGRGIADVKLLGEQLPYRFAEGESHMPFIET
HSCA_RALSO      PAGGAQIGYKAQVEAVRDPKNTIVSVKRFMGRGLKDVAHI-ENTPYDFVDA-PGMVQLKT
HSCA_NEIMA      ENGGIEVGKTALSAQKTDPLNTVSSAKRLIGRTLADLHQNTHYLPYRFGDN-QRVIELHT
HSCA_NEIMB      ENGGIEVGKTALSAQKTDPLNTVSSAKRLIGRTLADLHQNTHYLPYRFGDN-QRVIELHT
HSCA_ACIAD      E-QSIEYGDDAKPFITTDPKNSIISVKRFMGRSKADIKFQ---HPYVLVGNDNEMPAFET
HSCA_RICPR      N-----------EDLIIGNNKGLHSIKRLFGKTLKEILNTTTLFSLVKDYLDINSSELKL
HSCA_RICTY      N-----------EDLIIGNNKGLRSIKRLFGKTLKEILNTKTLFALVKDYLDINSSELKL
HSCA_RICCN      S-----------NNFTIGNNKGLRSIKRLFGKTLKEILNTPALFSLVKDYLDVNSSELKL
                                    . : * **::*:    :       .            .  

HSCA_BUCAI      NFGNIT--PIDVSSHILKKLKKRAVLLFNQEIDASVITVPAYFNDFQKKETKKAAVLSGI
HSCA_BUCAP      NSGLVT--PIDVTSEILKFLKEKSCEFFNKKIDATVITVPAYFDNLQRDSIKKAAISAKI
HSCA_HAEIN      AQGAKS--PIEVSSDILSRLNHIAEQRLGGELSGVVITVPAYFDDAQRQSTKDAARLAGL
HSCA_PASMU      SKGTLS--PVEISAEILKKLTALAEKRLAGELSGAVITVPAYFDDAQRQSTKDAAKLAGI
HSCA_VIBPA      AQGDKN--PIEVSADILKALGKRAEETLGGDLAGVVITVPAYFDDAQRAGTKDAAKLAGL
HSCA_VIBVU      TQGDKN--PIEVSADILKVLAKRAEESLGGELSGVVITVPAYFDDAQRAGTKDAAKLAGL
HSCA_VIBCH      AQGDKN--PIQISADILKALAERATATLGGELAGVVITVPAYFDDAQRVATKDAAALAGL
HSCA_ECOLI      AAGLLN--PVRVSADILKALAARATEALAGELDGVVITVPAYFDDAQRQGTKDAARLAGL
HSCA_SHIFL      AAGLLN--PVRVSADILKALAARATEALAGELDGVVITVPAYFDDAQRQGTKDAARLAGL
HSCA_ECOL6      AAGLLN--PVRVSADILKALAARATEALAGELDGVVITVPAYFDDAQRQGTKDAARLAGL
HSCA_SALTI      AAGLLN--PVRVSADILKALAARASESLSGELDGVVITVPAYFDDAQRQGTKDAARLAGL
HSCA_SALTY      AAGLLN--PVRVSADILKALAARASESLSGELDGVVITVPAYFDDAQRQGTKDAARLAGL
HSCA_SHEON      PQGLVN--PVQVSAEILRPLIERAEKTLGGELQGAVITVPAYFDDAQRQGTKDAASLLGV
HSCA_PSEPK      VQGPKS--PVEVSADILKVLRERAEATLGGELVGAVITVPAYFDDAQRQATKDAARLAGL
HSCA_PSESM      VQGAKS--PVEVSADILKVLRQRAEAALGGELVGAVITVPAYFDDSQRQATKDAAKLAGL
HSCA_PSEAE      VQGLKS--PVEVSADILRELRQRAETTLGGELVGAVITVPAYFDDAQRQATKDAARLAGL
HSCA_AZOVI      VQGPKS--PVEVSAEILRVLRRRAEEALGGELVGAVITVPAYFDEAQRQATKDAARLAGL
HSCA_RALSO      VAGVKS--PVEVSAEILATLRQRAEDTLGDDLVGAVITVPAYFDDAQRQATKDAARLAGL
HSCA_NEIMA      RQGVKT--PVEVSAEILKTLKSRAEETLGGDLVGVVITVPAYFDDAQRQATKDAARLAGL
HSCA_NEIMB      RQGVKT--PVEVSAEILKTLKSRAEETLGGDLVGVVITVPAYFDDAQRQATKDAARLAGL
HSCA_ACIAD      AQGRKT--PVEISAAILNQLKIRAEESLKNPINGAVITVPAYFDEAQRQATRDAAQLAGL
HSCA_RICPR      NFANKKMRIAEIAAEVFIYLKNQAEKQLKNNITKAVITVPAHFNDAARGEIMLAAKIAGF
HSCA_RICTY      NFANKKMRIAEIAAEVFIYLKNQAEKQLKNNITKAVITIPAHFNDTARGEIMLAAKIAGF
HSCA_RICCN      NFANKQLRVPEIAAEIFIYLKNQAEEQLKTNLTKAVITVPAHFNDAARGEVMLAAKIAGF
                  .        ::: ::  *   :   :   :   ***:**:*::  :     **    .

HSCA_BUCAI      NLIRLLNEPTAAAVAYGLQK----LKKGIVLVYDLGGGTFDVSILNLNKGIFEVLATSGD
HSCA_BUCAP      NLIRLLNEPTSAAVAYGLQL----NTEGLVVVYDLGGGTFDISVLKLNKGIFEVLGTAGH
HSCA_HAEIN      NVLRLLNEPTAAALAYGLDS----GQEGIIAVYDLGGGTFDISILRLSKGIFEVLATGGD
HSCA_PASMU      NVLRLLNEPTAAAIAYGLDS----GQEGVIAVYDLGGGTFDISILRLSKGVFEVLATGGD
HSCA_VIBPA      HVLRLLNEPTAAAIAYGLDS----GQEGVIAVYDLGGGTFDISILRLSKGVFEVLATGGD
HSCA_VIBVU      HVLRLLNEPTAAAIAYGLDS----GQEGVIAVYDLGGGTFDISILRLSKGVFEVLATGGD
HSCA_VIBCH      HVLRLLNEPTAAAIAYGLDS----GQEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGD
HSCA_ECOLI      HVLRLLNEPTAAAIAYGLDS----GQEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGD
HSCA_SHIFL      HVLRLLNEPTAAAIAYGLDS----GQEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGD
HSCA_ECOL6      HVLRLLNEPTAAAIAYGLDS----GQEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGD
HSCA_SALTI      HVLRLLNEPTAAAIAYGLDS----GKEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGD
HSCA_SALTY      HVLRLLNEPTAAAIAYGLDS----GKEGVIAVYDLGGGTFDISILRLSRGVFEVLATGGD
HSCA_SHEON      KVLRLLNEPTAAAIAYGLDS----KQEGVIAIYDLGGGTFDISILRLNRGVFEVLATGGD
HSCA_PSEPK      NVLRLLNEPTAAAVAYGLDQ----NAEGVVAIYDLGGGTFDISILRLTAGVFEVLATGGD
HSCA_PSESM      NVLRLLNEPTAAAVAYGLDQ----KAEGVIAIYDLGGGTFDISILRLTGGVFEVLATGGD
HSCA_PSEAE      NVLRLLNEPTAAAVAYGLDK----GAEGLVAIYDLGGGTFDISILRLTRGVFEVLATGGD
HSCA_AZOVI      DVLRLLNEPTAAAVAYGLDR----GAEGVVAIYDLGGGTFDISILRLTRGVFEVLATGGD
HSCA_RALSO      NVLRLLNEPTAAAIAYGLDN----AAEGVYAVYDLGGGTFDISVLKLTKGVFEVMSTGGD
HSCA_NEIMA      NVLRLLNEPTAAAIAYGLDN----ASEGTFVVYDLGGGTFDVSVLQLTKGLFEVKATGGN
HSCA_NEIMB      NVLRLLNEPTAAAIAYGLDN----ASEGTFVVYDLGGGTFDVSVLQLTKGLFEVKATGGN
HSCA_ACIAD      NVLRLLNEPTAAAIAYGLDQENQLSSDRNYVIYDLGGGTFDVSILRFSQGVFEVLATGGH
HSCA_RICPR      EVLRLIAEPTAAAYAYGLNK----NQTGRYLVYDLGGGTFDVSILNIQEGIFQVIATNGD
HSCA_RICTY      EVLRLIAEPTAAAYAYGLNR----NQTGRYLVYDLGGGTFDVSILNIQEGIFQVIATNGD
HSCA_RICCN      EVLRLIAEPTAAAYAYGLNK----NQKGCYLVYDLGGGTFDVSILNIQEGIFQVIATNGD
                .::**: ***:** ****:            :*********:*:*.:  *:*:* .* *.

HSCA_BUCAI      SNLGGDDFDDALAKNIYKKSNLQNRCNDFFQTSLLQIAKSTKLKLTKYEKVEVHFFDWKG
HSCA_BUCAP      ANLGGDDFDTLLSKYIYKKLNLSNQCDNFFQSLLLKKAKEIKIKLTKYEKVEVNFFNWKG
HSCA_HAEIN      TALGGDDFDHLIADWVIEQTKL-KPQTANQQRELITLANQAKITLTNEKSAVISWQDFSV
HSCA_PASMU      TALGGDDFDHQLMDWIVAQSGI-APQNAQQQRQLTELATQIKIALTDKLETSISYQGWQG
HSCA_VIBPA      SALGGDDFDHLLADYLMEQAGLEAPLSAEKNRALLNIATATKIAFSEQDSVEVDVFGWKG
HSCA_VIBVU      SALGGDDFDHLLADFLAEQAGLETPLSAEKNRTLLNIATATKIAFSEQDSVEVEVFGWKG
HSCA_VIBCH      SALGGDDFDHLIADHLQAQIGL-TSLTAEQQRALINAATQAKIDLTEYMTAELNVLGWQG
HSCA_ECOLI      SALGGDDFDHLLADYIREQAGIPDRSDNRVQRELLDAAIAAKIALSDADSVTVNVAGWQG
HSCA_SHIFL      SALGGDDFDHLLADYIREQADIPDRSDNRVQRELLDATIAAKIALSDADSVTVNVAGWQG
HSCA_ECOL6      SALGGDDFDHLLADYIREQAGIPDRSDNRVQRELLDAAIAAKIALSDADSVTVNVAGWQG
HSCA_SALTI      SALGGDDFDHLLADYIREQAGIADRSDNRVQRELLDAAITAKIALSDADTVRVNVAGWQG
HSCA_SALTY      SALGGDDFDHLLADYIREQAGIADRSDNRVQRELLDAAIAAKIALSDADTVRVNVAGWQG
HSCA_SHEON      SALGGDDFDHLLQAHMLQVWQL-TDIDSQLSRQLLIEARRVKEALTYASDTEASLTLADG
HSCA_PSEPK      TALGGDDFDHAIAGWIIEQAGLSSDLDPATQRALLQTACAAKEALTDADVVSVSHGAWHG
HSCA_PSESM      TALGGDDFDHAIASWIVADAGLSADLDPSAQRSLLQAACSAKEALTDAEFVEVTHGEWRG
HSCA_PSEAE      TALGGDDFDHAIAGWVIEQAGLSADLDPGSQRQLLQIACAAKERLTDEASVRVAYGDWSG
HSCA_AZOVI      SALGGDDFDHAIANWIVEQAGLSADLDPGVQRHLLQLACAAKEALSDSGSVTLAYGPWQG
HSCA_RALSO      SALGGDDFDQRIACWIVEQAGLQP-LSAEDMRLLLNKARAAKEWLSGADSTEVDAVLSTG
HSCA_NEIMA      SALGGDDFDHRLFCRLLEQNGLSQLNEQDSQ-LLLSLVRAAKEQLTTQTEARIQATLSDG
HSCA_NEIMB      SALGGDDFDHRLFCRLLEQNGLSQLNEQDSQ-LLLSLVRAAKEQLTTQTEARIQATLSDG
HSCA_ACIAD      TALGGDDLDRLIVKWAKKQLHI-ESLDDHEYAAFLVAARTAKEQLSEQQSVYFKALDHKL
HSCA_RICPR      NMLGGDDIDVVITQYLCNKFDLPH------SIETLQLAKKAKEILTYKESFNNDIISINK
HSCA_RICTY      NMLGGDDIDVVITQYICNKFDLPN------SSETLQLAKKAKETLTYKESFNNDIISINK
HSCA_RICCN      NMLGGNDIDVVITQYLCNKFDLPN------SIDTLQLAKKAKETLTYKDSFNNDNVSINK
                  ***:*:*  :         :               .   *  ::              

HSCA_BUCAI      YITRE-----EFNLIIIDFIKKTLFICSDLLEEINLSVEQIKEVIMVGGSTRIPLVHTEV
HSCA_BUCAP      IIFRD-----EFNLIIKDLIQKTLFICSNLLKEIDLKIESIKEVIMVGGSTRVPLVYQEV
HSCA_HAEIN      EISRE-----QFNELIYPLVKRSLLTCRRALKDANVESEEVQAVVMVGGSTRVPYVREQV
HSCA_PASMU      NISRE-----QFNQLIQGLVKRSLLACRRALKDADVSADEVCEVVMVGGSTRVPFVREQV
HSCA_VIBPA      TVTRE-----QFEDLIRPLVKKTLMSCRRALKDADVEAEEVLEVVMVGGSTRTLLVREMV
HSCA_VIBVU      VVTRE-----QFEELIRPLVKKTLMSCRRALKDADVEADEVLEVVMVGGSTRTLLVREMV
HSCA_VIBCH      SLTRE-----ELENLIAPLLKKTLLSCRRALKDAGVEADEVLEVVMVGGSTRTPFVREQV
HSCA_ECOLI      EISRE-----QFNELIAPLVKRTLLACRRALKDAGVEADEVLEVVMVGGSTRVPLVRERV
HSCA_SHIFL      EISRE-----QFNELIAPLVKRTLLACRRALKDAGVEADEVLEVVMVGGSTRVPLVRERV
HSCA_ECOL6      EISRE-----QFNELIAPLVKRTLLACRRALKDAGVEADEVLEVVVVGGSTRVPLVRERV
HSCA_SALTI      EITRE-----QFNDLISALVKRTLLACRRALKDAGVEPQDVLEVVMVGGSTRVPLVRERV
HSCA_SALTY      EITRE-----QFNDLISALVKRTLLACRRALKDAGVEPQDVLEVVMVGGSTRVPLVRERV
HSCA_SHEON      SVLKQVVTKAQFEGLIAALVKKTIASCRRTLRDAGVTADEVLETVMVGGSTRVPLVREQV
HSCA_PSEPK      ELTR-----NAFEAMIEPLVARSLKACRRAVRDSGVELEEVSAVVMVGGSTRVPRVREAV
HSCA_PSESM      TLTR-----DALNALIEPMIARSLKACRRAVRDTGIELEEVEAVVMVGGSTRVPRVREAV
HSCA_PSEAE      ELSR-----ATLDELIEPFVARSLKSCRRAVRDSGVDLEEIRSVVMVGGSTRVPRVRTAV
HSCA_AZOVI      ELSR-----ERFEALIEPLVARSLKACRRALRDAGIEPQEIAAVVMVGGSTRVPRVRRAA
HSCA_RALSO      ETVHLVLTAETFAELTANLVQKTLAPVRRALRDAGVAVDEIQGVVLVGGATRMPVIRRAV
HSCA_NEIMA      MPIDTSISRAEFHNLTQHLVMKTLEPVTQALKDAGVGKNEVKGVIMVGGSTRMLHVQQAV
HSCA_NEIMB      MAIDTSISRAEFHNLTQHLVMKTLEPVTQALKDAGVGKNEVKGVIMVGGSTRMLHVQQAV
HSCA_ACIAD      ELNRD-----TFESIIQIALDKTISVCKRVLRDAKLSLDEIEKVVLVGGSTRSYAVQNVV
HSCA_RICPR      QTLEQ---------LISPLVERTINITQECLEQSGNP--NIDGVILVGGTTRIPLIKDEL
HSCA_RICTY      QTLEQ---------LIFPLVKHTINITQECLEQSGNP--NIDGVILVGGTTRIPLIKDEL
HSCA_RICCN      QILEQ---------LILPLVERTINIAQECLEQAGNP--NIDGVILVGGATRIPLIKDEL
                              :    : :::      :.:      .:  .::***:**   :    

HSCA_BUCAI      SKFFKKDLLKSINPDQVVAIGAAMHVDMLFSSKNNTKNKVILLDVMPLSLGIEVMGGFVE
HSCA_BUCAP      KKFFRKSPLISINPDQVVAIGAAIQSDMLM--KNTIQKRTILLDVTPLSLGIEVMGGFVE
HSCA_HAEIN      GEFFGKTPLTSIDPDKVVALGAAIQADILVG-NKT-DSDMLLLDVVPLSLGIETMGGLVE
HSCA_PASMU      AAFFQKEPLTSIDPDKVVALGAGIQADILVG-NKP-DADMLLLDVIPLSLGIETMGGLVE
HSCA_VIBPA      GEFFGRTPLTSINPDEVVAIGAGIQADILAG-NKP-DSEMLLLDVIPLSLGIETMGGLVE
HSCA_VIBVU      GEFFGRTPLTNINPDEVVAIGAGIQADILAG-NKP-DSEMLLLDVIPLSLGIETMGGLVE
HSCA_VIBCH      GEFFGRTPLTSINPDEVVAIGAAIQADILAG-NKP-DAEMLLLDVIPLSLGIETMGGLVE
HSCA_ECOLI      GEFFGRPPLTSIDPDKVVAIGAAIQADILVG-NKP-DSEMLLLDVIPLSLGLETMGGLVE
HSCA_SHIFL      GEFFGRPPLTSIDPDKVVAIGAAIQADILVG-NKP-DSEMLLLDVIPLSLGLETMGGLVE
HSCA_ECOL6      GEFFGRPPLTSIDPDKVVAIGAAIQADILVG-NKP-DSEMLLLDVIPLSLGLETMGGLVE
HSCA_SALTI      GEFFGRTPLTAIDPDKVIAIGAAIQADILVG-NKP-DSEMLLLDVIPLSLGLETMGGLVE
HSCA_SALTY      GEFFGRTPLTAIDPDKVVAIGAAIQADILVG-NKP-DSEMLLLDVIPLSLGLETMGGLVE
HSCA_SHEON      EAFFGKAPLTSIDPDRVVAIGAAIQADILVG-NKP-ESELLLLDVIPLSLGIETMGGLVE
HSCA_PSEPK      GALFGRTPLTSIDPDQVVAIGAAIQADTLAG-NRREGGELLLLDVIPLSLGLETMGGLME
HSCA_PSESM      AELFGRQPLTQIDPDQVVAIGAAIQADTLAG-NKRDGGELLLLDVIPLSLGLETMGGLME
HSCA_PSEAE      GELFGCEPLTDIDPDQVVAIGAAIQADALAG-NKR-GEELLLLDVIPLSLGLETMGGLME
HSCA_AZOVI      AELFDRQPLTDIDPDQVVAIGAALQADTLAG-NGRDGEELLLLDVNPLSLGLETMGRLME
HSCA_RALSO      AQLFGRAPLTNLDPDQVVAIGAAMQASLLAG-NRAAGDDWLLLDVIPLSLGVETMGGLVE
HSCA_NEIMA      ATFFGQTPLNNLNPDEVVALGAAIQANVLAG-NKT-DGEWLLLDVTPLSLGLETYGGLAE
HSCA_NEIMB      ATFFGQTPLNNLNPDEVVALGAAIQANVLAG-NKT-DGEWLLLDVTPLSLGLETYGGLAE
HSCA_ACIAD      RQVFNQEPLCTINPDEVVAIGASITANQLIG-NSQ--DGSLLLDVTPLSLGLETMGGLVE
HSCA_RICPR      YKAFKIDILSDIDPDKAVVCGAALQAENLIT----QHTNSLLIDVVPLSLGIELYGGIVE
HSCA_RICTY      YKAFKINILSDIDPDKAVVCGAALQAENLIA----PHTNSLLIDVVPLSLGIELYGGIVE
HSCA_RICCN      YKAFKIDILSDIDPDKAVVWGAALQAENLIA----PHTNSLLIDVAPLSLGMELYGGIVE
                   *    *  ::**..:. **.:  . *           :*:** *****:*  * : *

HSCA_BUCAI      KIIFRNTSLPISKTKEFTTYKDNQTSILIHIVQGERELVKDCISLSRFVLRDIKPQKAGL
HSCA_BUCAP      KIIFRNTPIPISKTKEFTTAKDNQTIIVIHILQGERELVKDCISLSRFILKDIPSKKAGV
HSCA_HAEIN      KIIPRNTTIPVARAQEFTTFKDGQTAMTVHVLQGERELVDDCRSLGRFTLRGIPPMAAGA
HSCA_PASMU      KIIPRNTTIPVARAQEFTTFKDGQTAMSVHVVQGEREMVADCRSLARFSLRGIPAMAAGA
HSCA_VIBPA      KIIPRNTTIPVARAQEFTTFKDGQTAMSVHVVQGEREMVDDCRSLARFSLKGIPPMAAGA
HSCA_VIBVU      KIIPRNTTIPVARAQEFTTFKDGQTAMSVHIVQGEREMVDDCRSLARFSLKGIPPMAAGA
HSCA_VIBCH      KIIPRNTTIPVARAQEFTTFKDGQTAMSVHVVQGEREMVDDCRSLARFSLKGIPPMAAGA
HSCA_ECOLI      KVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELVQDCRSLARFALRGIPALPAGG
HSCA_SHIFL      KVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELVQDCRSLARFALRGIPALPAGG
HSCA_ECOL6      KVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELVQDCRSLARFALRGIPALPAGG
HSCA_SALTI      KVIPRNTTIPVARAQDFTTFKDSQTAMSIHVMQGERELVQDCRSLARFALRGIPPLPAGG
HSCA_SALTY      KVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELVQDCRSLARFALRGIPPLPAGG
HSCA_SHEON      KVVSRNTTIPVARAQEFTTFKDGQTAMAFHVVQGERELVDDCRSLARFTLKGIPPLAAGA
HSCA_PSEPK      KVIPRNTTIPVARAQEFTTYKDGQSAMMIHVLQGERELISDCRSLARFELRGIPAMVAGA
HSCA_PSESM      KVIPRNTTIPVARGQEFTTYKDGQTAMKIHVLQGERELVSDCRSLARFELRGIPPMVAGA
HSCA_PSEAE      KVIPRNTTIPVARAQEFTTYKDGQTAMMIHVLQGERELVKDCRSLARFELRGIPPMVAGA
HSCA_AZOVI      KVIPRNTTLPVARAQEFTTYKDGQTAMLIHVLQGERELVKDCRSLARFELRGIPPMVAGA
HSCA_RALSO      KIIPRNSTIPVARAQEFTTFKDGQTAMAIHVLQGERELAGDCRSLARFELRGIPPMVAGA
HSCA_NEIMA      KIIPRNSTIPTARAQDFTTFKDGQTAMTIHVVQGERELVSDCRSLAKFTLRGIPPMAAGA
HSCA_NEIMB      KIIPRNSTIPTARAQDFTTFKDGQTAMTIHVVQGERELVADCRSLAKFTLRGIPPMAAGA
HSCA_ACIAD      RLISRNTAIPVARRQEFTTYQDGQSAMLIHVVQGERDLVEHCRSLGRFVLHGIPPMTAGQ
HSCA_RICPR      KIITRNTPIPIAVIKEFTTYADNQTGIQFHILQGEREMAADCRSLARFELKGLPPMKAGN
HSCA_RICTY      KIIMRNTPIPIAVIKEFTTYADNQTGIQFHILQGEREMAADCRSLARFELKGLPPMKAGN
HSCA_RICCN      KIIMHNTPIPISVVKEFTTYVDNQTGIQFHILQGEREMAADCRSLARFELKGLPPMKAGY
                ::: :*:.:* :  ::***  *.*: : .*::****::  .* **.:* *:.: .  ** 

HSCA_BUCAI      VRILVTFQVDTDGLIHVKILENYSSKEKKIIIDNNITLKNLNISQILKDSLKHSKDDYYF
HSCA_BUCAP      VRILVTFEIDTDGLISVKILEKFSHKEKKIQIENVTFLQNKNIHKIIKESTINAKEDYYL
HSCA_HAEIN      AHIRVTYQVDADGLLSVTAMEKSTKVQASIQIKPSYGLTDEEVTAMIKSSFDNAQEDLQA
HSCA_PASMU      AHVRVTYQVDADGLLSVTAMEKSTGVQSSIQVKPSYGLSDDEITNMLKASMLNAKEDIQA
HSCA_VIBPA      AHIRVTYQVDADGLLSVTAMEKSTGVQSEIQVKPSYGLSDNEVANMLRDSMTHAKEDMQA
HSCA_VIBVU      AHIRVTYQVDADGLLSVTAMEKSTGVQSEIQVKPSYGLSDDEVANMLRDSMTYAKEDMQA
HSCA_VIBCH      AHIRVTYQVDADGLLSVTALEKSTGVQAEIQVKPSYGLSDDEVTQMLKDSMAYAKEDMLA
HSCA_ECOLI      AHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDSEIASMIKDSMSYAEQDVKA
HSCA_SHIFL      AHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDSEIASMIKDSMSYAEQDVKA
HSCA_ECOL6      AHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDSEIASMIKDSMSYAEQDVKA
HSCA_SALTI      AHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDGEIASMIKDSMSFAEQDVKA
HSCA_SALTY      AHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDGEIASMIKDSMSFAEQDVKA
HSCA_SHEON      AHIRVTFQVDADGLLSVTAMEKSTGVQSSIQVKPSFGLSDSEIATMLKDSMKHAKEDIGR
HSCA_PSEPK      AKIRVTFQVDADGLLSVAARELGSGVEASIQVKPSYGLTDGEIARMLKDSFEHAGSDKHA
HSCA_PSESM      AKIRVTFQVDADGLLSVSAREMGSGIESSIQVKPSYGLTDDEVTRMLKDSFEYAGDDKVA
HSCA_PSEAE      AKIRVTFQVDADGLLGVSARELSSGVEASIQVKPSYGLTDGEIARMLKDSFDYAGDDKAA
HSCA_AZOVI      AKIRVTFQVDADGLLNVSARELGSGYEASVQVKPSYGLTDGEIARMLKDSFEYAGGDKAA
HSCA_RALSO      ARIRVTYQVDADGLLSVSARETVSGVEASIAVKPSYGLGDDDIARMLQEGFQSAEEDMRR
HSCA_NEIMA      ARIRVTFQIDADGLLSVSAQEQSTGVQAQIEVKPSYGLDDGAITRMLKDSMDNAAEDMAA
HSCA_NEIMB      ARIRVTFQIDADGLLSVSAQEQSTGVQAQIEVKPSYGLDDDTITQMLKDSMSNAAEDMAA
HSCA_ACIAD      ARIEVTFQVDADGLLTVSAQETTSGVKAQIDIKPSYGLSATDTERLLLEGFQHAEEDKNL
HSCA_RICPR      IRVEVTFAIDADGILSVSAYEKISNISHNIEIKPNHGINKTEIETMLKNAYKNAKIDYTT
HSCA_RICTY      IRAEVTFAIDADGILSISAYEKISNISHTIEVKPNHGIDKTEIEIMLENAYKNASIDYTT
HSCA_RICCN      IRAEVTFSIDADGILSVSAYEKISNTSHAIEVKPNHGIDKTEIDIMLENAYKNAKIDYTT
                 :  **: :*:**:: :   *  :  .  : :.    :       ::  .   :  *   

HSCA_BUCAI      RVKEEKKIECVRTLEILNKSLKKH-LKLISKKELKKIKYTQEKLQKSIQEDDYFSMKNNL
HSCA_BUCAP      RVRKEKKIESKYILDLLNNALQED-RNLITSEELKKIKSHQIKLQKSIDEDDFFSMKLNL
HSCA_HAEIN      RELAEQRVEADRVIESVIVALQADGAELLSTDEFHHIETVLKQLMDVKQGSDRDAIAQGI
HSCA_PASMU      RLLAEQRVEAQRVLESVGSALSAD-QDLLNDEELSAVKNAIISLQRLQKEGDTQEIKQGI
HSCA_VIBPA      RALAEQRVEADRVIEGLIAAMQADGDELLSEQEKQDLLKAIEALIELRNGDDANAIEQGI
HSCA_VIBVU      RALAEQRVEADRVIEGLIAAMQADGDELLSEAEKATLLQAIESLIELRNGNEANAIEQGI
HSCA_VIBCH      RALAEQRVEADRVIEGLVSALQADGDELLNEQERQTLLQAIERLIELRNGDNADAIEQGI
HSCA_ECOLI      RMLAEQKVEAARVLESLHGALAAD-AALLSAAERQVIDDAAAHLSEVAQGDDVDAIEQAI
HSCA_SHIFL      RMLAEQKVEAARVLESLHGALAAD-AALLSAAERQVIDNAAAHLSEVAQGDDVDAIEQAI
HSCA_ECOL6      RMLAEQKVEAARVLESLHGALAAD-AALLSAAERQAIDDAAAHLSEVAQGDDVDAIEQAI
HSCA_SALTI      RMLAEQKVEAARVLESLTGALTAD-AALLSAAERQCIDDAAAHLSAVAQGDDVDAIEQAI
HSCA_SALTY      RMLAEQKVEAARVLESLTGALTAD-AALLSAAERQCIDDAAAHLSAVAQGDDVDAIEQAI
HSCA_SHEON      RMLAEQQVEAARVLESLNAALSKD-GDLLTSDERQQIDTVMAELVQVAGSDDADTIKKAI
HSCA_PSEPK      RQLREHQVDGERLLEAVQGALDADGDRLLSSDERDAIEFQMQELRDLLAGTDGAAIEQQT
HSCA_PSESM      RVLREHQVDAERLLEAVQGALDADGERLLDEEERLVINLQMDELRELMQGTDGYAIEQQT
HSCA_PSEAE      RALREQQVEAQRLLEAVQSALDVDGERLLDEEERLAIAAQMDTLRELAGGSDTAAIENQI
HSCA_AZOVI      RALREQQVEAQRLLEAVQAALEADGEALLSPAERAAIEAQMQALRGVLDGPDAAVIETHV
HSCA_RALSO      RALAEERVEGERLLEALSHALDADGD-LLSADERAAVDAQVAALRVTLQGEDHRAIKDAV
HSCA_NEIMA      RARAEAVVEAESLTDAVNAALELD-SDLLDAKELQQIRQGIADLQGRLKDGKAEDIRSAV
HSCA_NEIMB      RARAEAVVEAESLTDAVNAALELD-SDLLDAEELQQIRQGIADLQGRLKDGKAEDIRAAA
HSCA_ACIAD      RHLQETKVEAQRELEALEQALKND-AGLLDIQQLQALHTAKDQLQQQLQSNDIDQIERAV
HSCA_RICPR      RLLQEAVIETEALMSSIERSIIKL-TKLLSESEISIINALLDNIKDAVQTRDQILIKNSI
HSCA_RICTY      RLLQEEIIETEALISNIERSIIEL-TTLLSESEISIINALFDNIKYAVQTRDQTLIKHSI
HSCA_RICCN      RLLQEAVIEAEALIFSIERAIAEL-TILSSESEISIINSLLDNIKEAVHARDWILINNSI
                *   *  ::       :  ::      *    :   :      :       .   :    

HSCA_BUCAI      QKLDEVSKNFFSLQLKNAIDCSSIKNILKENI----
HSCA_BUCAP      KKLEEVSKNFLSLRLKKNMDSFSIKNLSDEIT----
HSCA_HAEIN      KALDTATQEFAARRMNASINKALTGKNLSDIENP--
HSCA_PASMU      KQLDLATQEFASRRMDKSIRQALAGKAIDDVMKNAK
HSCA_VIBPA      KDTDKASQDFASRRMDKSIRAALSGQSVDDI-----
HSCA_VIBVU      KDTDKASQDFASRRMDKSIRAALAGQSIDTI-----
HSCA_VIBCH      KDTDKASQDFASRRMDKSIRSALAGHSVDEI-----
HSCA_ECOLI      KNVDKQTQDFAARRMDQSVRRALKGHSVDEV-----
HSCA_SHIFL      KNVDKQTQDFAARRMDQSVRRALKGHSVDEV-----
HSCA_ECOL6      KNVDKQTQDFAARRMDQSVRRALKGHSVDEV-----
HSCA_SALTI      KNVDKQTQEFAARRMDQSVRRALKGHSVDEV-----
HSCA_SALTY      KNVDKQTQEFAARRMDQSVRRALKGHSVDEV-----
HSCA_SHEON      EILDEHTQDFAAKRMDNSIRVAFKGQSIDKI-----
HSCA_PSEPK      KRLSQVTDAFAARRLDSTVKAALAGRNLNEIEE---
HSCA_PSESM      KRLSQVTDAFAARRLDSTVKAALAGRNLNEIEE---
HSCA_PSEAE      KRLSQVTDAFAARRMDATVKAALSGRRLNEIEE---
HSCA_AZOVI      RHLTQVTDAFAARRLDASVKAALSGRRLNEIEE---
HSCA_RALSO      DALSHGTDEFAARRMDRGIRAALAGKRIEELG----
HSCA_NEIMA      AKLSRSTDNFAAKRMNRNIQRALTGQSVDNI-----
HSCA_NEIMB      AKLGSITDNFAAKRMNRNIQRALTGQSVDNI-----
HSCA_ACIAD      AQLKIHSDEFAALRMNQHIDHALKGTKLEDWSDSQK
HSCA_RICPR      KEFKSKIKK--YLDTKLNINDLRKCKNSNQIK----
HSCA_RICTY      KEFKSKIKNI-WIQNIININDLRK------------
HSCA_RICCN      KEFKSKIKKSIDTKFNIIINDLLKGKNINQIK----
                       .          :