CLUSTAL format seed alignment for MF_00682

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HSCB_BUCAI      ------MNYFTLFDLPRKFNIDKKLLSQNFYKLQLKFHPDLFINDSESKKKIILEKSIQI
HSCB_BUCAP      ------MDYFALFNLPKKYIIDKFLLSKNFYKLQLKFHPDLFIHHSESKKRIVLQKSIEI
HSCB_BUCBP      ------MNYFKLFNLPQKFELDVNNLTSQYYNLQKKFHPDSYQ-DKNIYTKKYLEKSMLL
HSCB_PASMU      ------MNPFNIFDLPVDFHVDQATLSARYLALQKSLHPDNFTTHSAQEQRLAMQRSAEV
HSCB_MANSM      -----MNNPFALFDLPIEFQLDQNRLSERYLALQKALHPDNFANSSAQEQRLAMQKSAEV
HSCB_HAEIN      -----MFNPFQIFDLPVDFQLDEKVLNARYLKLQKALHPDNFVSSNALDQRVAMQKSTEV
HSCB_HAEDU      -----MRNPFSLFNLPVQFQIDNAQLSERYLALQKQFHPDNFANESADKQLAALQQSADV
HSCB_VIBC3      ------MNYFELFGLPIQFELDGSLLSSQFRALQKRFHPDNFATASERDRLMAVQQAAQI
HSCB_VIBCH      ------MNYFELFGLPIQFELDGSLLSSQFRALQKRFHPDNFATASERDRLMAVQQAAQI
HSCB_VIBVY      ------MNHFELFGLPPQFSLDGSLLSSQFRELQKRFHPDNFATASERDRLLAVQKAAQI
HSCB_VIBVU      ------MNHFELFGLPPQFSLDGSLLSSQFRELQKRFHPDNFATASERDRLLAVQKAAQI
HSCB_VIBCB      ------MNHFELFGLPSQFQLDGSLLSSQFRELQKRFHPDNFATASERDRLMAVQKAAQI
HSCB_VIBPA      ------MNHFELFGLPSQFQLDGSLLSSKFRELQKRFHPDNFATASERDRLMSVQKAAQI
HSCB_PHOPR      ------MNHFELFRLPFQFELDGGLLSTQFRELQRRFHPDNFATASERDRLMSVQKAAQI
HSCB_ALIF1      ------MNHFELFGLPNQFELDGGLLSLQFRELQKRFHPDNFATSSERDRLLSIQKAAQI
HSCB_AERHH      ------MNYFELFGLVEGFELDTRQLAETYRQLQTQFHPDRFATAPEWEQLAAVQRAAQI
HSCB_AERS4      ------MNHFELFGLVEGFELDTRKLADTYRQLQTQFHPDRFATAPEREQLVAVQRAAQI
HSCB_SHESM      ------MNYFELFKFSPAFDIDTAVLAERYRELQRAVHPDKFANDTEQQRLLSVQRTAQV
HSCB_SHESR      ------MNYFELFKFSPAFDIDTAVLAERYRELQRAVHPDKFANDTEQQRLLSVQRTAQV
HSCB_SHESA      ------MNYFELFKFSPAFDIDTAVLAERYRELQRAVHPDKFANDTEQQRLLSVQRTAQV
HSCB_SHEON      ------MNYFELFKFPPTFDIDTAVLADRYRELQRAVHPDKFANDTEQQRLLSVQRTAQV
HSCB_SHEB8      ------MNYFELFKFSPAFDIDTALLAERYRELQRAVHPDKFANDTEQQKLLSVQRTAQV
HSCB_SHEB5      ------MNYFELFKFSPAFDIDTALLAERYRELQRAVHPDKFANDTEQQKLLSVQRTAQV
HSCB_SHEB9      ------MNYFELFKFPPAFDIDTALLAERYRELQRAVHPDKFANDTEQQKLLSVQRTAQV
HSCB_SHESW      ------MNYFELFKFSPAFDIDTAVLAERYRELQRAVHPDKFAHDTEQQKLLSVQRTAQV
HSCB_SHEPC      ------MNYFELFKFSPAFDIDTAVLAERYRELQRAVHPDKFAHDTEQQKLLSVQRTAQV
HSCB_SHEFN      ------MNYFDLFNVVPAFDIDTALLAERYRELQRAVHPDKFANDTEQQKLLSVQRTAQV
HSCB_SHEDO      ------MNYFNLFNFTPSFDIDTGLLAERYRELQKAVHPDKFANDSEQQKLLAVQRTAQV
HSCB_SHEHH      ------MNYFELFSLLPSYDVDTALLAERYRELQRAVHPDKFANASEQDKRLSVQRTAQI
HSCB_SHEPA      ------MNYFELFSLLPSYDVDTALLADRYRELQRAVHPDKFANASEQDKRLSVQRTAQI
HSCB_SHELP      ------MNYFELFSLSPSFELDTAVLSERYRELQRAVHPDKFANASEQDKRLAVQHTAQV
HSCB_SHEAM      ------MNYFELFNLPVAFDVNTSELADKYRELQRTVHPDKFAAASEQEKLLAVSRTAMV
HSCB_PSEA6      ------MNYFALFNLTPSFDVDKAALAATYQQLQKLTHPDRFATASERDKLIALQKNAQV
HSCB_COLP3      ------MNYFQLFNIEVSFDVDLQQLSSSYQTLQKTVHPDKFAHASEQEQRIAVQKSAQI
HSCB_XENNA      ------MDYFTLFGLPARYALDRELLATRYQELQRQFHPDRFANQPEREKTLALQQATTI
HSCB_PHOLL      ------MDYFTLFGLPARYTVDREQLASCYQELQRQFHPDRFASQPEREKTLALQQAVTI
HSCB_YERPE      ------MDYFTLFGLPARYLIDGNQLTTRYQELQRQFHPDRFATQPERERLASMQQAATI
HSCB_YERPP      ------MDYFTLFGLPARYLIDGNQLTTRYQELQRQFHPDRFATQPERERLASMQQAATI
HSCB_YERPN      ------MDYFTLFGLPARYLIDGNQLTTRYQELQRQFHPDRFATQPERERLASMQQAATI
HSCB_YERPA      ------MDYFTLFGLPARYLIDGNQLTTRYQELQRQFHPDRFATQPERERLASMQQAATI
HSCB_YERP3      ------MDYFTLFGLPARYLIDGNQLTTRYQELQRQFHPDRFATQPERERLASMQQAATI
HSCB_YERPS      ------MDYFTLFGLPARYLIDGNQLTTRYQELQRQFHPDRFATQPERERLASMQQAATI
HSCB_YERE8      ------MDYFTLFGLPPQYLIDGSRLTTRYQELQRQFHPDRFANQPERERLASLQQAATI
HSCB_SERP5      ------MDYFTLFGLPVRYPVDGSLLASRYQDLQRQFHPDRFASQPERERLMALQQAATI
HSCB_PECAS      ------MDYFTLFGLPIRYDVDGGLLASRFQDLQRQFHPDRYATSPECERMLAVQLAATI
HSCB_ECOLI      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECOUT      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECO57      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECOLC      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECOL6      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECOHS      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECOK1      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_SHIBS      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECOL5      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_SHIDS      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_ECO24      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_SHISS      ------MDYFTFFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATI
HSCB_SHIF8      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSLAEQLAAVQQSATI
HSCB_SHIFL      ------MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSLAEQLAAVQQSATI
HSCB_CITK8      ------MDYFTLFGLPAHYQLDTQALSLRFQDLQRQYHPDKFASGTQAEQLAAVQHSATI
HSCB_SALPB      ------MDYFTLFGLPARYQIDTQALSLRFQDLQRQYHPDKFANGTQAQQLAAVQQSATI
HSCB_SALCH      ------MDYFTLFGLPARYQIDTQALSLRFQDLQRQYHPDKFANGTQAQQLAAVQQSATI
HSCB_SALTY      ------MDYFTLFGLPARYQIDTQALSLRFQDLQRQYHPDKFANGTQAQQLAAVQQSATI
HSCB_SALPA      ------MDYFTLFGLPARYQIDTQALSFRFQDLQRQYHPDKFANGTQAQQLAAVQQSATI
HSCB_SALTI      ------MDYFTLFGLPARYQIDTQALSFRFQDLQRQYHPDKFANGTQAQQLAAVQQSATI
HSCB_SALAR      ------MDYFTLFGLPASYHIDTQALSLRFQDLQRQYHPDKFANGTQAQHLAAVQQSATI
HSCB_ENT38      ------MDYFTLFGLPAQYSIDLPALTIRFQDLQRQFHPDKFASGTPAEQLAAVSQSATI
HSCB_KLEP7      ------MDYFTLFGLPASYTLSLEQLAVRYQDLQRQYHPDKFASAPAAEQLAAVQHSATI
HSCB_PARXL      -MASLNDSHFDLFDLPAQFALDASALDHAYRTVQAQVHPDRFAAAGDAQKRIAMQWATRT
HSCB_BURVG      -MVSLKDSHFDLFHLPAQFALDDAALDDAYRTVQTQVHPDRFAAAGDAQKRIAMQWATRA
HSCB_BURP0      -MVSLKDSHFDLFHLPARFALDEPTLDAAYRAVQSQVHPDRFAAAGDAQKRIAMQWATRA
HSCB_BURP1      -MVSLKDSHFDLFHLPARFALDEPTLDAAYRAVQSQVHPDRFAAAGDAQKRIAMQWATRA
HSCB_BURMA      -MVSLKDSHFDLFHLPARFALDEPTLDAAYRAVQSQVHPDRFAAAGDAQKRIAMQWATRA
HSCB_BURMS      -MVSLKDSHFDLFHLPARFALDEPTLDAAYRAVQSQVHPDRFAAAGDAQKRIAMQWATRA
HSCB_BURP6      -MVSLKDSHFDLFHLPARFALDEPTLDAAYRAVQSQVHPDRFAAAGDAQKRIAMQWATRA
HSCB_BURPS      -MVSLKDSHFDLFHLPARFALDEPTLDAAYRAVQSQVHPDRFAAAGDAQKRIAMQWATRA
HSCB_BURTA      -MVSLKDSHFELFHLPAQFALDEPTLDAAYRAVQSQVHPDRFAAAGDAQKRVAMQWATRA
HSCB_RALSO      -MNSASDTHFSLFGLPEHFEVDDGALNAAYRTVQSRAHPDRHAHASDAERRVAMQWATRA
HSCB_BORPE      ---MAADDHFSLFGLPTRFALDPVQLEQAWRAVAARVHPDRYATASAAERRVAMQWAARA
HSCB_BORBR      ---MAADDHFSLFGLPTRFALDPVQLEQAWRAVAARVHPDRYATASAAERRVAMQWAARA
HSCB_BORPA      ---MAADDHFSLFGLPARFALDPVQLEQAWRAVAARVHPDRYATASAAERRVAMQWAARA
HSCB_BORA1      ---MAADDYFSLFGLPSKFAIDAQALEEAWRLVAARVHPDRYATASAAERRVAMQWAARA
HSCB_AROAE      MSIDLQQDFFALFGLPRRFRVDEAALEMAYHDLQGQVHPDRFAHLPDVEKRLSMQWATRV
HSCB_CHRVO      MNHDFNQDFFSLFGLPRRFAIDAAGLDAAWRAAAAQVHPDRYAASSDADKRSALMLATRV
HSCB_METCA      MSEMAPRNYFEFFQLPEMFRLDQSVLDSHYLELQARVHPDKAAHLSDVEKRLSLQWATFA
HSCB_NEIMF      -----MSQYFTLFRIEPAFDIDTENLEQTYRALAARFHPDKFASASAFEQKQAVMMSSTI
HSCB_NEIMB      -----MSQYFTLFRIEPAFDIDTENLEQTYRALAARFHPDKFASASAFEQKQAVMMSSTI
HSCB_NEIM0      -----MSQYFTLFRIEPAFDIDTENLEQTYRALAARFHPDKFASASAFEQKQAVMMSSTI
HSCB_NEIMA      -----MSQYFTLFRIEPAFDIDTENLEQTYRALAARFHPDKFASASAFEQKQAVMMSSTI
HSCB_PSEAE      ---MGKPCHFAQFDLQPAFLVDLDELGQRYRELVRSVHPDRFADAPEREQRLALERAAQL
HSCB_PSEA7      ---MGKPCHFAQFDLQPTFLVDLDELGRRYRELVRSVHPDRFADAPEREQRLALERAAQL
HSCB_PSEAB      ---MGKPCHFAQFDLQPAFLVDLDELGQRYRELVRSVHPDRFADAPEREQRLALERAAQL
HSCB_PSESM      ---MGSPCHFALFELKPEFQLDLDQLATRYRELARNVHPDRFADAPEREQRLALERSASL
HSCB_PSEPF      ---MGIPCHFALFELQPGFRLDLEQLATRYRELARGVHPDRFADASEREQRSALEQSARL
HSCB_PSEMY      ---MGNPCHFALFDLQPSFRLDLEQLAARYRELARQVHPDRFADAGEREQRLALERSACL
HSCB_PSEPK      ---MGTPCHYALFDLQPSFRLDLDKLATRYRELAREVHPDRFADASEREQRIALEKSAAL
HSCB_PSEP1      ---MGTPCHYALFDLQPSFRLDLDKLATRYRELAREVHPDRFADASEREQRVALEKSAAL
HSCB_PSEPG      ---MGTPCHYALFDLQPSFRLDLDKLATRYRELAREVHPDRFADASEREQRIALEKSAAL
HSCB_PSEE4      ---MGTPCHYALFDLQPAFRLDLDKLAVRYRELAREVHPDRFADASEREQRVALEKSAAL
HSCB_PSEU5      ---MGTPCHFALFDLKPDFELDLAQLADRYRELARQVHPDRFADAGESEQRQALERSANL
HSCB_AZOVI      -----MTSHFALFDLEPDFRLDQDRLAVRYRELVRRVHPDRFAGAPEREQRLALEEAARL
HSCB_PSYIN      ------MNYFDLFSLPVIFPIDQTRLSETYRELQKQYHPDKFVMQNDSERLRAMQKSTEI
HSCB_RICRS      -----MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQ--NLITAAEL
HSCB_RICRO      -----MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQ--NLITAAEL
HSCB_RICCN      -----MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQ--NLITAAEL
HSCB_RICM5      -----MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQ--NLITAAEL
HSCB_RICFE      -----MQNYFQLLGLPQDYNIDLKILEKQYFAMQVKYHPDKAKTLQEKEQ--NLITAAEL
HSCB_RICAH      -----MQNYFQLLGLPQDYDIDLKILEKQYFAMQVKYHPDKAKTLQEKEH--NLITAAEL
HSCB_RICPR      -----MQNYFQLLELPQEYNIDLKILEKQYFAMQVKYHPDTAKTAQEKAQ--NLITSTEL
HSCB_RICTY      -----MQNYFQLLELPQEYNIDLKILEKQYFAMQIKYHPDKAKTVQEKEQ--NLIIATEL
HSCB_RICBR      -----MQNYFELLGLEQIYNIDLKILEKQYFAMQIKYHPDKAKNLQEKEQ--NLIIASNL
                         :  : .   : :.   *   :       ***             :      

HSCB_BUCAI      NKGYKTLKNFLNRAIYFLCL-NGYEVKKETLLLKNNDFLIRYFSLYEQLDNLKENNFNKK
HSCB_BUCAP      NKGYKILQDSLNRAIHLLFL-NGFKISKEKVLSEDNSFLKKYFFLYEELDFLLKNNCDEV
HSCB_BUCBP      NQGYQTLKNMLTRAEHLLFL-NNYKVDKKKKIVFNAKFLEMQIELFERLEIHK-NKNNKH
HSCB_PASMU      NDALQILKDPILRAETIIAIYTGEQQNIEENSTRDMAFLMQQMQWREQLENIEAQQDS-D
HSCB_MANSM      NDALQILKDPILRADCIIALNTGEQQNTEEKSTQDMAFLMQQMQWREQLEEIENTQDI-D
HSCB_HAEIN      NDALKTLKDPILRAEAIIALNTGEQLDLEQKSTQDVAFLMQQLQWREQLEEVERQQDE-R
HSCB_HAEDU      NEALQILKDPIARATAIIEINTGIVKNLEENSRQDLDFLMQHMEWHEKLDSIENSRSE-Q
HSCB_VIBC3      NDAYQTLKDPLRRAEYLLSL-QGIEMNAEQQTLQDPMFLMEQMELREELESVTACADPEA
HSCB_VIBCH      NDAYQTLKDPLRRAEYLLSL-QGIEMNAEQQTLQDPMFLMEQMELREELESVTACADPEA
HSCB_VIBVY      NDAYQVLKNPISRAEYLLSQ-NGLEIRGEQQTMQDPMFLMEQMELREELEEIPHGSDAES
HSCB_VIBVU      NDAYQVLKNPISRAEYLLSQ-NGLEIRGEQQTMQDPMFLMEQMELREELEEIPHGSDAES
HSCB_VIBCB      NDAYQVLKHPISRAEYILAE-NGTEIRGEQQTMQDPMFLMEQMELREELEDIADSSDPES
HSCB_VIBPA      NDAYQVLKHPISRAEYILAE-QGMEIRGEQQTMQDPMFLMEQMELREELEDIADCSDPES
HSCB_PHOPR      NDAFQTLKNPISRAEYMLSE-QDMDIRGEQKTLQDPEFLMQQMELREELEDISDASDPES
HSCB_ALIF1      NDAYQTLKNPVSRAEYILSE-QGHDIRGEQTTMQDPMFLMQQMELREELESLPSSSDPES
HSCB_AERHH      NDAFTTLKAPLRRAEYLLSL-RGTELRGEQQTLQDTAFLMQQLEWRERLADLKGETDPER
HSCB_AERS4      NDAYTTLKTPLRRAEYLLSL-RGTDIRGEQQTLQDTSFLMQQLEWRERLADLKGEADPEG
HSCB_SHESM      NDGYQTLKDPIRRAEHMLSL-RGIDLSHETTTVKDTAFLMQQMEWREALEDIRDSADPQE
HSCB_SHESR      NDGYQTLKDPIRRAEHMLSL-RGIDLSHETTTVKDTAFLMQQMEWREALEDIRDSADPQE
HSCB_SHESA      NDGYQTLKDPIRRAEHMLSL-RGIDLSHETTTVKDTAFLMQQMEWREALEDIRDSADPQE
HSCB_SHEON      NDGYQTLKDPIRRAEHMLSL-RGIDLSHETTTVKDTAFLMQQMEWREALEDIRESIDHQA
HSCB_SHEB8      NDGFQTLKDPIRRAEHMLSL-RGIELSHETTTVKDTGFLMQQMEWREALEDIRDSADPQA
HSCB_SHEB5      NDGFQTLKDPIRRAEHMLSL-RGIELSHETTTVKDTGFLMQQMEWREALEDIRDSADPQA
HSCB_SHEB9      NDGFQTLKDPIRRAEHMLSL-RGIELSHETTTVKDTGFLMQQMEWREALEDIRDSADPQA
HSCB_SHESW      NDGYQTLKDPIRRAEHLLSL-RGIDLSHETTTVKDTVFLMQQMEWREALEDIRHSTDPQE
HSCB_SHEPC      NDGYQTLKDPIRRAEHLLSL-RGIDLSHETTTVKDTVFLMQQMEWREALEDIRHSTDPQE
HSCB_SHEFN      NDGYQTLKNPLRRAEHMLSL-RGIELSHETTTLKDGAFLMQQMEWREALEDIQHNSDPQS
HSCB_SHEDO      NDGYHTLKQPLRRAEHLLSL-GGVDLSHETTTIKDTVFLMQQMDWREALEDIKHSKQPQE
HSCB_SHEHH      NDAFQTLKNPIQRAEHLLTL-KGLELSHESTTLKDTQFLMQQMEWRESLEEIKHSDDPDS
HSCB_SHEPA      NDAFQTLKNPIQRAEHLLAL-KGLELSHESTTLKDTQFLMQQMDWRESLEEIKHSDDPDS
HSCB_SHELP      NDGYNTLKHPISRAEHMLSL-KGIDLSHESTTVKDTMFLMQQMEWREALEEISDCDDPDE
HSCB_SHEAM      NDGFQTLKDPIRRAEHMLAL-KGVDIRHETQTVRDTAFLMQQMEWREALEEITHADDPHC
HSCB_PSEA6      NDGYQVLKTPLSRAEHMLEL-RGVELQHEQKTMQDGAFLMQQMEWREQLDDAQHASDPLT
HSCB_COLP3      NDAYQTLKNPLQRAEYILVQ-RSVEMPNEQHSFQDTSFLMRQMELREMLEDVRHSGDVDA
HSCB_XENNA      NTGYQTLKHPLKRAEYMLSQ-QGFDLSNEQHTMQDTAFLMQQLELREELDAIEHSSDTEA
HSCB_PHOLL      NDGYQTLKHPLKRAEYMLSL-HGFDLANEQHTMNDNAFLMEQLMLREELECIADKANPEV
HSCB_YERPE      NDAYQTLKHPLKRAEYMLSL-QGFDLGNEQHTMRDTAFLMEQLELREELDAIERKPDAET
HSCB_YERPP      NDAYQTLKHPLKRAEYMLSL-QGFDLGNEQHTMRDTAFLMEQLELREELDAIERKPDAET
HSCB_YERPN      NDAYQTLKHPLKRAEYMLSL-QGFDLGNEQHTMRDTAFLMEQLELREELDAIERKPDAET
HSCB_YERPA      NDAYQTLKHPLKRAEYMLSL-QGFDLGNEQHTMRDTAFLMEQLELREELDAIERKPDAET
HSCB_YERP3      NDAYQTLKHPLKRAEYMLSL-QGFDLGNEQHTMRDTAFLMEQLELREELDAIERKPDAET
HSCB_YERPS      NDAYQTLKHPLKRAEYMLSL-QGFDLGNEQHTMRDTAFLMEQLELREELDAIERKPDAET
HSCB_YERE8      NDAYQTLKHPLKRAEYMLSL-QGFDLGNEQHTLRDTAFLMEQLELREELDAIERSPDAEI
HSCB_SERP5      NEAYQTLKHPLKRAEYMLSL-HGFDLGNEQHTMRDTAFLMEQLELREELDAIERKADAQT
HSCB_PECAS      NNAYQALKHPLKRAEYMLSL-HGFDVNNEQHTMRDTAFLMEQLELREELDTISQRSDADE
HSCB_ECOLI      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECOUT      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECO57      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECOLC      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECOL6      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECOHS      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECOK1      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_SHIBS      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECOL5      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_SHIDS      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_ECO24      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_SHISS      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_SHIF8      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_SHIFL      NQAWQTLRHPLMRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_CITK8      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIE-QAKDEA
HSCB_SALPB      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLTLREELDDIE-QSKDDV
HSCB_SALCH      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLTLCEELDDIE-QSKDDV
HSCB_SALTY      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLTLREELDDIE-QSKDDA
HSCB_SALPA      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLTLREELDDIE-QSKDDA
HSCB_SALTI      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLTLREELDDIE-QSKDDA
HSCB_SALAR      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLTLREELDDIE-QTKDDA
HSCB_ENT38      NQAWQTLRNPLARAEYLLSL-HGFDLTSEQHTVRDTAFLMEQLELREELDEID-QAKDEA
HSCB_KLEP7      NQAWQTLRHPLTRAEYLLSL-HGFDLASEQHTVRDTAFLMEQLELREELDEIG-QAKDDA
HSCB_PARXL      NEAYQTLRDPLKRATYLLHL-RGIDVGAENNTAMEPAFLMQQMEWRESIEDAAAAKNV-D
HSCB_BURVG      NEAYRTLRDPLQRASYLLSL-RGVDIGAENNTAMEPAFLMQQMEWREGIEDAAAARNV-D
HSCB_BURP0      NEAYQTLRDPLKRATYLLHL-RGVDVGAENNTAMEPAFLMQQMEWRERIEDAAGAKNV-D
HSCB_BURP1      NEAYQTLRDPLKRATYLLHL-RGVDVGAENNTAMEPAFLMQQMEWRERIEDAAGAKNV-D
HSCB_BURMA      NEAYQTLRDPLKRATYLLHL-RGVDVGAENNTAMEPAFLMQQMEWRERIEDAAGAKNV-D
HSCB_BURMS      NEAYQTLRDPLKRATYLLHL-RGVDVGAENNTAMEPAFLMQQMEWRERIEDAAGAKNV-D
HSCB_BURP6      NEAYQTLRDPLKRATYLLHL-RGVDVGAENNTAMEPAFLMQQMEWRERIEDAAGAKNV-D
HSCB_BURPS      NEAYQTLRDPLKRATYLLHL-RGVDVGAENNTAMEPAFLMQQMEWRERIEDAAGAKNV-D
HSCB_BURTA      NEAYQTLRDPLKRATYLLHL-RGVDVGAENNTAMEPAFLMQQMEWRERIEDAAAAKNV-G
HSCB_RALSO      NEAYQTLRDPLKRATYLLHL-RGVDVQAENNTAMPPAFLMQQLEWRESLADAKAAGDL-D
HSCB_BORPE      NEAYRQLRDPMLRARYLCEQ-AGVDLQTESNTAMDPAFLMQQMEWREMLDDAR--RDP-A
HSCB_BORBR      NEAYRQLRDPMLRARYLCEQ-AGVDLQTESNTAMDPAFLMQQMEWREMLDDAR--RDP-A
HSCB_BORPA      NEAYRQLRDPMLRARYLCEQ-AGVDLQTESNTAMDPAFLMQQMEWREMLDDAR--RDP-A
HSCB_BORA1      NEAYRLLRDPMLRARYLCES-AGIDLQTESNTAMAPAFLMQQMEWREMLDDAR--HDE-R
HSCB_AROAE      NEGFRTLRKPLPRAQYMLEL-AGVDAGLHTNTAMSSAFLMEQMEWREAVEEARAAGEG-H
HSCB_CHRVO      NEGYQTLKSPLNRARYLLQL-SGVDTQEENNTRMPADFLMAQMEWRESIDDARA--DV-D
HSCB_METCA      NEAYQTLKRPLERARYLLRI-HGVDTREEDNTAMPAEFLLEQIEWREEMQDAIAGRSE-A
HSCB_NEIMF      NDAYRTLKNPIDRAAYLLKT-SGIDADAPEHTAFAPEFLMQQMEWRETLMEARAGNDL-E
HSCB_NEIMB      NDAYRTLKNPIDRAAYLLKT-SGIDADAPEHTAFAPEFLMQQMEWRETLMEARAGNDL-E
HSCB_NEIM0      NDAYRTLKNPIDRAAYLLKT-SGIDADAPEHTAFAPEFLMQQMEWRETLMEARAGNDL-E
HSCB_NEIMA      NDAYRTLKNPIDRAAYLLKT-SGIDADAPEHTSFASEFLMQQMEWRETLMEARAGKDL-E
HSCB_PSEAE      NEAYQTLKSAPRRALYLLTL-SGHELPLEA-TVQDPEFLLQQMQLREELEELQDSADL-A
HSCB_PSEA7      NDAYQTLKSAPRRALYLLTL-NGRELPLEA-TVQDPEFLLQQMQLREELEELQDSADL-A
HSCB_PSEAB      NEAYQTLKSAPRRALYLLTL-SGHELPLEA-TVQDPEFLLQQMQLREELEELQDSADL-A
HSCB_PSESM      NEAYQTLKSPPKRARYLLAM-NGNEVPLEV-TVHDPEFLLQQMQLREDLEDLQDEADL-A
HSCB_PSEPF      NDAYQTLKSPAQRARYLLTI-SGHEVPMEV-TVHDPEFLLQQMQWREELEDLQDSADL-A
HSCB_PSEMY      NEAYQVLKTPSQRARYLLAL-RGPELPLEV-TVQDPDFLLQQMQLREELEELQDDADL-A
HSCB_PSEPK      NDAYQTLRSAPRRARYLLAI-SGHEVPQEV-TVHDPDFLLQQMQWREELEELQDEADL-D
HSCB_PSEP1      NDAYQTLRSAPRRARYLLAI-SGHEVPQEV-TVHDPDFLLQQMQWREELEELQDEADL-D
HSCB_PSEPG      NDAYQTLRSAPRRARYLLAI-SGHEVPQEV-TVHDPDFLLQQMQWREELEELQDEADL-D
HSCB_PSEE4      NDAYQTLRSAPRRARYLLAI-GGHEVPQEV-TVHDPDFLLQQMQWREELEELQDEADL-D
HSCB_PSEU5      NEAYQTLKSPSRRARYLLAL-EGHDVPLEA-TVQDPAFLMQQMHWREELEELHEQADL-D
HSCB_AZOVI      NEAYQTLKSPSQRARYLLSL-QGEELSQET-TVQDPAFLMQQMELREELQELQDSADL-A
HSCB_PSYIN      NDAYQTLKNSCLRAQYLLLL-AGLDIALEHKTLQDTAFLVQQMEWRETIAAFTE--DDQD
HSCB_RICRS      NNAYSTLKDALKRAEYMLLL---QNINLNDEKTRSLLSPLELSIFWDEMEIIENTILF-S
HSCB_RICRO      NNAYSTLKDALKRAEYMLLL---QNINLNDEKTRSLLSPLELSIFWDEMEIIENTILF-S
HSCB_RICCN      NNAYSTLKDALKRAEYMLLL---QNINLNDEKTRSLLSPLELSIFWDEMEIIENTILF-S
HSCB_RICM5      NNAYSTLKDALKRAEYMLLL---QKINLNDEKTRSLLSPLELSIFWDEMEIIENTILF-S
HSCB_RICFE      NNAYSTLKDTLKRAEYMLLL---QNINLNDEKTRSLLSPLELCIFWDEMEIIENTILF-S
HSCB_RICAH      NNAYSTLKNALKRAEYMLLL---QNINLNDEKTRSVLSPLELSIFWNEMEIIENTTLF-S
HSCB_RICPR      NKAYSTLKDALKRAEYMLLL---QNINLNDEKIRSLLSPLELSIFWDEMERIENTTLF-S
HSCB_RICTY      NKAYSTLKDALKRAEYMLLL---QNINLNDEKIRSLLSPLELSIFWNEMERIENTILF-S
HSCB_RICBR      NKAYYTLKDSLKRAEYMLLL---YGVNLNDEKVRSKLSALELSIFWDEMELIENTSSY-K
                * .   *:    **  :                             : :           

HSCB_BUCAI      ELNNLEQIIQKKIIYCKKKIELEFEKTR---YKKVIKIISELLFFEKIKDVLKKEYNIYL
HSCB_BUCAP      QIDIFFKKIRNKIDNYEKIIEIKFNEKK---WDDIIKLITKLLFFKKIQTRLKQS-----
HSCB_BUCBP      EINKILLEVSQIEKNYIKKLKNFCNLEK---WKIAHSILYKLLFLTKFIKKTKKIQHEII
HSCB_PASMU      QLVAFSADIEQTQQALLSELADALSSQQ---WQQAKVINDKLRFIKKLLLEVERVEEKLL
HSCB_MANSM      GLMTFSAEIEQSNKEKISEISTALSMKD---WQQAKLINDRLRFIKKLMTEIERIEDKLA
HSCB_HAEIN      ALNAFAKEIKQETQSLLTALFESLKSQQ---WARASQYCDKLRFTHKLSEEIERVEERIF
HSCB_HAEDU      QLAGFLKQIKTEQRNVEQQLATLLNQQQ---WQKADLLTERLRYFKKLIIQIEKVEEKLL
HSCB_VIBC3      ALVAFDTKVTAMQRHYLAQLQGQLAQSE---WLAAADQIRKLKFIAKLKNEVERVEDQLL
HSCB_VIBCH      ALVAFDTKVTAMQRHYLAQLQGQLAQSE---WLAAADQIRKLKFIAKLKNEVERVEDQLL
HSCB_VIBVY      ALAAFDARVSKMYKQHLASIEQELNDAQ---WPQAADRVRKLKFIAKLKNEIELVEEKLF
HSCB_VIBVU      ALAAFDARVSKMYKQHLATIEQELNDAQ---WPQAADRVRKLKFIAKLKNEIELVEEKLF
HSCB_VIBCB      ALFDFDSKVSKMYKQHLASVEQELDQGL---WAEAADRVRKLKFIAKLKNEIELVEDKLL
HSCB_VIBPA      ALFDFDSKVSKMYKQHLASVEQELNDGL---WAEAADRVRKLKFIAKLKNEIELVEDKLL
HSCB_PHOPR      ALFDFEQQVTALYKSQLSALEQLLNQDD---WEEAADAVRKLKFIDKLRYEIERLEETFF
HSCB_ALIF1      ALFDFAENVTAMRKSQLVQLQELLKNEA---WIEAAQSVRKLKFIEKLNQEVEQLEEKLL
HSCB_AERHH      AIKDFRQEIRHDHQLLMQQLTQALATGE---DPRAADCVRKLKFVDKLLEELERFEDSLF
HSCB_AERS4      AIKDFRQEIGHDHQLLMQQLTLTLAAGD---DLIAADCVRKLKFVDKLLEELERFEDSLF
HSCB_SHESM      CIDELYDSFAAYRTKLTKLLTAQLSSDSEEDALLAADQVRKLKFMAKLHDELTRIEDALL
HSCB_SHESR      CIDELYDSFAAYRTKLTKLLTAQLSSDSEEDALLAAVQVRKLKFMAKLHDELTRIEDALL
HSCB_SHESA      SIDELYDSFAAYRTKLTKLLTAQLSSGSEDDALLAADQVRKLKFMAKLHDELTRIEDALL
HSCB_SHEON      IINELYDSFAAYRLKLTKLLAAQLSSGSDEDALLAADQVRKLKFMAKLQDELTRIEDALL
HSCB_SHEB8      SIDELYQSFAQYRAQLTQQLTQLLTSEQAEDALLAADQVRKLKFMAKLHDELTRVEDALL
HSCB_SHEB5      SIDALYQSFAEYRAQLTQQLTQLLTSEQAEDALLAADQVRKLKFMAKLHDELTRVEDALL
HSCB_SHEB9      SIDELYQSFAEYREQLTQQLTQLLTSEQAEDALLAADQVRKLKFMAKLHDELTRVEDALL
HSCB_SHESW      SIDELYQSFAEYRAKLTYMLTAQLNSSKDEDALLAADQVRKLKFMAKLHDELTRIEDALL
HSCB_SHEPC      SIDELYQSFAEYRAKLTHMLTVQLNSSKDEDALLAADQVRKLKFMAKLHDELTRIEDALL
HSCB_SHEFN      SIDELYESFGEFESTLLTKLATLLISDESADALLAADQIRKLKFMAKLHDELARIEDGLL
HSCB_SHEDO      QIDELYDSFSAHEKLLFSQLSHLLQTQDEVAYLKAADQVRKLKFMAKLQQELTNIEDALL
HSCB_SHEHH      EIAELYDSFEQYARQITTELKPLLVSELEADHLQAAEQIRKLKFMAKLQDELTRVEDALF
HSCB_SHEPA      EIAELYDSFEQYAKHITAELKLLLVSELEADHLQAADQIRKLKFMAKLQDELTRVEDALL
HSCB_SHELP      AIEHLHQSFGEYRGDITAQLAQKIGSEEASVLEQAADLVRKLKFMDKLQAELERAEDALF
HSCB_SHEAM      LIADLYQSFGDFQKQVTAKLKTLLVSEDDNDLQAAADQVRKLKFMAKLHVELERAEDALL
HSCB_PSEA6      ALESLDDEVAADIKRLLSELGGFLEQSDDAANENAANLVRKLKFLFKLRHEIEIKEDALS
HSCB_COLP3      ALLEVQSVLSTEYLQLSQVMRTQISENNAASNSAACDNLRKLKFYQKLNIEVDRLEDSLF
HSCB_XENNA      VLSGFSSRLNKMIKTRREQMEQQLDAAE---WLIAADTVRKLRFLDKLQQQVEQLEERLL
HSCB_PHOLL      ALADFAARLNGMIKTRSQLMVQQLDEQQ---WEQAADTVRKLRFLDKLQQQVEQLEERLL
HSCB_YERPE      LLAEFSRRVAQMTTTRTQQMVEQLDAQL---WVQAADTVRKLRFLDKLQQQVEQLEERLF
HSCB_YERPP      LLAEFSRRVAQMTTTRTQQMVEQLDAQL---WVQAADTVRKLRFLDKLQQQVEQLEERLF
HSCB_YERPN      LLAEFSRRVAQMTTTRTQQMVEQLDAQL---WVQAADTVRKLRFLDKLQQQVEQLEERLF
HSCB_YERPA      LLAEFSRRVAQMTTTRTQQMVEQLDAQL---WVQAADTVRKLRFLDKLQQQVEQLEERLF
HSCB_YERP3      LLAEFSRRLAQMTTTRTQQMVEQLDAQL---WVQAADTVRKLRFLDKLQQQVEQLEERLF
HSCB_YERPS      LLAEFSRRLAQMTTTRTQQMVEQLDAQL---WVQAADTVRKLRFLDKLQQQVEQLEERLF
HSCB_YERE8      QLATFSSRLALMTKTRSQLMVEQLGRQQ---WEQAADTVRKLRFLDKLQQQVEQLEERLF
HSCB_SERP5      QLASFGARVNETVKQRSALMIQQLDSQQ---WMDAADTVRKLRFLDKLQQQVEQLEEKLL
HSCB_PECAS      VLTTFAERLQVMIGTRRSHMRHELDNET---WTDAADTVRKLRFLDKLQQQVEELEEQLL
HSCB_ECOLI      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECOUT      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECO57      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECOLC      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECOL6      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECOHS      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECOK1      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SHIBS      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECOL5      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SHIDS      RLESFIKRVKKMFDTRHQLMVEQLDNET---WDAVADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_ECO24      RLESFIKRVKKMFDTRHQLMVEQLDNEA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SHISS      RLESFIKRVKKMFDTRHQLMVEQLDNEA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SHIF8      RLESFIKRVKKMFDTRHQLMVEQLDNEA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SHIFL      RLESFIKRVKKMFDTRHQLMVEQLDNEA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_CITK8      RLESFIKRVKTMFDARHQLMVEQLDNET---WDVAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SALPB      RLESFIKHVQKMFDARLQQMVEQLDNAA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SALCH      RLESFIKRVQKMFDARLQQMVEQLDNAA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SALTY      RLESFIKRVQKMFDARLQQMVEQLDNAA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SALPA      RLESFIKRVQKMFDARLQQMVEQLDNAA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SALTI      RLESFIKRVQKMFDARLQQMVEQLDNAA---WDAAADTVRKLRFLDKLRSSAEQLEEKLL
HSCB_SALAR      RLESFIKRVQKMFDTRLQQMVTQLDNAA---WGEAADTVRKLRFLDKLRSSADQLEEKLL
HSCB_ENT38      RLESFIKRVKGMFDSRHQQMVEQLNNET---WDVAADSVRKLRFLDKLRSSAEQLEEKLL
HSCB_KLEP7      RLEGFIKRVKALFDTRQQLMVDQLHNES---WEAAADTVRKLRFLDKLRSSAEELEEKLL
HSCB_PARXL      ALDALLTELRDEERMRFDKLGALLDSG---ANQAAGEAVRQLMFIERVASEIGTQIERLE
HSCB_BURVG      ALDALLAELRDEKRVRIERLGTLLDSG---ADQAAAEAVRQLMFIERVASEVGAQIERLE
HSCB_BURP0      ALDALLAELRDERRARLAKLGALLDSG---SDQGAAEAVRQLMFVERVSAEIGAQIERLE
HSCB_BURP1      ALDALLAELRDERRARLAKLGALLDSG---SDQGAAEAVRQLMFVERVSAEIGAQIERLE
HSCB_BURMA      ALDALLAELRDERRARLAKLGALLDSG---SDQGAAEAVRQLMFVERVSAEIGAQIERLE
HSCB_BURMS      ALDALLAELRDERRARLAKLGALLDSG---SDQGAAEAVRQLMFVERVSAEIGAQIERLE
HSCB_BURP6      ALDALLAELRDERRARLAKLGALLDSG---SDQGAAEAVRQLMFVERVSAEIGAQIERLE
HSCB_BURPS      ALDALLAELRDERRARLAKLGALLDSG---SDQGAAEAVRQLMFVERVSAEIGAQIERLE
HSCB_BURTA      ELDALLDELRDERRARLAKLGSLLDSG---SDQGAAEAVRQLMFVERVSAEIGAQIERLE
HSCB_RALSO      ALDDLLAMLRGEKRARYQTLAGLLNGGG--HDAAAADAVRQLMFIEKIERDTAEAIDRLD
HSCB_BORPE      AFAALRAELEQARLRMQQTLSELIDERG--DYQQAGTKVREWMFVEKLAQELSAAQPMQ-
HSCB_BORBR      AFAALRAELEQARLRMQQTLSELIDERG--DYQQAGTKVREWMFVEKLAQELSAAQPMQ-
HSCB_BORPA      AFAALRAELEQARLRMQQTLSELIDERG--DYQQAGTKVREWMFVEKLAQELSAAQPMQ-
HSCB_BORA1      ARAALGEELEQAREAMRASLAELIDTRQ--DYAAAGQKVREWMFIEKLAQELAAVQP---
HSCB_AROAE      ELTQLHHRLRHHAREVFDELERTIDERH--DFAAAAEIVRRLMFMEKIQHEIDDALEALE
HSCB_CHRVO      ALESLSRRLRGEVRDLQTELEAALDARA--DLDAAAVLVRKLRFMEKLDQEIGDAIESLL
HSCB_METCA      ALDRLGFRLKKEMDHLIESLGAMLDVQQ--SHPDAAVLVRQLAFLEKLKRDLDQAHALLE
HSCB_NEIMF      SLKNLDNEIRDEQEKLFCGLKQSFARQ---DYDTAAQQVRQGRFLDKLRNEISSAL----
HSCB_NEIMB      SLKNLDNEIRDEQEKLFCGLKQSFARQ---DYDTAAQQVRQGRFLDKLRNEISSAL----
HSCB_NEIM0      SLKNLDNEIRDEQEKLFCGLKQSFARQ---DYDTAAQQVRQGRFLDKLRNEISSAL----
HSCB_NEIMA      SLKNLDNEIRDEQEKLFCGLKQSFARQ---DYDTAAQQVRQGRFLDKLRNEISSAL----
HSCB_PSEAE      GVATFKRRLKAAQAELEREFAACWDDAQ--RREEAERLVRRMQFLDKLAQEVRQLEERLD
HSCB_PSEA7      GVATFKRQLKAAQAELEGEFAACWDDAR--RREEAERLVRRMQFLDKLAQEVRQLEERLD
HSCB_PSEAB      GVATFKRRLKAAQAELEREFAACWDDAQ--RREEAERLVRRMQFLDKLAQEVRQLEERLD
HSCB_PSESM      GVATFKRQLKVAQDELNQSFAACWNDAA--QREHAEKLMRRMQFLDKLSHEVRQLEERLD
HSCB_PSEPF      GVAAFKRRLKTAQEELNESFAACWDDAA--QREQAERLMRRMQFLDKLTYEVRQLEERLD
HSCB_PSEMY      GVAAFKRRLKTAQEQLNDSFAACWDDDT--RREEAERLMRRMQFLDKLSHEVRQLEERLD
HSCB_PSEPK      GVGVFKKRLKAAQDTLNEDFAGCWDAPG--ERDKAERLMRRMQFLDKLAQEVRQLEERLD
HSCB_PSEP1      GVGVFKKRLKAAQDTLNEDFAGCWDAPG--ERDKAERLMRRMQFLDKLAQEVRQLEERLD
HSCB_PSEPG      GVGVFKKRLKFAQDTLNEDFAACWDAPG--ERDKAERLMRRMQFLDKLAQEVRQLEERLD
HSCB_PSEE4      GVGVFKKRLKVAQDTLNDDFADCWDDAA--QRDKAERLMRRMQFLDKLAQEVRQLEERLD
HSCB_PSEU5      GVAAFKSRLKQAQQGLNDDFGQIWRDPA--RRVDAERLVRRMQFLDKLTQEVRQLEERLD
HSCB_AZOVI      GVARFKRRLVQDQEQLNEGFAACWADPR--RRDEAERLARRMQFLDKLFAEVRQLEERLD
HSCB_PSYIN      KMDEFALQLQQQVAGLESKIEVQLQNDE---LEATADSIRQLKFMLKLQIELVLIEEKLF
HSCB_RICRS      DLEKIKDKYELMKKLEIDALKQAFEEQN---LSDATIKTSKLKYIGTLLHKLQEKIKSCK
HSCB_RICRO      DLEKIKDKYELMKKLEIDALKQAFEEQN---LSDATIKTSKLKYIGTLLHKLQEKIKSCK
HSCB_RICCN      DLEKIKDKYELMKKLEIDSLKQAFEEQN---LSDATIKTSKLKYIGTLLHKLQEKIKSCK
HSCB_RICM5      DLEKIKDKYELMKKLEIDSLKQAFEEQN---LSDATIKTSKLKYIRTLLHKLQEKIKSCK
HSCB_RICFE      DLEKIKDKYELMKKLEIDSLKQAFEEQN---LSDTIIKTSKLKYIGTLLHKLQEKIKSCK
HSCB_RICAH      DLEKIKDKYELMQKQEIDSLKQAFKEQN---LSDATIKTSKLKYIGTLLHKLQKKIKSCK
HSCB_RICPR      DLEKLKNKYELMQQQNINSLKQAFVEQN---LSDATIYTSKLKYIRTLQSKLQEKIKSCK
HSCB_RICTY      DLEKIKHKYELMQQQNINSLKQAFEKRN---LSDATIHTSKLKYIRTLQNKLQEKIKSCK
HSCB_RICBR      SLEEIKSKYELMEKAEVNFLAESFKKQD---LSDATIKTSKLKYIHTLLSKLQEKMKLCK
                    .              .                    .  :   .            

HSCB_BUCAI      SQIN
HSCB_BUCAP      ----
HSCB_BUCBP      N---
HSCB_PASMU      DF--
HSCB_MANSM      DF--
HSCB_HAEIN      ELD-
HSCB_HAEDU      EY--
HSCB_VIBC3      G---
HSCB_VIBCH      G---
HSCB_VIBVY      G---
HSCB_VIBVU      G---
HSCB_VIBCB      G---
HSCB_VIBPA      G---
HSCB_PHOPR      D---
HSCB_ALIF1      G---
HSCB_AERHH      ES--
HSCB_AERS4      ES--
HSCB_SHESM      D---
HSCB_SHESR      D---
HSCB_SHESA      D---
HSCB_SHEON      D---
HSCB_SHEB8      D---
HSCB_SHEB5      D---
HSCB_SHEB9      D---
HSCB_SHESW      D---
HSCB_SHEPC      D---
HSCB_SHEFN      D---
HSCB_SHEDO      D---
HSCB_SHEHH      D---
HSCB_SHEPA      D---
HSCB_SHELP      ----
HSCB_SHEAM      D---
HSCB_PSEA6      DF--
HSCB_COLP3      DD--
HSCB_XENNA      GDF-
HSCB_PHOLL      DDF-
HSCB_YERPE      DDFA
HSCB_YERPP      DDFA
HSCB_YERPN      DDFA
HSCB_YERPA      DDFA
HSCB_YERP3      DDFA
HSCB_YERPS      DDFA
HSCB_YERE8      DDLS
HSCB_SERP5      GFE-
HSCB_PECAS      DR--
HSCB_ECOLI      DF--
HSCB_ECOUT      DF--
HSCB_ECO57      DF--
HSCB_ECOLC      DF--
HSCB_ECOL6      DF--
HSCB_ECOHS      DF--
HSCB_ECOK1      DF--
HSCB_SHIBS      DF--
HSCB_ECOL5      DF--
HSCB_SHIDS      DF--
HSCB_ECO24      DF--
HSCB_SHISS      DF--
HSCB_SHIF8      DF--
HSCB_SHIFL      DF--
HSCB_CITK8      DF--
HSCB_SALPB      DF--
HSCB_SALCH      DF--
HSCB_SALTY      DF--
HSCB_SALPA      DF--
HSCB_SALTI      DF--
HSCB_SALAR      DF--
HSCB_ENT38      DF--
HSCB_KLEP7      DF--
HSCB_PARXL      N---
HSCB_BURVG      T---
HSCB_BURP0      H---
HSCB_BURP1      H---
HSCB_BURMA      H---
HSCB_BURMS      H---
HSCB_BURP6      H---
HSCB_BURPS      H---
HSCB_BURTA      H---
HSCB_RALSO      D---
HSCB_BORPE      ----
HSCB_BORBR      ----
HSCB_BORPA      ----
HSCB_BORA1      ----
HSCB_AROAE      T---
HSCB_CHRVO      D---
HSCB_METCA      D---
HSCB_NEIMF      ----
HSCB_NEIMB      ----
HSCB_NEIM0      ----
HSCB_NEIMA      ----
HSCB_PSEAE      D---
HSCB_PSEA7      D---
HSCB_PSEAB      D---
HSCB_PSESM      D---
HSCB_PSEPF      D---
HSCB_PSEMY      D---
HSCB_PSEPK      D---
HSCB_PSEP1      D---
HSCB_PSEPG      D---
HSCB_PSEE4      D---
HSCB_PSEU5      D---
HSCB_AZOVI      D---
HSCB_PSYIN      D---
HSCB_RICRS      ----
HSCB_RICRO      ----
HSCB_RICCN      ----
HSCB_RICM5      ----
HSCB_RICFE      ----
HSCB_RICAH      ----
HSCB_RICPR      ----
HSCB_RICTY      ----
HSCB_RICBR      ----