CLUSTAL format seed alignment for MF_00688

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LFTR_XANAC      MARHLPFLLDADPTAPFPPAAQALR---DPDGLLAIGGDLAPQRLLNAYAHGIFPWFSQ-
LFTR_XANCP      MSRTLPHLLSSDPASPFPPAEHALR---EPDGLLAIGGDLHPQRLLNAYAHGIFPWFSD-
LFTR_XYLFA      -MHSPPYLLSPAPNTPFPPAEYALR---EPNGLLAIGGDLTPQRLLAAYRNGIFPWFTE-
LFTR_XYLFT      -MHSQPYLLSPTPNTPFPPAEHALH---EPNGLLAIGGDLTPQRLLAAYRSGIFPWFTE-
LFTR_RALSO      ------MIAWLDPHDPFPPVDRALGPDSEAPGLLAASADLSPQRLLIAYRQGIFPWYAQ-
LFTR_PSEAE      -----MLTWLSRTDFDFPPLDKALQ---EPNGLLAAGGDLNPQRLVAAYRHGCFPWYQD-
LFTR_PSEPK      -----MLTWLTRDSLTFPPLEKALH---DPNGLLAAGGDLSPERLVQAYRHGCFPWYQD-
LFTR_PSESM      -----MLTWLNRNNLDFPPLEKALR---EPDGLLAAGGDLSADRLIKAYRHGCFPWFQE-
LFTR_NITEU      ------MIRTLYSDTPFPPLEQALI---EPNGLLAAGGDLSPERLISAYRQGIFPWFNP-
LFTR_ECOLI      ----MRLVQLSRHSIAFPSPEGALR---EPNGLLALGGDLSPARLLMAYQRGIFPWFSP-
LFTR_ECO57      ----MRLVQLSRHSIAFPSPEGALR---EPNGLLALGGDLSPARLLMAYQRGIFPWFSP-
LFTR_ECOL6      ----MRLVQLSRHSIAFPSPEGALR---EPNGLLALGGDLSPARLLMAYQRGIFPWFSP-
LFTR_SALTY      ----MRLVQLSRHSIAFPSPEGALR---EPNGLLALGGDLSPARLLMAYQHGIFPWFSP-
LFTR_YERPE      ----MRVTQLSSQSFIFPSPELALR---EPNGLLALGGDLTAPRLLAAYQRGIFPWFNP-
LFTR_VIBCH      --MAIYLTELSPETLTFPSPFTALD---DPNGLLAFGGDLRLERIWAAYQQGIFPWYGP-
LFTR_VIBPA      --MAIYLTELDS-TFNFPSPYEALS---DPNGLLAFGGDLDPHRILSGYYQGIFPWYGP-
LFTR_SHEON      ---MKSLSFLNHEFEAFPSPELALT---DPNGLLAIGGDLRPDRLLTAYYHGIFPWFNA-
LFTR_NEIMA      ----MRIPLLAPDNYAFPDPAYALA---WCDGLVGVSGDLDAGRLLEAYQNGVFPWFLR-
LFTR_NEIMB      ----MRIPLLAPDNYAFPDPAYALA---RCDGLVGVSGDLDAGRLLEAYRNGVFPWFSR-
LFTR_CAMJE      ----------MKSSNLYSKLLNAPK-----NAPVFLSQNLEADFIVKAYTFGLFPWTS--
LFTR_LEPIN      ----------MKDFSDFFRNPHIWD-----REIVAVGGDLSPERLLYAYKNGIFPWSD--
LFTR_AGRFC      -----------------------------MAGRRSRNNDITVDILLRAYSAGLFPMADSA
LFTR_RHIME      -----------------------------MKETRSKQPDITPDMLLRAYSIGLFPMADSA
LFTR_BRUME      ----------------------------MTAEAPPDDDIIEPEMLLRAYATGIFPMAEEA
LFTR_RHILO      -----------------------------MTRPYAPGYRIPTDLLLKAYASGVFPMAESA
LFTR_BRADU      -----------------------------MTSRDSASSEITPAVLLRAYACGIFPMAESA
LFTR_CAUVC      -----------------------------------MDDAFTVDDLIACYARGVFPMADAR
LFTR_NOSS1      -------------------------------------MQYDIASIIQGYAQGYFLMADD-
LFTR_THEEB      -------------------------------MEISQAEWVRDTFIDHRYAQGYFLMGA--
LFTR_SYNY3      -------------------------------------MKIDVDYAIAQYAQGLFLMADD-
LFTR_DEIRA      -----------------------MLAHMPAARTFLQHPDPLTREIAEGYAGGSFLMDN--
LFTR_CHLTE      --------------------------------------MIKVEDILRAYRHGFFPMADS-
                                                                *  * *      

LFTR_XANAC      -DQPILWWSPDPRMVFRTDALRLSSRFRRQLR----SSSWTVRADTAFEQVIDACASVP-
LFTR_XANCP      -GQPLLWWSPNPRTVFRTDAIHLSSRFRRQLR----TCTWTLRADTAFAQVIAACALSP-
LFTR_XYLFA      -GQPPLWWSPDPRTVFRSDSIHLSRRFRRNLR----TSTWTVRADTMFAAVIDACASTP-
LFTR_XYLFT      -GQPPLWWSPDPRTVFHSDNIHLSRRFRRSLR----TSTWTVRADTMFAAVIDACASTP-
LFTR_RALSO      -GQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDDPTWEIRIDHAFRDVMVDCATTA-
LFTR_PSEAE      -GQPILWWSPDPRTVLFPDELHVSRSLAKCLR----QQRFEVTFNRDFRAVIQACAAP--
LFTR_PSEPK      -GQPILWWSPDPRTVLLPDQLHVSRSLAKLMR----QGRYQVSFDTDFPAVIAACAAP--
LFTR_PSESM      -GQPILWWSPDPRTVLLPEELHISRSLGKVLR----QSRYRVTFDTDFARVIKACAAP--
LFTR_NITEU      -GEIILWWSPDPRMVLFPRELKISRSLHKTLK----KNDYQIRTDSAFTEVMQACAAP--
LFTR_ECOLI      -GDPILWWSPDPRAVLWPESLHISRSMKRFHK----RSPYRVTMNYAFGQVIEGCASD--
LFTR_ECO57      -GDPILWWSPDPRAVLWPESLHISRSMKRFHK----RSPYRVTMNYAFGQVIEGCASD--
LFTR_ECOL6      -GDPILWWSPDPRAVLWPESLHISRSMKRFHK----RSPYRVTMNYAFGQVIEGCASD--
LFTR_SALTY      -GDPILWWSPDPRAVLWPEKFHLSRSMKRFHN----ASPYRVTLNYAFDRVIDGCANH--
LFTR_YERPE      -GEMILWWSPDPRAVLFPEDLHISRSMRRFIR----HCPYRFTLNHAFADVISACATE--
LFTR_VIBCH      -EDPILWWSPSPRAVFDPTRFQPAKSVKKFQR----KHQYRVSVNHATSQVIEQCALT--
LFTR_VIBPA      -GEPILWWSPSPRAVFDPLTFKPSKSLKKFQR----KHQYKVTINQATEHVIQLCSST--
LFTR_SHEON      -EDPILWWSPDPRAIFIPGQVNISTSLRKYLK----KQPWRFTINHAFTDVMAGCAQP--
LFTR_NEIMA      -DGWFFWYAVGPRAVIVPERLHVPCSLAKTLR----NGSYRVAVNGCFAEVVAHCAAAA-
LFTR_NEIMB      -DGWFFWYAVGPRAVVFPDRLHIPRSLAKTLR----NGSYRVAVNGCFAEVVAHCAAAA-
LFTR_CAMJE      --KPVTWWCPDPRCILIPNQIHIQKNMKKFINL------YQIKLDYDFLKLITLCRDT--
LFTR_LEPIN      --QPILWYCLDPRSIFDLNKLHISKRLKRKINQK----RYTITFNRAFEQVMRCCAYR--
LFTR_AGRFC      DDPELFWVEPEIRGIIPLDDFHVSKSLAKAMR----KKPFAIRFNTAFEDVMAGCAAE--
LFTR_RHIME      DDPELFWVEPEIRGIIPLDRFHVSRSLAKAIR----RRPFDIRFDTAFAEVMEGCAQP--
LFTR_BRUME      DDPEVFWVRPEKRGVIPLDGFHIPRSLQKTIR----QGIFEIRLDSNFAGVIEGCASG--
LFTR_RHILO      SDPEVFWVRPETRGIIPLDGFHTPKSLRKTIR----KSLFDIRFDFDFEATIDGCAEK--
LFTR_BRADU      DDPTLFWVEPELRGVIPLGGFRVASRLARTVR----SDGFRVTVNTAFKATIAGCAAP--
LFTR_CAUVC      EDESLFLIDPERRGVLPLGTFHIPKRLARTVR----NGPYEVRVDTAFDTVIENCAAS--
LFTR_NOSS1      NDCLGWYGSRDRTLIPLDERFRYPKSLQRVLN----QERFTVAINRDFAAVVAGCAN---
LFTR_THEEB      GDRLEWYTSRQRALIPLDERFRYPASLRRVLN----QNRFQVAINRDFSAVVEGCAD---
LFTR_SYNY3      RHGLGWYSSDRHALIPLDDQFRYPKSLQRVLN----QNRFQVKINQAFTAVCEGCAA---
LFTR_DEIRA      GDGLRWYGVPGRALVPLTEDAGLHVARRMRRE----LKHFRPSVDLAFDEVIAGCRGHLP
LFTR_CHLTE      REGTVSWCQPYQRAVVPLDSFRPSRSLRRVIG----KKRFTIKINSVFEQVIRACSQP--
                              :                        :    :         *     

LFTR_XANAC      -RAGQDGTWITAQMQQAYIALHELGHAHSLEVFD-----GTRLVGGIYGVAIGQMFFGES
LFTR_XANCP      -RPGQDGTWITDQMQEAYLDLHRRGYAHSVEVFD-----GARLVGGIYGVAIGQMFFGES
LFTR_XYLFA      -RRGQDGTWITANMREAYLTLHQHSYAHSVEVFD-----GTMLVGGIYGVALGRMFFGES
LFTR_XYLFT      -RRGQDGTWITANMREAYLTLHQHGYAHSVEVFD-----GTMLVGGIYGVAIGRMFFGES
LFTR_RALSO      -RPGQHGTWITEDVIQAYTALHRRGYAHSVETWH-----GGRRVGGLYGVALGHMFYGES
LFTR_PSEAE      -RNYADGTWITTPMQLAYQELHLRGIAHSVEVWQ-----ERQLVGGLYGLAMGRLFFGES
LFTR_PSEPK      -RDYADGTWITDTMRNAYCELHRRGIAHSVEVRQ-----DGELVGGLYGLAMGQLFFGES
LFTR_PSESM      -RSYANETWITGSMQDAYLELHRRGHAHSVEVWD-----QDELVGGLYGLAMGQLFFGES
LFTR_NITEU      -REDQAGTWIHEEMIAAYTALHQMGVAHSVETWI-----EGELAGGLYGVAIGRAFFGES
LFTR_ECOLI      -R--EEGTWITRGVVEAYHRLHELGHAHSIEVWR-----EDELVGGMYGVAQGTLFCGES
LFTR_ECO57      -R--EEGTWITRGVVEAYHRLHELGHAHSIEVWR-----EDELVGGMYGVAQGTLFCGES
LFTR_ECOL6      -R--EEGTWITRGVVEAYHRLHELGHAHSIEVWC-----EDELVGGMYGVAQGTLFCGES
LFTR_SALTY      -R--DEGTWITRGIEEAYRRLHELGHAHSIEVWR-----DRELVGGMYGVSQGALFCGES
LFTR_YERPE      -R--DEGTWIGRDVQQAYCQLHALGHAHSLEVWL-----ENELVGGLYGVAVGAVFCGES
LFTR_VIBCH      -R-PADQRWLNDSMRHAYGELAKQGRCHSVEVWQ-----GEQLVGGLYGISVGQLFCGES
LFTR_VIBPA      -R-PADETWLNEEMQAAYIQLSNLGHCHSVEVWH-----DNTLVGGLYGISVGQLFCGES
LFTR_SHEON      -RRKQAGTWITHEIQMAYRELHHNGHAHSIEVWQ-----GERLIGGLYGLAIGQVFCGES
LFTR_NEIMA      -RPNQDGTWIAPEFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGES
LFTR_NEIMB      -RPNQDGTWIAPEFQTAYLKLHEMGYAHSFECHYPDESGETRLAGGFYGVQIGRVFYGES
LFTR_CAMJE      ---RSQ-SWIDDEFITTYYKLFTQGYAHSLELYENN-----ELIGGIYGLILGKVFFGES
LFTR_LEPIN      ---PGEDTWITDLFIKSYTEFHKLGYAHSLEVWDENG----KLGGGVYGIAIGNFFAGES
LFTR_AGRFC      -AADRPSTWINATIRRLYTELHQIGHAHSVEAWE-----GDELVGGLYGVSLGAAFFGES
LFTR_RHIME      -APDRPTTWINDTIRSLYAALHNMGHAHSVEAWE-----GDALVGGLYGVSLGAAFFGES
LFTR_BRUME      -TGERARTWINEPIRRAYAKLFEIGHCHTVEAWY-----EGKLAGGLYGVTLGRAFFGES
LFTR_RHILO      -REERRSTWINAPIREAYVQLHRMGHCHSVEAWR-----EDQLVGGLYGVSLGRVFFGES
LFTR_BRADU      -QAGREDTWINKRIRDLYSGLFELGHCHSVEAWQ-----GDDLVGGLYGVSLGRAFFGES
LFTR_CAUVC      -RPGRLDTWINHPIQRLYGQLYARGLAHSVETWL-----GDELVGGLYGVSLGGAFFGES
LFTR_NOSS1      ----RESTWISQELQEIYRLLYQTGYAYSFETWQ-----GEELAGGILGIVIGGAFIGES
LFTR_THEEB      ----RPMTWITPRLKEVYHLLYATGWAVSFETWQ-----GDELAGGILGIVIGGAFIGES
LFTR_SYNY3      ----RPETWISQELIEVYHTFHVAGWAHSFETWH-----GDRLAGGILGIAIRGAFIGES
LFTR_DEIRA      GSPERDGEWISDELVEIYQHLHTTGLAHSFEVWQ-----GDELAGGVLGLALGGAFIAES
LFTR_CHLTE      -RSTGQETWLSEEIIKVFLKLHRLGVAHSVESWQ-----DGELAGGLYGLSMGGAFFGES
                        *:   .   :  :   . . :.*             **. *:     * .**

LFTR_XANAC      MFSAQSGGSKVALAALAMHLHTEGWPLLDAQVENPHLLSLGAQRLPRAQFLQQVQLQVAR
LFTR_XANCP      MFSGASGGSKIALAALAAELHGLGWPLIDAQVENPHLMRLGAQRLQREQFLQHVATQVAL
LFTR_XYLFA      MFSTRNGASKIALASLAHFLHTHSAPLIDAQVENQHLLNLGAERWPRKDFLAYVRRLITQ
LFTR_XYLFT      MFSTHNGASKIALASLAYFLHTHSVPLIDAQVENQHLLNLGAERWPRRDFLTSVRRLITQ
LFTR_RALSO      MFAHRTDASKIALAALCAFLGSRGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAASA
LFTR_PSEAE      MFSRADNASKVGFVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQ
LFTR_PSEPK      MFSRADNASKVGFVTLVNHLRDAGFVLIDCQMPTNHLHSLGAHAISRAEFASYLARHLDQ
LFTR_PSESM      MFSRADNASKVGFATLVEHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLARHLDQ
LFTR_NITEU      MFSRATDASKIALVHLARQLENWGYGLIDCQMKTAHLMSMGAREIPRSQFSKRLNQLNAL
LFTR_ECOLI      MFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLG
LFTR_ECO57      MFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRNYLNYLNQMRLG
LFTR_ECOL6      MFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLG
LFTR_SALTY      MFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQ
LFTR_YERPE      MFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFS
LFTR_VIBCH      MFSLATNASKIALWYFCDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSLLSFKEK
LFTR_VIBPA      MFSLKDNASKIALWYLCTHLASKHGQLIDCQVMNPHLASLGAFELDRDEFIQKLLSLREK
LFTR_SHEON      MFHRETNASKAAMAVLQQHLIKMNFKLIDAQVMNPHLESLGAKALKRADFIQLLTQFRDD
LFTR_NEIMA      MFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRMLNAV
LFTR_NEIMB      MFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRMLNAV
LFTR_CAMJE      MVSIKKNASKVAMIKLCDLLKPYDF-IIDCQVYNQHLEFMGAHNISRKEFLNILKEKCNQ
LFTR_LEPIN      MFSFIPDFGKIGLFHLFETLKKDHFTLFDTQQLNLVTLSLGAYQIPKKEYLKRLESAVAS
LFTR_AGRFC      MFSRRTNASKICLVHLVERLNAKGFVLLDTQFTTEHLKTFGAIDVPKLDYARMLDLAVNR
LFTR_RHIME      MFSRRTGASKICLVHLVERLRSKGFQLLDTQFTTEHLKSFGAVDVPKAQYEVLLAKAIAS
LFTR_BRUME      MFTRKRDASKVCLAYLVQHLSRQGFVLLDTQFTTPHLERFGALEVPRKEYEEMLERALEG
LFTR_RHILO      MFSKETDASKICLVHLVERLKARGFALLDTQFTTEHLKRFGAVDVPRGKYEKMLAEALKG
LFTR_BRADU      MFHTARDASKVALVHLVARLIHGGFELLDTQYVTEHLKNFGAVEIPRRRYTALLDKALAG
LFTR_CAUVC      MFSTARDASKVALVHLVARLIAGGYELLDTQFLTEHLAQFGVMEISRADYRRRLSKALA-
LFTR_NOSS1      MFYRIPEGSKVAMVKLVERLRQREFVMFDAQMMNPHLERFGAYRIKDKEYKTLLEKALLS
LFTR_THEEB      MFYRIPNGSKVAMVKLVEHLRQRGFLLFDAQLQNPHLERFGAYVVSPRKYRQLLAQAIRK
LFTR_SYNY3      MFYTIPEASKVAMVKLVQHLRQRSYQLFDAQLQNPHLKRFGAYEVEEKAYKKQLEKALNY
LFTR_DEIRA      KFHRLTNGSKAALIHLAEHLDRQGFALLDAQIQNPHLATLGVYEVTDKEYRRLLRRALAL
LFTR_CHLTE      MFFFRSDASKVAFAWLVGYLKRKGYLLLDAQIMNPHLESLGAIEIPHEEYMVQLERALGK
                 .      .*  :      :      ::* *  .     :*        :   :      

LFTR_XANAC      PALPGTWSGRYGQRPASSLGEARLT--
LFTR_XANCP      PEPPGSWTQRYGERHASALAGVRLT--
LFTR_XYLFA      TDLPACWSVLFGEQLSRELV-------
LFTR_XYLFT      TELPACWSVLFGEKLSRDLV-------
LFTR_RALSO      PAIVPWHFDKSVLRRWTARNEQA----
LFTR_PSEAE      PPTGDLDF-------------------
LFTR_PSEPK      PNSASWVA-------------------
LFTR_PSESM      PTDADWLSRRV----------------
LFTR_NITEU      PGQNRKWYFDFTYPGRSEQ--------
LFTR_ECOLI      RLPNNFWVPRCLFSPQE----------
LFTR_ECO57      RLPNNFWVPRCLFSPQE----------
LFTR_ECOL6      RLPNNFWVPRCLFSPQE----------
LFTR_SALTY      PLASRFWVPRTLFLPRK----------
LFTR_YERPE      PLPAECWLPQSLNFSSAMQ--------
LFTR_VIBCH      QVLSGCFETQWLATPTSPCAFED----
LFTR_VIBPA      QTASDTFTPQVLQDSES----------
LFTR_SHEON      AVNPAAWIPSEVFLEL-----------
LFTR_NEIMA      PLKEEIGRREVACRGL-----------
LFTR_NEIMB      PLKEEIGRREVACKGL-----------
LFTR_CAMJE      ESGFKNFKDLIT---------------
LFTR_LEPIN      GKKWNPSHFVL----------------
LFTR_AGRFC      PSLQF----------------------
LFTR_RHIME      PNLEF----------------------
LFTR_BRUME      IARF-----------------------
LFTR_RHILO      EAIFFP---------------------
LFTR_BRADU      EPGDFLKLSPGEAIPGARALEIIASRQ
LFTR_CAUVC      TPGDFYGLAAGATGIDCLQAISQAS--
LFTR_NOSS1      PSTLI----------------------
LFTR_THEEB      PCQFL----------------------
LFTR_SYNY3      RCHFTSEPDLYD---------------
LFTR_DEIRA      DVEL-----------------------
LFTR_CHLTE      KISFV----------------------