CLUSTAL format seed alignment for MF_00689

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BPT_PSEA6         ---------------------------------------MKFGISQSFPCSYLPDEQETL
BPT_COLP3         ----------------------------------MSDTSYKLGITKTFPCNYLPDQQERL
BPT_SHEON         ------------------------------MNSNANNTPIAIGISQVFPCSYLDGQQEQL
BPT_SHEPC         ------------------------------MNSNANKTPIAIGISQIFPCSYLEDQQEQL
BPT_VIBPA         --------------------------------MSTDLQHIRIGLTNNHPCSYLPERQERV
BPT_VIBVY         --------------------------------MSSDIHQIKIGLTDNHPCSYLPERKERV
BPT_VIBCH         --------------------------------MSSDIQQIRIGLTNNHPCSYLADRMERV
Q6LT11_PHOPR      ----------------------------------MNNLSLRIGLTPNSDCNYLPNEQEQL
BPT_XANCP         -----------------------------MAIHADTHDDLRLFQTGEHACGYWSDRQARD
BPT_XANOR         -----------------------------MAIHADTHDDLRLFQTGEHACGYWSDRRARD
BPT_XYLFA         -----------------------------MAIDSKPHDDLQLFKTNLHPCGYWPDRWASD
BPT_HALHL         ----------------------------------MSRSRITLLRTHCHECAYVSGRTARL
BPT_BURVG         -------------------------MTHPTELPLSPLSALQFYATAPYPCSYLDGRIARS
BPT_BURPS         -------------------------MTHPTELPLSPLSALQFYATAPYPCSYLDGRVARS
BPT_PARXL         -------------------------MTHPNELPLSPLSALQFYATAPYPCSYLDGRIARS
BPT_JANMA         -------------------------MTHPKELPF---STLQFYATAPYPCSYLDGRQARS
BPT_BORPE         -------------------------MPDMSQLKELPFSTLQFYATAPYPCSYLPGRQARS
BPT_ACIAC         -------------------------MTQLNDLPL---QTLQFYATAPYPCSYLPDRQARS
BPT_VEREI         -------------------------MTQLNDLPL---QSLQFYATAPYPCSYLPQRQARS
BPT_POLSJ         -------------------------MTHLKDLPL---QTLQFYATAPYPCSYLPGKQARS
BPT_NITEU         -------------------------------------MTMDFQITRRYPCSYLPGELARS
BPT_PSEAE         ---------------------------------MTELARLKFYATQPHPCSYLPEEQATT
BPT_PSEPK         ---------------------------------MTELARLKFYATQPHSCSYLPEEQATT
BPT_HAHCH         ---------------------------------MSNLRTLVFYATPEHPCSYLDDRLATT
BPT_SACD2         ---------------------------------MTDLNELKLFATTPHPCSYLDDRDATT
BPT_ACIAD         ---------------------------MKSYQPKSLLNDLQYYITPPHDCSYLDNKSARM
BPT_NITHX         ------------------------------MTQH-SRDTPQFYLTAPSPCPYLPDRSERK
BPT_NITWN         ------------------------------MTQH-SRDTPQFYLTAPSPCPYLPDRSERK
BPT_BRADU         ------------------------------MTQH-SRDTPQFYLTAPSPCPYLPGRHERK
BPT_AZOC5         ------------------------------MTEH-SRDTPQFYLTAPSPCPYLPGKEERK
BPT_XANP2         ------------------------------MSEH-PRDTPQFYLTAPSPCPYLPGREERK
BPT_AGRVS         ------------------------------MNTQ-AATSPQFYLTAPAPCPYLAGEMERK
BPT_CAUVC         ------------------------------MTQHFPTRQLRFFLTAPTPCPYLPGREERK
BPT_NOVAD         ------------------------------MTAP--VRFPRFFVTSPAPCPYLPGRSERK
BPT_SPHAL         ------------------------------MSAP--FRFPRFFVTSPAPCPYLAGRTERK
BPT_PARDP         -------------------------------MRHTLPHAPQFYVTAPQPCPYLHGRAERK
BPT_JANSC         -------------------------------MRHTLPIAPQFYVTAPQACPYLDGRRERK
BPT_RUEST         -------------------------------MRHTLPIAPQFYVTAPQPCPYLEGRMERK
BPT_HYPNA         -----------------------MKFSDPHLLPAGLERSLRFYVTNPSPCPYLPDRKERK
BPT_MAGSA         ------------------------------MDHFPLKRPHFFFTTAPLPCPYVSGRLERK
BPT_LEPIN         -----------------------------MIQNKLQNFVDTLPISPEKSCSYYPERL-SQ
BPT_LEPBL         -----------------------------MIRHKLQNFVNSLPISPERSCSYYPDRL-SQ
BPT_CAMJE         -------------------------------------MLEIGFCTLEDQCPYLKDKR-SR
A0RNS0_CAMFF      -------------------------------------MREIDFCTLDTLCPYLEDRN-SR
D1B1S5_SULD5      ---------------------------------MTSASRIVHFSTLDTECSYLKERK-TR
A6QAZ0_SULNB      --------------------------------------------MLDYDCAYLPGHK-VR
BPT_HELHP         -------------------------------------MRLVEFYSEKKVCSYIDSKQ-SI
D3UJ04_HELM1      -------------------------------------MKIVEFFSERSECSYLKNKE-SF
Q1D9U3_MYXXD      -----------------------------------MAFLLAHEVESPRACSYLPERE-AS
H8MFH5_CORCM      -----------------------------------MAVLLAHEIEDPRPCSYLPGRE-AS
E3FRT0_STIAD      -----------------------------------MANVHHHTKEPPGPCTYLPGQF-SS
M1NGD9_DESSD      ------------------MKMSLYDEQCARDFELMESRIDHFFAEMAVECPYHLPHD-AR
Q6AJB2_DESPS      ----------MNREKSLNGTLSAYDLWAAEEFSCIEEKLEQVFVDVETDCPYGLPQQ-AV
D6Z2A5_DESAT      --------------------------------------MRDYLFDIAAECPYGLQSR-AV
I4C3K1_DESTA      MFAFLPPRNHSVTQADSRIMHGQRGVSWTVSPFYGPVELDFLVTSEAHSCPYRPGMDAVE
Q7UET6_RHOBA      --MAPKRQPDPSPPQSGTLDDMSPARDHFPESAEPLRHRMMLVQDAVSDCPYIDGEPARM
C7LWG7_DESBD      -----------------------------------MILYSQPEFSAPAPCPYLPDRTLVY
                                                                   * *        

BPT_PSEA6         L-VYAEETEHNT-YYEMLMAAGFRRSGAQVYRPHCGACTACQAIRVPVADFAPSKGQKRI
BPT_COLP3         L-IAVDERLHNSESYGWLMTQGFRRSGDQSYRPSCPNCNACQSIRVLTSDFLPSKSQKRS
BPT_SHEON         L-VIQEETLDPI-LFERLLAIGFRRSGSAIYKPRCPRCSACQPIRVPIQEFVPSKRQKRT
BPT_SHEPC         L-VIQEETLDPI-LFERLLAIGFRRSGSAIYKPRCPRCSACQPIRLPVREFIPSKRQKRT
BPT_VIBPA         A-VALDAELHTEQNYQLLMANGFRRSGDTIYKPHCERCHACQPIRISIPDFVLSRSQKRL
BPT_VIBVY         A-VALEADMHTADNYEVLLANGFRRSGNTIYKPHCDSCHSCQPIRISVPDIELSRSQKRL
BPT_VIBCH         A-VAIDPQMQTPETYEVLMANGFRRSGDTIYKPHCDHCQSCQALRIPAPDFVPSKSQKRL
Q6LT11_PHOPR      G-VVMDEHWLSPVGYNILLSSGYRRSGRAIYKPMCELCSACTPLRVDCPNFVASKSQKRQ
BPT_XANCP         L-VLDPHDPRLGALYPQALAWGFRRSGDLVYRPHCERCRACVPVRIAVDAFHPDRSQRRC
BPT_XANOR         L-VLDPHDPRLGAIYPQALAWGFRRSGDLVYRPHCERCRACVPVRIAVDAFHPDRSQRRC
BPT_XYLFA         L-VMDPNDPRLGAIYPQALAWGFRRSGNLLYRPHCEHCNACVPVRVNVNAFVPNRSQRRC
BPT_HALHL         E-FLSPTLRLNDHRYQLLLEQGFRRSGPYVYRPHCPGCKACQSLRIPVARFRPRRRHRRC
BPT_BURVG         Q-VATPSHLINSDIYTELVKAGFRRSGVFTYRPYCDGCRACVPVRVPVRAFTPSRTQRRM
BPT_BURPS         Q-VATPSHLINSDIYTELVKAGFRRSGVFTYRPYCDGCRACVPVRVPVDAFAPNRTQRRT
BPT_PARXL         Q-VATPSHLINSDVYTDLVKAGFRRSGVFTYRPYCDGCRACVPVRVPVDRFEPNRTQRRV
BPT_JANMA         Q-VATPSHLINADVYSELVKSGFRRSGIFTYRPYCDGCQACTPVRIKVADFIPNRSQRRA
BPT_BORPE         Q-VAAPGHLINAGTYSQLVEQGFRRSGLFTYRPHCDNCHACVPVRVDAARFEPNRTQRRA
BPT_ACIAC         Q-VATPSHLIQSDVYSDLVARGFRRSGMFTYRPYCDGCQACTPLRVLAGEFRPDRSQRRA
BPT_VEREI         Q-VATPGHLIQSDIYSDLVTKGFRRSGMFTYRPYCDGCQACTPLRIVVDGFRPDRSQKRA
BPT_POLSJ         Q-VATPSHLIHNDAYSELVTNGFRRSGMFTYRPYCDGCQACVPLRVPVKSFKADRSQRRA
BPT_NITEU         RIVVTDDTLSDSNTYAQLIQQGYRRSGSLIYRPDCDYCHACIPVRIPVELFDPNRTQRRI
BPT_PSEAE         L-FLDPSQPMDTQLYASLSEVGFRRSGDHLYRPHCQHCTACIAARIPVADFSPNRQQRRI
BPT_PSEPK         L-FLDPSQPMDVHVYADLSEMGFRRSGDHLYRPHCQNCNACVPARIPAARFIPNRQQRRI
BPT_HAHCH         M-FVDPKADINLDLYTRLSQLGFRRSGNHYYKPRCNGCNACIAVRIPTEEFNRTRSQERT
BPT_SACD2         V-FIDPEVSVDQNLYSQLTNYGFRRSGKHIYRPACKTCQACIPIRVDVETFTPNRSQQRC
BPT_ACIAD         V-FLDPIHRIDVVTLSELSRVGFRRSGDFVYRPECHLCRQCLSCRVPVHDFNMNSLQKKA
BPT_NITHX         V-FTHLVGEKAGELNDLLTHGGFRRSQSIAYRPACDQCRACVSVRVIAGEFRPSRNFRKV
BPT_NITWN         V-FTHLVGEKAGELNDLLTHGGFRRSQSIAYRPACDQCRACVSVRVIADEFQLSRGARRV
BPT_BRADU         V-FTHLVGDRAGDLNDLLTHGGFRRSQSIAYRPACDQCRACVSVRVIANEFRPSRNFRKV
BPT_AZOC5         V-FTHLVGERAGALNDVLTQGGFRRSQSIAYRPACEGCRACISVRICVDDFVPSRSFRRT
BPT_XANP2         V-FTHLVGDKAASLNDVLTQGGFRRSQSIAYRPACEGCKACVSVRICVDDFTPGRSFRRV
BPT_AGRVS         V-FTHLVGPRAPEMNDLLTQGGFRRSQNIAYRPACETCRACISVRIVAREFQPNRTMRRV
BPT_CAUVC         V-FAHLPLSDGPIVNDSLTQVGFRRSQNIAYRPACETCRACQSARAPATEYILSRSERKI
BPT_NOVAD         V-FTELKGANADELNDALGRIGFRRSQTVAYRPSCIDCQACVSVRVVTGEFRPSSTQKRI
BPT_SPHAL         V-FTELSGNNATELNDALGRIGFRRSQSVAYRPSCADCSACVSVRVCASEFAPSNSQKRT
BPT_PARDP         L-FTALAGDSANELNNALSRQGFRRSQNVLYRPSCESCVACMSARIRVSEFEPSRTQRRI
BPT_JANSC         L-FTALQGDQAETLNNSLSKQGFRRSQNVLYRPSCTDCAACLSARIRVADFAPRRGHKRI
BPT_RUEST         L-FTSLQGDGVEQLNNSLSQQGFRRSQNVLYRPSCSDCSACMSARISVADFKPTRSQRKT
BPT_HYPNA         A-FTNLAIPEADALHNVLSQSGFRRSQSIAYRPACTRCNACKSVRVATREYDISRNDRRV
BPT_MAGSA         I-VTELNGTDADSLHEALSRAGFRRSHSIAYTPACPGCSACIPVRIVADDFVPDRTMRRI
BPT_LEPIN         IQYFPFPEEISKEVLQFFFDSGFRRNGNILYRTSCCGCKDCLSYRIPLDQFVPSRNRKKL
BPT_LEPBL         IQYLPLQGKIEKDNLQFFFDSGFRRTGNILYRTSCNACRECLSYRVPLNQFVPSRNRKRL
BPT_CAMJE         IEYK-YIENCPKEINNELIKRGWRRFGRYFSRPICKDCDECLSLRILVNEYNFSRSERRV
A0RNS0_CAMFF      TMYR-YVSQCSFDYNSNLVKHGYRRFGSYFSKPICDGCDECKSIRIDAFNFKFTKSHRRI
D1B1S5_SULD5      MAYQ-YIENASMELNQALVERGWRRFGNYYSRPQCQGCVECLSLRIDVEKYHFSRSAKRT
A6QAZ0_SULNB      MHYK-YVEKANKQFATAVIARGWRRFGKYYFHPICNGCNECKSIRIDVNNYHYSKSQRRA
BPT_HELHP         FRYF-HIQNVTPSFYYGLLERGWRRFGNYFFTPMCEGCTDCISIRTLIDDFTFSRNHKRL
D3UJ04_HELM1      FRYF-YIEECSEYFYAGLLARGWRRFGECFFVPVCQSCDACKTIRQNIAQFIPSRIHRRI
Q1D9U3_MYXXD      LENL-VLEDVTPEEYEHLLVRGWRRFGLVYFRPACVGCNACVSLRIPVEGFRPNRSQRRA
H8MFH5_CORCM      LETL-LMRNVTAQEYEHLLVRGWRRFGPQYFRPACASCHECVSLRVPVAGFTPNRSQRRA
E3FRT0_STIAD      LEQK-LMTDVTPEELDAMLVRGWRRFGPIYFRPACRACSECITLRIPVETFQPNRSQRRA
M1NGD9_DESSD      FYQA-LFSPLSDRAMELFLASGYRRNGNCLYTMHCPDCSACVPIRLHPQEMKLNRNQRRV
Q6AJB2_DESPS      FHQA-FFAPLEEHVVGLFLAAGYRRNGNCLYTMRCPHCTACQPIRLQVEQFSPSRSQKRN
D6Z2A5_DESAT      YRQS-PCPPLSGEMFDDYLQAGFRRNGNIMYTMACPNCQACVPIRLAVRDFRPNRNQRRI
I4C3K1_DESTA      Q--VFAAEAFPPELYHDFMDIGFRRSGNYFYRPMCSSCLECRSIRVVLKEFRLSKSLRRI
Q7UET6_RHOBA      P-LYYPTPPRRSDDTDTLLAAGFRRSSQFVYHTNCPNCRACQPTRLRADDFQLTKSLRRV
C7LWG7_DESBD      S--FFFADGLNNIELSWFLSRGWRKFGHYFFRPACPDCRACTPLRVPVRRFLPSRGQKRV
                                       *:*:         *  *  * . *            .: 

BPT_PSEA6         LKR-NSDITVVLSEQ--DKAHYYSLYEKYINTRHQDGSMYPAT-------PEQYASFAHG
BPT_COLP3         KKR-NSHFIIKQSSQ--LKDSYYPLFENYINTLHQDGSMYPAS-------FQQFESFLSC
BPT_SHEON         LAH-NRDLTWRITTE--HTETQYALYEKYIRERHFDGPMYPPS-------KAQYEQFLFC
BPT_SHEPC         LAN-NRDLTWRITSS--QTDEQYTLYERYIRQRHFDGPMFPPS-------KEQYEQFLFC
BPT_VIBPA         LSK-AKSLRWEMKTE--MDAEWFELYSRYICKRHKNGTMYPPK-------RDEFSRFAQT
BPT_VIBVY         LAK-ARSLSWSMKRN--MDENWFDLYSRYIVARHRNGTMYPPK-------KDDFAHFSRN
BPT_VIBCH         LKLLSQEFHWQLKPE--LDEDWYTLYARYIFARHRHGSMYPPN-------KMEFAKFARA
Q6LT11_PHOPR      LNQ-MKKFRWEFKAK--LDEEWFPLYERYIRLRHSTGSMYPAN-------KEQFFEFCTA
BPT_XANCP         LAR-NQDLVVRVVAA-ERTEEQLALYRQYLQHRHPGGGMDTHG-------AAEFDQFLIG
BPT_XANOR         LTR-NQDLVVRVVAA-ERTDEQLALYRQYLKYRHPGGGMDEHG-------ATEFDQFLIG
BPT_XYLFA         LAR-NATLVTRIVPA-ERNAEQLSLYRRYLHQRHPDGGMDGHG-------AIEFDQFLIG
BPT_HALHL         QRA-NANLHVTACPP-VMTQEHLALYRRYIDHRHPRSSMANPD-------HAEAEGFLAA
BPT_BURVG         WKR-HRALVATVSPL-HYDEEHYALYMRYQSARHAGGGMDRDS-------RDQYEQFLLQ
BPT_BURPS         WKR-HRALVATVAAL-HYDEEHYALYMRYQSARHAGGGMDRDS-------RDQYEQFLLQ
BPT_PARXL         WKK-HGELIATVAPL-HYDEEHYALYMRYQSARHAGGGMDRDS-------RDQYEQFLLQ
BPT_JANMA         QAK-HSDLQTSVTKL-TYLAEHYDLYLRYQTARHAGGGMDQDS-------REQYAQFLLQ
BPT_BORPE         WRS-HQALRAFVAEL-AWSPEHYDLYTRYQQGRHPGGGMDEDS-------RTQYAQFLLT
BPT_ACIAC         WKQ-HSILQTRVLRL-CYEPEHYQLYLHYQRARHSGGGMDHDS-------IDQYTQFLLQ
BPT_VEREI         VAR-HGKLQTRVLRL-CFVPEHYQLYLRYQNGRHAGGGMDHDS-------IDQYTQFLLQ
BPT_POLSJ         WSR-HQGMQARVLKL-CFMPEHYQLYLRYQNGRHAGGGMDHDS-------IDQYTQFLLQ
BPT_NITEU         WKR-HQHLQIAWHPL-HFDPVHFDLYQRYQKSRHTNGSMDQDDEN----GRKQYRDFLLK
BPT_PSEAE         LKR-NAELQVIRKRP-SFNEEYYDLYRRYIEQRHADGDMYPPS-------RDQFATFLVR
BPT_PSEPK         LKR-NADLTVTAARP-AFKEEYFELYRRYIETRHADGDMYPPS-------RDQFSTFLVR
BPT_HAHCH         WKR-NSDLTVRLRSA-QFEQEHFALYQRYISARHQDGDMYPPT-------LDQYESFLLE
BPT_SACD2         LRK-NKDLTVTVVST-IDTDEHYTLYAKYIERRHSDGDMYPPK-------RDEYRSFLSA
BPT_ACIAD         WKR-NQDLRMSIVPTHAATSVHYQLYERYINERHADGDMFPPS-------LDQFEKFLVH
BPT_NITHX         LAR-NADIVSQLRAA-TPTSEQYSIFRAYLDQRHRDGGMADMT-------VLDYAMMVED
BPT_NITWN         LAR-NADITGSLRAA-TPTSEQYSIFRAYLDQRHRHGGMADMT-------VLDYAMMVED
BPT_BRADU         IAR-NADIIGEQRSA-VPTSEQYSVFRAYLDARHRHGGMADMT-------VLDYAMMVED
BPT_AZOC5         LKE-NEDLIGALRPP-SPTSEQYGLFRSYVTSRHGSGGMADMS-------VLDYAMMVED
BPT_XANP2         QAD-NSDLIGQIKPA-TPTSEQYALFRSYVTGRHGTGGMADMS-------VLDYAMMVED
BPT_AGRVS         AGV-NADLTSSVFAA-QPSTEQFSLFRTYLDHRHQQGGMSDMS-------ALDFAIMVED
BPT_CAUVC         LGR-NDDLERHLVEA-EATLEQFELLRRYLLTRHADGGMAEMT-------WPDYVAMVED
BPT_NOVAD         HKR-NRDLEVSICKA-WSTPEQFELLQRYLAVRHPGGGMAAMD-------EMDFADMVEH
BPT_SPHAL         LRR-NGDLVVTACKP-WATEEQYALLRSYLASRHPDGGMADMD-------EQDFADMVEQ
BPT_PARDP         ARR-NAHLRRLATSA-WATEEQYELFRAYLDERHADGGMADMD-------IFEFAAMIEE
BPT_JANSC         SRR-NEHLFRNPRSA-WATEEQYALFRTYLDTRHADGGMADMD-------VFEFAAMIEE
BPT_RUEST         LNR-NRHLDRRATSP-WATEDQYALFRDYLDQRHADGGMADMD-------VFEYAAMVEE
BPT_HYPNA         IAR-NAHLVRRPVAA-QATREQFRLLKSYVVTRHDNGGMSDMT-------YRDYVAMVGG
BPT_MAGSA         WRA-NGGLTASKVPA-RASADQFRLFARYQESRHSGGDMALMG-------FYDYRSMVED
BPT_LEPIN         LKK-NSDLKICFESP-NLTLEKEILYLRYQRSRYQNFVIEESDQ----ELLEGMRWNLFE
BPT_LEPBL         LKK-NSDLVVRFGSP-HLTVEKEILYLRYQRSRYQSFVIGESDQ----ELLEGMRWNLFG
BPT_CAMJE         VNK-NINTKVILRTP-NLSNEHLFLYDKYHRFMEEKKNWKRYDL----SFKQYYNLYVDG
A0RNS0_CAMFF      INK-NSNTKIVVSKP-YISQRHIDLYEKYHKFMHEKRGWEYYNL----DFRRYYSVYVEG
D1B1S5_SULD5      FKK-AEGISYVIQAP-TMSTQHLELYDKYHRFMEQKRGWHYYYL----KPQSYHELYVSG
A6QAZ0_SULNB      IKR-NKDTQILVQEP-SLTTSHLELYNKYHAFKHQKDGWSHRNI----TQREYSENFVEG
BPT_HELHP         LKK-AQNIDIYIQKP-TITQAHIELYNRYHRVMRDKKGWEYTPT----TPESYMDMFVEG
D3UJ04_HELM1      IRK-NQDLEVILQKP-SFSEEKLQLYNKYHRVMEEKKQWHYKSV----DERYYYDTFVAG
Q1D9U3_MYXXD      RAA-CAHLRVEVGPP-RVDDARLALYRQWHSEREAVREWEPSPI----TAREYSLQFSY-
H8MFH5_CORCM      RAA-CAHLRVEVGPP-RVDEERLALYRAWHANRESSRDWEASEL----GAREYSLQFAF-
E3FRT0_STIAD      RTA-SARFRVEVGTP-RVDAERLALYHAWHGWREQAREWESSEL----SEREYFLQFAF-
M1NGD9_DESSD      LKK-NQDIEVEFAPI-TASEENIRLCEKFLRSRYPHKYND---------GKSYYKGFFLN
Q6AJB2_DESPS      RKK-NDDIAASFLPL-VRSQEHLDLCDRFLQNRYPSD-NS---------AERYYADFFEN
D6Z2A5_DESAT      WRR-NQDVRVSQGPL-QLSAEKLELCERFLACRYPDQECVPGSEGVDGRAVDYYGGFFLN
I4C3K1_DESTA      LRK-NLDVTVSIDAP-RFSRNKYRLYQYYLHSRHAATGADSFT---------SVRKSLYA
Q7UET6_RHOBA      LKKAERELTWSWQTP-RVDADRVRLYNDHRNLRGLAHDGDISA--------SDYETFLIA
C7LWG7_DESBD      LRR-CSHLRVSFGPV-RYEKELFDLYHTHSQVRFGQESSF-----------DEFIANLHS
                                          :                                   

BPT_PSEA6         DWLDPLYIELHLSG--------------ELVGIAVTDALENALSAVYTFFEPSLAERS-L
BPT_COLP3         NLTQQLFIETWAPANEENG-----PKEDKLVCVAVTDVLSNGLSAVYTFYHPDYKANG-L
BPT_SHEON         HWLPPTFIEVYDDN--------------RLVAVAVTDTLPNSFSAIYSYFDPDEERRS-L
BPT_SHEPC         HWLPPTFIEVYANN--------------KLIAVAVTDTLPNSLSAIYSYFDPDEAHRS-L
BPT_VIBPA         TWLTTLFLHIYDESN-------------QLLGVAVTDVMAQCSSAFYTFFEPDY-PLS-L
BPT_VIBVY         QWLTTQFLHIYE-GQ-------------RLIAVAVTDIMDHCASAFYTFFEPEH-ELS-L
BPT_VIBCH         KWLNTQYLHLYQ-GE-------------KLVAIAVTDLLPNSASAFYTFYDPDI-SIS-L
Q6LT11_PHOPR      EWMDTLFLHVYD-DD-------------KLIAIAVTDVFENALSAVYSFFEPDS-TLS-L
BPT_XANCP         GWSHGRFLEIREPAVDH--------VPGRLLAVAVTDVTEHALSAVYTFYAPDAAARS-L
BPT_XANOR         GWSHGRFLEIREPAIAH--------LPGRLLAVAVTDVTEHALSAIYTFYAPEAAARS-L
BPT_XYLFA         PWGYGRFMEIREPATNG--------TPGQLLAVAVTDLTHQALSAVYTFYEPNAAARG-L
BPT_HALHL         PWCTTVFYELRTEA------------QGSLLAVAVTDVLPDALSAVYTFYAPEAEHRG-L
BPT_BURVG         SRINSRLVEFRDLDASG-------GEPGKLRMVSMIDILGDGLSSVYTFFEPDDAHTS-Y
BPT_BURPS         SRINSRLVEFRDLDPAE-------NGASTLRMVSMIDILGDGLSSVYTFFDPDESHAS-F
BPT_PARXL         SRINSRLVEFREPPREWPEQPERPDAPGILRMISMIDILGDGLSSVYTFFEPGLPHTS-F
BPT_JANMA         SKVNTRLVEFRE-------------DDGTLRMVSIIDVLDDGLSSVYTFYDPEPPNAS-Y
BPT_BORPE         TRVNTRLVEFRAP-------------QGQLAMISIIDVLDDGLSSVYTFYDPDMA-GS-L
BPT_ACIAC         SRVNSRLVEFRDPAPDG-----ETG---TLRMVSILDVLDDGLSAVYTFYDPDPD-CS-Y
BPT_VEREI         SRVNSRLVEFREVDDTG-----ATGGPGVLKMVSLLDLLDDGLSAVYTFYEPEPR-CS-Y
BPT_POLSJ         SRVNSRLVEFRESLPNG-----EAG---ALKMVSILDVLEDGISAVYTFYEPDTR-AS-Y
BPT_NITEU         STVDSFLVTFHENE--------------QLRMVSIIDRLPDGLSPVYTFFEPDVPGSS-Y
BPT_PSEAE         DLPFCCFFEFR--------------LHGRLLAIAVTDVLPNGLSAVYTFYDPDEEQRS-L
BPT_PSEPK         DLPFCWFYEFR--------------LEGRLMAVAVCDLLPNGLSAVYTFYEPDEERRS-L
BPT_HAHCH         ARSETLFIEFR--------------KDSKLLAIAVTDRTTDGLSAIYTFFDPNEDKRA-L
BPT_SACD2         QWGVTKYLEFRN-------------SENSLIGVAVADQLKNGISAVYTFFDPNEQKRS-L
BPT_ACIAD         SCTESFFLELW--------------KDDRLICVSTCDLMDDGLSAVYTFFDPDENRRS-L
BPT_NITHX         SHVETRIIEYRRRGADSDI---NERGD--LVGVALTDVLSDGLSMVYSFFEPSEQNRS-L
BPT_NITWN         SHVETRIIEYRRRGADRVD---NKRGD--LVGVALTDVLSDGLSMVYSFFDPSEQNRS-F
BPT_BRADU         SHVETRIIEYRKRGPDSGI---TGRGEE-LIAVALTDVLSDGLSMVYSFFEPSQVSRS-M
BPT_AZOC5         THVQTRLVEYRRRGPDSRI---NGRGTGDLFAVALTDILGDGLSMVYSFYNPNIPERS-L
BPT_XANP2         THVHTRLVEYRKRGPDSRI---IPRGTGDLMAVALTDVLTDGLSMVYSFYNPQVHDRS-L
BPT_AGRVS         SHVKTKVIEYRLPKVDEDS---DRPGE--LVAVALSDILSDGLSMVYSFFNPAMEKRS-L
BPT_CAUVC         TAVRTHLIEYRRKSLDR------GPGD--LVACVLVDVLADGLSLVYSFYEPDQPRRS-L
BPT_NOVAD         TPVKSYVIEYREPTVDG------SQGR--LVGACLTDEQGDGLSMIYSFYDPQHETRSGL
BPT_SPHAL         TPVDSYMIEYREPVAGG------GKGR--LVGCCLTDRQGDGLSMIYSFFDAHHPLREGL
BPT_PARDP         TPVRTRVIEYRAHQGDSSEIP-PPPDSDQLVAVCLTDVLDDGLSLVYSFYDPALEGFS-L
BPT_JANSC         TPVKTRVIEYRDRT-----------DGDDLAAVCLTDILDDGLSLVYSFFAPELQKNS-L
BPT_RUEST         TPIRTRVVEYTDLD------------TNALTAVSLTDVLEDGLSMVYSFYAPNLPQNS-L
BPT_HYPNA         SPVQSLIFEYRDGP----------EPDAPLVAAAITDVLRDGLSMVYTFFDPAKTSQS-L
BPT_MAGSA         SPIDTFIVEFRDGDGN-------------LAAACLADRMNDGLSAVYSFFDPDLASRS-L
BPT_LEPIN         YKENSLEMTLSLDG--------------KILCFMILDFASDSLSAVYSVYDPDYPDRS-L
BPT_LEPBL         YPENSLEMTLSLDE--------------KILGFMILDSASDSLSAVYSVYDPDYPDRS-L
BPT_CAMJE         FMNFGYELAFYIED--------------KLVCVDLIDILEDGISSIYCFYDPDFSYFS-L
A0RNS0_CAMFF      AGDFGYEIDYFVND--------------ELVCVDLVDIVDDGISSIYCYWDIDFAHLS-L
D1B1S5_SULD5      SHNFGKEILYFQGQ--------------KLIGVDLIDFLDNGISSIYFYYDPDFAHLS-L
A6QAZ0_SULNB      AQDFGKEVLYIVDG--------------KLVGVDLIDILDDGISSIYFYYDPDYAHLS-L
BPT_HELHP         HQDFGYEILYFIDS--------------QLVGVGLVDALFDSITAVYFYYDHTFAHHS-L
D3UJ04_HELM1      GRNFGYELNYFLDG--------------ILLGVGYVDILEDLISAIYFFYDHDFEKRS-L
Q1D9U3_MYXXD      PHPSAREVAWYDDGAEGGP---------RLVGVGICDETPRAWSAVYFFYDPAYAHLS-L
H8MFH5_CORCM      PHPSAREVAWYDDSDPSGP---------KLVGLGLCDETPHAWSAVYFFYDPAYARLS-L
E3FRT0_STIAD      PHPCARELAWYDDAAEGGP---------RLIAVGICDETPSAWSAAYFFFHPDYAHCS-L
M1NGD9_DESSD      RIIPGMEFRFRLRG--------------RLVGTGIVDVGQNWMNAVYFYFDPDEASRS-L
Q6AJB2_DESPS      GLTHTEQLEFRQGG--------------RLLGNAIVDHGEHWLNAVYFFFDPEESGRG-L
D6Z2A5_DESAT      SITDTWEIAYRVEE--------------RLLGLAVVDIAPTALNAVYFYFDPDQAHRS-P
I4C3K1_DESTA      SPVHTVEFEYRLGL--------------RLIGAGLVDVCSRSLSSVYMFFDPDLANRS-L
Q7UET6_RHOBA      SCWPTLELEIRHQD--------------QLVGVSIMDIGRDSISAVYTHFDPIASKFS-L
C7LWG7_DESBD      SPCPNLLARYEENG--------------RLLGAGYLDVGSDGLSSVYFVFDPAASPLS-P
                                               :      *      .  *  :          

BPT_PSEA6         GTFAVLQQISIAKRLNKQHLYLGYQIDNCQKMQYKRNFLPHERFIEQKWQLISKKDW---
BPT_COLP3         GVFSILTQLSLSQQMSLPYLYLGYQIDECQKMNYKDRYFPFERFIDGQWLINTKPSVNKA
BPT_SHEON         GVLLILLQCRLAKLQGKAFLYLGYQIDANRKMSYKRLYRPYQILTHQGWEYSQVC-----
BPT_SHEPC         GVLLILIQCRLAKLQRKEFLYLGYQIDANRKMSYKRLYRPYQILTPQGWEYS--------
BPT_VIBPA         GTLAVLYQVNYCQQNNEQWLYLGYQIDECPAMNYKTRFQRHQRLVNQRWQG---------
BPT_VIBVY         GTLAVLFQLEYCQEEKKQWLYLGYQIDECPAMNYKVRFHRHQKLVNQRWQG---------
BPT_VIBCH         GTLAVLCQLNYCQQTKKQWLYLGYQIDECPAMNYKVRFNPHQRLVNQRWRG---------
Q6LT11_PHOPR      GTLCVLYQIQYSQQTGRKWLYPGYQIDDCKAMNYKVRFQPHQKLILGDWQ----------
BPT_XANCP         GTFAILEQIQWARRERRAHLYLGYWIEGHAKMNYKRRFNALEAYDGRHWRGLPAAQGSAR
BPT_XANOR         GTFAILQQIQWAQRERRAHVYLGYWIEGHAKMNYKRRFSALEAYDGRHWCDLPAHPSGT-
BPT_XYLFA         GTLAILHQIHWAQREQRPYLYLGYWIKDHFKMDYKRRFQKLEIYDGYRWRPFSTTYPTTH
BPT_HALHL         GNLAVLWQLSEARRLGAQHLYLGYWIADAPAMAYKASFRPHEIFDGRGWRAQE-------
BPT_BURVG         GTYNILWQIEQARSLGLPYVYLGYWIRESPKMAYKANFHPLEGLLDGRWKTLDPARVDLP
BPT_BURPS         GTYNILWQIEQAKSLRLPYVYLGYWIRESPKMAYKANFHPLEGLVDGRWKVLDPTLADLP
BPT_PARXL         GTYNIYWQIEQARSLKLPYVYLGYWIRESPKMAYKANFHPLEGLIDGAWRVLDPTGLDLP
BPT_JANMA         GTYNILWQIAQAKALQMPYIYLGYWIKESPKMSYKTNFQPLEALQQGEWT-------PLP
BPT_BORPE         GTYSILWQIEQCRTLDLPWLYLGYWIADSRKMAYKANFRPLQMHVDGAWR-------ETP
BPT_ACIAC         GTFNVLWQIEQARTLGLAHVYLGYWIAESAKMNYKSRFHPHELRVHGEWQ----------
BPT_VEREI         GTYNVLWQIAQARALSLPHVYLGYWIAVSPKMNYKAGFHPHEILTDGRWH----------
BPT_POLSJ         GNYSVLWQIEQARRLELPYVYLGYWIAQSPKMNYKAGFKPHEILVNGQWT----------
BPT_NITEU         GTFNILWQTAQCRADRLPYLYLGYWIANSRKMHYKANFQPLQYLIDNQWQ---------Y
BPT_PSEAE         GRYAILWQIAETERLGLQAVYLGYWIKNCRKMNYKTQYRPIELFVNQRWVALT-------
BPT_PSEPK         GRFAILWQITEALRQNLEAVYLGYWIKNCKKMNYKTQYRPIELLINQRWVTLN-------
BPT_HAHCH         GVYAILWQLQFAREQRLPYLYLGYWIRGCRKMSYKTNYRPIQVLVRDSWITI--------
BPT_SACD2         GVYAVLAQIEWAQKQSNRYVYLGYWIKECQKMSYKTLYKPFELFINNQWLTFI-------
BPT_ACIAD         GVFAILKQLEYVKSIDLDYLYLGYWVPHSQKMNYKSQYIPLELLLDGQWRRLNRALSQEE
BPT_NITHX         GTFMILDHISRARQLGLPYVYLGYWIEGSRKMDYKGRFMPQQRLAPTGWLRVDAKDESQH
BPT_NITWN         GTFMILDHISRARQLGLPYVYLGYWIEGSRKMDYKGRFLPQQRLAPTGWLRVDADGETKH
BPT_BRADU         GTFMILDHIARARRQGLPYVYLGYWIEGSKKMDYKARFLPQQRLAPSGWLRIDAQGDAAS
BPT_AZOC5         GTFLILDHIAKAKEMGMPYVYLGYWVNGSRKMDYKRRFLPQERLSPHGWERVDE------
BPT_XANP2         GTFLILDHITRARQMGLPYVYLGYWVQGSRKMDYKRRYLPQERLTPHGWERVEK------
BPT_AGRVS         GTFMVLDHIRRANEMGLPHVYLGYWVNGSRKMGYKIRFLPQEHLLSQGWTRYEPESGVEE
BPT_CAUVC         GSFIILDHIVQAQQNALPYVYLGYWVPGSEKMAYKARFSPLEILKPGGWSLMSARERGAR
BPT_NOVAD         GTFIILDHIQRAARAGLPYVYLGYWVEGSERMQYKVRFRPMEKLGRDGWERFEPAEQASA
BPT_SPHAL         GTYIIADHVLRAAKAGLPYVYLGYWIEGSARMAYKARFRPLEKLGPDGWSRFEPTPSER-
BPT_PARDP         GTHIILDHIDLARSAGLPFVYLGYWVPGSRKMDYKAKFSALEIYKGGVWQPIGDPAQHTS
BPT_JANSC         GTYVILDHIALAQEAGLPYVYLGYWVPGSTKMGYKASFPALEVHVNGDWQDIGDPADYDT
BPT_RUEST         GTFMVLDHIEIAREAGLPYVYLGYWVPGSQKMGYKAKFSGLEVYFGGEWTPLKDPESFTA
BPT_HYPNA         GHYLILDHIRHAHDLGLPHLYLGYWVKGSPKMDYKRRYKPLEVLDGDRWRPLRDDE----
BPT_MAGSA         GTFMVLWLVEEAKRMALPFVYLGYWIGESRKMSYKTRYQPLEAFGPDGWKRFAPGDGA--
BPT_LEPIN         GSFAILSSILYAKELGMKYFHLGYFLPGHPNMDYKKYWTPAQIREPVSNENRWIETDDFQ
BPT_LEPBL         GSFAILYSILYAKELGMKYYHLGYFLPGHPDMDYKKHWVPSEIRELDTND--WIPFEEFQ
BPT_CAMJE         GKFSLLNEIQIAKKMNLDYIYLGYFVKKCQSLSYKADYTPNEILKGTKELFENEV--LWE
A0RNS0_CAMFF      GKFSLLNQITIALKNDLRWIYLGFYVKDCASLAYKGEYKPYETLKTYCDIDEKP---IWE
D1B1S5_SULD5      GRLSIYEQILLGKEYNLKWIYLGYYVKECQSLTYKATYTPYEILQGLPELNEEA---IWR
A6QAZ0_SULNB      GTFSLLYQIKLAKILELPWIYLGYWVEGCKAFAYKPKFQPQEILDGFPHISQIPDWEPWD
BPT_HELHP         GTLNILKQIQIGKENGLKYFYPGYWIKDHYCMGYKQRFTPFEVLKNIPDVFEAPIWEMYN
D3UJ04_HELM1      GVFNILTQFHIARQRGIPYFYPGYWIEGHPSLGYKSKFKPFEILCNQPDLFDVPDYKPFR
Q1D9U3_MYXXD      GTANVLHQVELAKARGIPHVYLGYRVLACASLRYKGAFRPHELLEERPALDAAPQWVAPP
H8MFH5_CORCM      GKASVLFQVELARERGIPYVYLGYRVLACDSLRYKAGFRPHELLEGRPALDAPPEWRAAA
E3FRT0_STIAD      GTANVLKQVEIAQARGIPHVYLGYRVQGCASLRYKGLFRPHELLRGSPGPEETPDWTSAE
M1NGD9_DESSD      GTFNILSMIETCLKLDISYLYLGYYIEEVAAMNYKRRFDPHYLYLDDGWRKIDKLT----
Q6AJB2_DESPS      GTYNVLRLIDFCRERGIIYLYLGFYIRDVQAMNYKDTFRPYQLLEDGVWCSYSGASSRDL
D6Z2A5_DESAT      GILNILSLIQLCRQVKLEHLYLGYWIKEVPAMSYKSRFKPHQLLLDGHWQTITRN-----
I4C3K1_DESTA      GTFAAIQEILFALQLNIPFYYLGFFVADCKAMNYKARFKPHEYLDQTFVWRGSAEETW--
Q7UET6_RHOBA      GTFAVLQQIQWAKDNGRTWVYLGLYVAENPHLNYKSRFVPQERLIDGQWRVCLE------
C7LWG7_DESBD      GIFSVLREIEETKKRGLSHYYLGYVVPGCERMAYKAGFNPHQVFSWEDGLWREAGKEPES
                  *                   : *  :     : **  :                      

BPT_PSEA6         ---------------------------------------
BPT_COLP3         KIAK-----------------------------------
BPT_SHEON         ---------------------------------------
BPT_SHEPC         ---------------------------------------
BPT_VIBPA         ---------------------------------------
BPT_VIBVY         ---------------------------------------
BPT_VIBCH         ---------------------------------------
Q6LT11_PHOPR      ---------------------------------------
BPT_XANCP         ---------------------------------------
BPT_XANOR         ---------------------------------------
BPT_XYLFA         TL-------------------------------------
BPT_HALHL         ---------------------------------------
BPT_BURVG         PVDAALARAPLPGGHSGAG--------------------
BPT_BURPS         PVDAALARAPLPGGHSGTR--------------------
BPT_PARXL         PVDLAIHGKRPPFKP------------------------
BPT_JANMA         VVDPAATR-------------------------------
BPT_BORPE         P--------------------------------------
BPT_ACIAC         RGT------------------------------------
BPT_VEREI         RVDMPL---------------------------------
BPT_POLSJ         PSDAATRRPKTD---------------------------
BPT_NITEU         RTTNR----------------------------------
BPT_PSEAE         ---------------------------------------
BPT_PSEPK         ---------------------------------------
BPT_HAHCH         ---------------------------------------
BPT_SACD2         ---------------------------------------
BPT_ACIAD         ISQLGESLMTILPSEWNSMIIK-----------------
BPT_NITHX         ESRD-----------------------------------
BPT_NITWN         ETTE-----------------------------------
BPT_BRADU         EPQD-----------------------------------
BPT_AZOC5         ---------------------------------------
BPT_XANP2         ---------------------------------------
BPT_AGRVS         ---------------------------------------
BPT_CAUVC         PPRGPGALKDACDLPLSDAQPADIEDLD-----------
BPT_NOVAD         IERAVTARKCEPASLVEGSLKDGVHGAQERYAHI-----
BPT_SPHAL         -----IAAMFELA--------------------------
BPT_PARDP         DIHPLSIDPIVEQVARINLPSNRR---------------
BPT_JANSC         QTHPLSTDPIAQQVAQITLPDLRGENGRSDGLRGFSDGP
BPT_RUEST         EDHPLSTAPVAEQVANIQLPQGTSPKKR-----------
BPT_HYPNA         ---------------------------------------
BPT_MAGSA         ---------------------------------------
BPT_LEPIN         KRYSDFSW-------------------------------
BPT_LEPBL         KKYADFSW-------------------------------
BPT_CAMJE         K--------------------------------------
A0RNS0_CAMFF      F--------------------------------------
D1B1S5_SULD5      ---------------------------------------
A6QAZ0_SULNB      NP-------------------------------------
BPT_HELHP         G--------------------------------------
D3UJ04_HELM1      SIDDQ----------------------------------
Q1D9U3_MYXXD      EEA------------------------------------
H8MFH5_CORCM      ADVPDAAADAPAPERVGPEAVLRSR--------------
E3FRT0_STIAD      ---------------------------------------
M1NGD9_DESSD      ---------------------------------------
Q6AJB2_DESPS      SRK------------------------------------
D6Z2A5_DESAT      ---------------------------------------
I4C3K1_DESTA      ---------------------------------------
Q7UET6_RHOBA      ---------------------------------------
C7LWG7_DESBD      PSPGILHPFSG----------------------------