CLUSTAL format seed alignment for MF_00691

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PXPA1_AGRFC      -----------MAAIDLNSDLGESYGAWRMGD--DEAMLAIVSSANIACGFHAGDPAGIY
PXPA3_PSESM      -----------MRAIDLNSDLGESFGAWSMGD--DAAMLDIVTSANVACGFHAGDPAGIL
PXPA_STRAW       -------------MIDLNADLGEGFGRWELTD--DERLLSVVTSANVACGFHAGDAATMR
PXPA_STRCO       -------------MIDLNADLGEGFGRWTLTD--DDALLSVVTSANVACGFHAGDPSVMR
PXPA_MYCLE       -----------MACIDLNADLGEGFGVWRLGD--DEAMLRIVTSANVACGFHAGDPAGLL
PXPA_COREF       --------MNPPHSIDLNSDLGESYGSWVMGN--DEAVLDLVSSANIACGFHAGDATVLL
PXPA_CORGL       -----------MTTIDLNSDLGESYGSWVMGN--DVAVLDLVSSANIACGFHAGDATVLF
PXPA2_PSEAE      --MNN---------LLLNCDIGESFGAWRMGL--DAEVMPLIDCANIACGFHAGDPGTMR
PXPA2_PSEPK      --MHNDKGDRVVERLLLNCDMGESFGSWRMGL--DAEVMPYIDCANIACGYHAGDPGIMR
PXPA3_PSEAE      --MNDTG-----RRILLNCDMGESFGAWRMGD--DVHSMPLVDQANLACGFHAGDPLTMR
PXPA_VIBVU       --MNKQR-------VTLNCDMGESFGNWKMGS--DELVMPWVDMANIACGFHASDPSVMS
PXPA_VIBCH       --MSKRT-------IQLNCDMGESFGVWTMGA--DEEVMPWIDMANIACGFHASDPHVMS
PXPA_VIBPA       MTLNKQQ-------LTLNCDMGESFGSWKMGA--DDSVMPHVDMANIACGFHASDPNVMH
PXPA_DEIRA       --MTTTL------TTDLNADAGESFGHWPLGD--DARLFPLLTSVNLALGFHAGDPVTLH
PXPA_BACAN       -----------MTTIDLNCNLGESFGAYKMGN--DDEILPFVSSINVACGFHAGDPSVMR
PXPA_BACCR       -----------MTTIDLNCDLGESFGAYKMGN--DDEILPFVSSINVACGFHAGDPSIMR
PXPA_BACSU       -----------MFQIDLNCDLGESFGAYKIGL--DQDILEYVTSANIACGFHAGDPSVMR
PXPA_BORPE       ----------MNPAIDLNCDMGESYGAWRMGN--DEAVLQFVTSANIACGFHGGDPSTMR
PXPA_ECOLI       ------------MKIDLNADLGEGCAS-------DAELLTLVSSANIACGFHAGDAQIMQ
PXPA_SHIFL       ------------MKIDLNADLGEGCAS-------DAELLTLVSSANIACGFHAGDAQTMQ
PXPA_ECO57       ------------MKIDLNADLGEGCTS-------DAELLTLVSSANIACGFHAGDAQTMQ
PXPA_ECOL6       ------------MKIDLNADLGEGCAS-------DAELLTLVSSANIACGFHAGDAQTMQ
PXPA_SALTI       ------------MNIDLNADLGEGCAS-------DSELLTLVSSANIACGFHAGDAQTML
PXPA_SALTY       ------------MNIDLNADLGEGCAS-------DSELLTLVSSANIACGFHAGDAQTML
PXPA_YERPE       ------------MKIDLNADLGEGCAN-------DQALLQLVSSANIACGFHAGDAQTMR
PXPA1_RALSO      -----------MTAIDLNADLGEGCDN-------DEALLALVSSANIACGWHAGDVNTMR
PXPA_HAEIN       -----------MKKIDLNADIAEGFPF-------DESLLQLLSSANVACGLHAGGAKEMQ
PXPA_NEIMA       -----------MKQVDLNADLAEGCGS-------DEALLQLITSANIACAQHAGSIADIR
PXPA_BACHD       -----------MQRVDLNSDLGESFGAYTIGQ--DDRVLEHVTSANIACGYHAGDHNVMA
PXPA_OCEIH       ----------MQYQVDLNSDIGESYGAYTIGQ--DDEVMEFITSANIACGYHAGDHNIIH
PXPA_STAAM       ------------MRVDLNCDLGEAFGNYSFGG--DHQIIPLITSANVACGFHAGDENVMN
PXPA_STAAW       ------------MRVDLNCDLGEAFGNYSFGG--DHQIIPLITSANVACGFHAGDENVMN
PXPA_STAES       ----------MKLKIDLNCDLGEAFGNYTFGG--DQHILPLITSANIACGYHAGDEDVMN
PXPA_CAMJE       -----------MFKVDLNSDLGESFGAYKMGM--DEEILKFVSSVNVACGFHAGDPCVMD
PXPA_FUSNN       ----------MKFFVDLNSDIGEGYGAYKLGM--DEEIMKCVTSVNCACGWHAGDPLIMD
PXPA_PYRAB       ------------MRVDLNSDLGESFGRYKLGL--DEEVMRYITSANIACGWHAGDPIVMR
PXPA_PYRHO       ------------MRVDLNSDLGESFGRYKLGL--DEEVMKYITSANVACGWHAGDPLVMR
PXPA_PYRFU       ------------MKVDLNSDLGESFGRYKLGL--DDEVMKYITSANVACGWHAGDPLVMR
PXPA_CALS4       -----------MYRVDINSDIGESFGAYKIGM--DEEVVKYISSANIACGFHAGDPMVMA
PXPA2_BRADU      -----------MKTIDLNCDLGEGFGAWEMGN--DAAMIELASSVNVACGFHAGDPDIMR
PXPA2_AGRFC      ------------MKIDLNSDMGEGFGPYRLCD--DEAMMKIVSSANIACGFHGGDPDTMA
PXPA1_BRADU      ------------MKIGINSDMGEGFGNYRICD--DEALMSIVSSANVACGFHAGDPIIMD
PXPA1_PSESM      ------------MRIDLNADLGEGFGAWTMGE--DEALMQLISSANVACGFHAGDPLIMD
PXPA2_RALSO      ------------MEIDLNADLGEGYGPWRMGD--DEAMMSLISSANIACGFHAGDPLIMD
PXPA1_PSEPK      -----------MQAVDFNSDMGEGFGPWTIGDGVDNELMGYISSANIATGFHAGDPGTMR
PXPA2_PSESM      ------------MQIDFNSDMGESFGAWTIGDGVDTELMAFISSANIATGFHAGDPSTMR
PXPA1_PSEAE      -----------MTEVDLNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDPSSMR
                                 :*.: .*.          *   .      * * . *...   : 

PXPA1_AGRFC      RTVKAAAEKGVVVGAHVSYPDRVGFGRRDLD-ATSEELIADVIYQIGALKGVAAAAGTTV
PXPA3_PSESM      RTLKAAAAKNVTIGAHVSYPDKVGFGRRNMD-VASDELTADVIYQIGSLQGLAKAAGTSV
PXPA_STRAW       RVCELAAERGVRIGAQVSYRDLAGFGRRAMD-VPPAELAAEVAYQIGALEVFARAAGTRV
PXPA_STRCO       RVCDLAAERGVRIGAQVSYRDLAGFGRRAMD-VPSDELAAEVAYQIGALRVFAEAAGAPV
PXPA_MYCLE       RVCRLAAERGVRIGAQVSYRDLVGFGRRFID-VTADDLLADVVYQIGALQAIAQTAGSAV
PXPA_COREF       KTVVAAKARNVRIGAHIGYNDLTGFGRRAME-YDHEVLVAETIYQIGAIQAAATTVGATV
PXPA_CORGL       KTVRAAHARHVRIGAHIGYNDIAGFGRRNLD-IAHDDLVAETIYQIGAIQAAAKASGAVV
PXPA2_PSEAE      RTVALAVEHGVRIGAHPGYPDLVGFGRRSLA-CSAQEVEDLLLYQIGALDGLCRAQGTRV
PXPA2_PSEPK      RTVTLALEHGVTIGAHPAYPDLVGFGRRSMA-CSPEEIRDLLHYQIGALDGICKVLGGRV
PXPA3_PSEAE      RAVELAVRHGVSIGAHPAYPDLSGFGRRSLA-CSAEEVHAMVLYQIGALDAFCRSLGTQV
PXPA_VIBVU       KTVALAKHYKVKIGAHPGYQDLVGFGRRSIP-HTPAQISEIVLYQVGALKAVCQYHDVPL
PXPA_VIBCH       RTIDLALEHEVMIGAHPSYPDLQGFGRRSLA-MNEQEVSEIILYQVGALKALCESKNGQL
PXPA_VIBPA       DTITLANLHDVDIGAHPGYPDLQGFGRRSLS-MSSDEITNMVIYQVGALQALCRAQYTDI
PXPA_DEIRA       SAVRLARQHGLGIGAHPGYPDLVGFGRRELA-LTPLEIQAATLYQIGALQAFLTVEGGTL
PXPA_BACAN       QTVEKAMQHNVAIGAHPGFPDLIGFGRRNMN-VSANEVYDYVLYQIGALDAFVKAAGGKM
PXPA_BACCR       QTVEKALEHNVAIGAHPGFPDLIGFGRRNMN-VSASEVYDYVLYQTGALDAFVKAAGGKM
PXPA_BACSU       KTVALAAERGVKMGAHPGLPDLLGFGRRNMA-ISPEEAYDLVVYQIGALSGFLKAEGLHM
PXPA_BORPE       QTVAAALAHGVALGAHPSLPDLAGFGRRAMQ-ITPQEAYDLVVYQVGALAGVAASQGARL
PXPA_ECOLI       ACVREAIKNGVAIGAHPSFPDRENFGRSAMQ-LPPETVYAQTLYQIGALATIARAQGGVM
PXPA_SHIFL       ACVREAIKNGVAIGAHPSFPDRENFGRSAMQ-LPPETVYAQTLYQIGALATIARAQGGVM
PXPA_ECO57       ACVREAIKNGVAIGAHPSFPDRKNFGRSAMQ-LPPETVYAQTLYQIGALATITRAQGGVM
PXPA_ECOL6       ACVREAIKNGVAIGAHPSFPDRENFGRSAMQ-LPPETVFAQTLYQIGALAAITRAQGGVM
PXPA_SALTI       TCVREALKNGVAIGAHPSFPDRDNFGRTAMV-LPPETVYAQTLYQIGALGAIVQAQGGVM
PXPA_SALTY       TCVREALKNGVAIGAHPSFPDRDNFGRTAMV-LPPETVYAQTLYQIGALGAIVQAQGGVM
PXPA_YERPE       QSVRWALEYGVAIGAHPSFPDRENFGRTAMQ-LPPETVYAQVVYQLGALAAIVQVEGGVM
PXPA1_RALSO      QTTAWALRQGVSIGAHPSFPDRENFGRTEMH-LPPDEVYAGVLFQIGGLSAIVRAQGGRL
PXPA_HAEIN       SAVKFAKENKVRIGAHPSFPDRENFGRTAMA-LSSQELIAHLRYQLGALKAICDGEGAVI
PXPA_NEIMA       AALAYAQQNGVRIGAHPGYPDRENFGRTEMN-LSEADLRACLNYQLGALQALCRDQGLEM
PXPA_BACHD       RTVKLAADKGMGIGAHPGFPDLLGFGRRNIQ-TDHKDIYNFIVYQVAALNGFCQLHRVRM
PXPA_OCEIH       RTIDLAIKNNVAIGAHPGLQDLIGFGRRPMQ-ISPEEVYQLTVYQIGAVQAFAQVKGHNL
PXPA_STAAM       ETVKLAKAHNVAVGAHPGLPDLKGFGRRNID-ISNDEIYNLMIYQLGALQGFCRIHQLKI
PXPA_STAAW       ETVKLAKAHNVAVGAHPGLPDLKGFGRRNID-ISNDEIYNLMIYQLGALQGFCRIHQVKI
PXPA_STAES       ETVQLAKKNNISIGAHPGLPDLKGFGRRKMD-LTPNEIYNLVIYQLGALSGFCKINHVKM
PXPA_CAMJE       ETLNLAKQNGVCIGAHPSYPDLLGFGRRNMQ-ISFEEAKNYALYQLGALFGFAKAKGMKI
PXPA_FUSNN       KTIKIAKENNVAVGAHPGYPDLLGFGRRKMV-VTPDEARAYMLYQLGALNAFAKANETKL
PXPA_PYRAB       RTVKLAKENNVQVGAHPGYPDLMGFGRRYMK-LTPEEARNYILYQIGALYAFAKAEGVEL
PXPA_PYRHO       KTVRLAKENDVQVGAHPGYPDLMGFGRRYMK-LTPEEARNYILYQVGALYAFAKAEGLEL
PXPA_PYRFU       KTVRLAKKNNVQVGAHPGYPDLMGFGRRYMK-LTPEEARNYILYQIGALYAFVKAEGLEL
PXPA_CALS4       LTVDRCLKNVVSIGAHPGFPDLLGFGRRNLD-ASSEEIKNYVIYQIGALQAFAAIRGTKL
PXPA2_BRADU      RTVELAKARGVSVGAHPGYRDLHGFGRHPIAGLKASEIENLVAYQIGALQAIATAAGHKV
PXPA2_AGRFC      RMVRLAKANGVGIGAHPGLPDRAGFGRREIP-FQPDELRQQMLYQLGALMAIAGAEGMKV
PXPA1_BRADU      RMVRLAKQKGVEVGAHPGLPDLLGFGRRVIQ-MDAAELEKHMVYQIGALQAIAANAGHRV
PXPA1_PSESM      STVRRAKALGIDLGAHVGFPDLQGFGRRRMN-IELKELCAIVVYQLGALAGIATAAGYRV
PXPA2_RALSO      RTVRLAIEGGVDVGAHVGFPDRQGFGRRFMQ-VDIPDLTAMVTYQLGALAGIARAHGRRV
PXPA1_PSEPK      RTVERAKALGVAVGAHPGFRDLVGFGRRHIN-ASAQELVDDMLYQLGALREIARAQGVRL
PXPA2_PSESM      RTIEQAKRLGVAIGAHPGFRDLVGFGRRHIN-APAQELVDDMLYQLGALRELARVQGVPL
PXPA1_PSEAE      RTVEMAAEHGVAIGAHPGFRDLVGFGRRHIA-APAIELVNDMLYQLGALREFARLQGLSL
                      .    : :**: .  *  .***  :             :* ..:          :

PXPA1_AGRFC      RYVKPHGALYNRIANDAKQGQAVIDGIKAIDPSLVLMGLA---NAPILDLARKAGLAVVA
PXPA3_PSESM      RYVKPHGALYNTIAHDRRQAMAVIEAIRAIDPALVLVALA---GSTLIELARSEGLQCIA
PXPA_STRAW       SYVKPHGALYNRVVHDEGQAGAVVDGVRLADASLPVLGLP---GSRLLEVAEKAGLPVVT
PXPA_STRCO       AYVKPHGALYNRTVHDEGQARAVVAGVRLAGGALPVLGLP---GSRLLTAAAEAGLTGVP
PXPA_MYCLE       SYVKPHGALYNTIVTNREQGAAVAAAIQLVDSTLPVLGLA---GSTFFDEAARIGLRTVA
PXPA_COREF       DYVKPHGALYNRIAVDEAQAAAVIEAMKKLNPELPLMVLS---GAPIVEQAISEGLTVIQ
PXPA_CORGL       EYVKPHGALYNTIAVDEAQAAAVIEGIKLVNPELSLMALA---GSQIVEQARAVGLQVEQ
PXPA2_PSEAE      RYVKPHGALYQDMMRDPAILAAVLRALAAYDRTLPLMLMSTRDNTAARALGEAHGIELWF
PXPA2_PSEPK      AYVKPHGALYNDMMADPLKLRTVLEAVAAYDSNLPLMLMATADNRAAQALGDEIGVPLWF
PXPA3_PSEAE      AYVKPHGALYNDLVGDDELLRAVLDACAAYRKGLPLMVLALADNGRELELADEADVPLLF
PXPA_VIBVU       HYVKPHGALYNDMMESEAIFRAICEAVSIF--GIPLMILATSDNQHYLDIADIYDVPLLF
PXPA_VIBCH       SYVKPHGALYNDMMSDPSIFRAVVDAVSCF--NLPLMVLASANNQDYLDIADRFDVPLLF
PXPA_VIBPA       GYIKPHGALYNDMMKSDAVFRAVVKAAALF--KVPLMILASQENEKYLEIADDYDVPLLF
PXPA_DEIRA       QHVKAHGALYMRIHEDRAAGEAFCHAVQQLVPQAYLIVLAGAAGSDLALTAAAHGLRVRR
PXPA_BACAN       QHVKPHGALYNMAATNPEIADAIAKAIYHMNSSLSLYGLA--NSEAFIQAAEKYNITLVQ
PXPA_BACCR       QHVKPHGALYNMAASNPEIADAIAKAIYHINPSLLLYGLA--NSEAFIQAAEKYKVTLVQ
PXPA_BACSU       QHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLA--ESE-LVKAGERIGLQTAN
PXPA_BORPE       HHVKAHGALYNMAAKDAALARAICQAVRDVDSDLVLYGLA--GSA-LIDAARAIGLRAAQ
PXPA_ECOLI       RHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLA--GSE-LIRAGKQYGLTTRE
PXPA_SHIFL       RHVKPHGMLYNQAAKEAQLADAIARAVYACDPALVLVGLA--GSE-LIRAGKQYGLTTRE
PXPA_ECO57       RHVKPHGMLYNQAAKEAQLADAIARAVYACDPALVLVGLA--GSE-LIRAGKQYGLTTRE
PXPA_ECOL6       CHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLA--GSE-LIRAGERYGLVTRE
PXPA_SALTI       RHVKPHGMLYNQAAKDPHLAQAIAKAVHDYDPSLILVGLA--GSE-LIRAGERHRLVTRQ
PXPA_SALTY       RHVKPHGMLYNQAAKDPHLAQAIAKAVHDYDPSLILVGLA--GSE-LIRAGERHRLVTRQ
PXPA_YERPE       QHVKPHGMLYNQAAVDPLLADAIAQAVKAVDPSLRLVGLA--GSE-LIRAGTRVGLVTRQ
PXPA1_RALSO      AHVKPHGALYNQAARDRPLAMAIARAVRDFDASLAVFGLA--GGE-LVLAARELGLAAKE
PXPA_HAEIN       SYVKPHGALYNQAAKDEKIARLIAQTVYQFDPNLKLMGLA--GSL-MLRIAEEEKLQTIS
PXPA_NEIMA       AYVKPHGAMYNQAAKNRALADTVARIVADFDPKLKLMALS--GSL-LLEAGKAAGLGVIS
PXPA_BACHD       QHVKPHGALYNMAAKDRVIAEAIAEAIYDIDPSLILFGLS--GSE-LIKAGKKLGLTVAN
PXPA_OCEIH       YHVKPHGALYNMAAKDTAIAKAIAQAVYDYNPNLILFGLA--NSE-LIRMGKEVGLNVAN
PXPA_STAAM       NHVKPHGALYQMGAKDREIANVIAQAVYDFDPSLVLVGLA--NSY-LISEAKNVGLITAS
PXPA_STAAW       NHVKPHGALYQMGAKDREIASVIAQAVYDFDPSLVLVGLA--NSY-LISEAKNVGLITAS
PXPA_STAES       MHVKPHGALYQMGARNKEIAHAIAQAVFDFDSNLIFVGLA--NTL-LISEAELVGLKVAS
PXPA_CAMJE       QHFKAHGALYNMAAIDENLALALCEAVASFDENIIFLGLS--NSA-MNEAAKKKGLRYAN
PXPA_FUSNN       QHMKLHGAFYNMAAVEKDLADAVLDGIEQFDKDIIVMTLS--GSY-MAKEGKRRGLKVAE
PXPA_PYRAB       QHVKPHGALYNAMVKEEELARAVIEGILDFDKNLILVTLS--NSR-VAEIAEEMGLKVAH
PXPA_PYRHO       QHVKPHGALYNAMVKEEDLARAVIEGILDFDKDLILVTLS--NSR-VADIAEEMGLKVAH
PXPA_PYRFU       QHVKPHGALYNAMVKEEDLARAVIEGILDFDKRLIVVTLA--GSR-VVEIAREMGARVAQ
PXPA_CALS4       QHVKAHGALYNMAAVDEKIAMAIAEAIASVDRNLICVGMA--NTA-MERAAEKVGLRFAY
PXPA2_BRADU      THVKAHGALSNVACEDDMTAKAIAAGIKAVDPSLIFVVLA--NSK-LVKAGEAANLPMVH
PXPA2_AGRFC      GHFSFHAAMGNMVNRDPVLADLMMNAIATVDPRLVVFVTP---ESEIERAAKRAGLKTLA
PXPA1_BRADU      THVSFHAAMGNMVNADPDMADVVARAIATINRDFIVFSQP---DAEIVRAARKVGLRTLT
PXPA1_PSESM      THMSFHGALGNMAAADAELAGPLVKAVARFDPQMIISSSS---SEAIEQAAQACNLRVAT
PXPA2_RALSO      THMSFHGALGNRAAADPAWATPLLKAIAAFDPNLIISTSS---SQAIEGAAAAFGLPVGV
PXPA1_PSEPK      QHIKPHGALYMHLARDEEAARLLVENLRVIEPELLLYCMP---GSVICRIAQELGQPVIR
PXPA2_PSESM      QHFKPHGALYMHLARDEEAARLLVENLQRLEPDLLLYCMP---GSVICNVAQELGQPVVR
PXPA1_PSEAE      QHVKPHGALYMHLARDEVAARLFVETLQRLEPELLLYCMP---GSATWRIGRELGQPLVR
                  :.. *. :      .      .                .          .         

PXPA1_AGRFC      EAFADRAYTPEGQLVSRREAGAVLHDAAKIAERMVQLAREGTLEAIDGSIIKIEAQSICV
PXPA3_PSESM      EAFADRAYTPQGTLVSRREPGAVLHDPELVAQRMLRLVQSGSIEAIDGSLVRIEADSICV
PXPA_STRAW       EAFADRAYTEEGTLVPRGEDGAVVTDPDAVVERSVNLARLGVVDAHSGRRIPVRARSLCL
PXPA_STRCO       EAFADRAYTAEGSLVPRSEAGSVVTDEDAVVRRALAFAVEGSVEAVDGTAVAVAARSLCV
PXPA_MYCLE       EAFADRTYRPDGQLISRREPGAVLHDPAVIAQRVVTMVTTGKATAVDGTQLAVTVESICL
PXPA_COREF       ETFADRAYTSDGRLVSRTQTGAVHHDPQVAARQALAFATGGSITSIDGDPVTVHADSICV
PXPA_CORGL       ETFADRAYTADGQLVSRKLPGAVLHDPETAARQALAFATGQPITAITGESVLVDANSICV
PXPA2_PSEAE      EAFADRAYDGAGYLVSRSQPGAVHHDAETVLAQALLLARGAALRASDGSALALEAQTLCV
PXPA2_PSEPK      EAFADRAYTASGHLLSRRLPGAVHHDPARVVEQAVRLARGETLLADDGSALQLAARTLCV
PXPA3_PSEAE      EAFADRAYLPDGRLAPRRLGGAVHHDPQRIIEQALAIARGEAFPDYDGNPLRLTADSLCV
PXPA_VIBVU       EAFADRQYQEDGKLTPRSQANAVYHQPEDIYNQALQIATYGSVNTANGTRLSLEADTICV
PXPA_VIBCH       EAFADRTYLANGKLTPRSQPNAVLSSEEAILNQVRQIARYGKVTSSDGFVIPIEADTLCV
PXPA_VIBPA       EAFADRLYQDDGMLTPRRHPNAVLKDELAILEQVRTLADSGRVKTASGSYILLEADTICV
PXPA_DEIRA       EAFPERAYTGDGRLASRQLPGSSIHDPAEAARRAVGMAQ-GWVQTLGGERLALEMDTLCI
PXPA_BACAN       EAFADRTYKEDGTLTSRTEENALIKNEDEAIKQVLQMVKEGYVNSVNGEKVAVQAQTICL
PXPA_BACCR       EAFADRTYKQDGTLTSRTEENALIKDEDEAIKQVLQMVKEGYVNSVNGEKVAVQAQTICL
PXPA_BACSU       EVFADRTYQSDGTLTPRSQPDALIESDDAAVTQVIKMVKEGAVKSQQGHDVSLKADTVCI
PXPA_BORPE       EVFADRTYQADGQLTPRSQPDAMITDLDQAIAQVLGMVRDGSVRTPDGQTVALQADTLCI
PXPA_ECOLI       EVFADRGYQADGSLVPRSQSGALIENEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCL
PXPA_SHIFL       EVFADRGYQADGSLVPRSQPGALIENEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCL
PXPA_ECO57       EVFADRGYQADGSLVPRSQSGALIEDEEQALAQTLEMVQHGRVKSITGEWATVTAQTVCL
PXPA_ECOL6       EVFADRGYQADGSLVPRSQPGALIENEEQALAQTLEMVQHGRVKSITGEWAMVTAQTVCL
PXPA_SALTI       EVFADRGYQADGSLVPRMQPGALIHDEEQALAQTLDMVQAGRVKSVTGVWTTVTAQTVCI
PXPA_SALTY       EVFADRGYQADGSLVPRMQPGALIHDEEQALAQTLDMVQAGRVKSVTGVWTTVTAQTVCI
PXPA_YERPE       EVFADRHYQPDGTLVPRSQPDALIESDELALSQTLAMVQQHQVQACDGSWVQVQADTVCV
PXPA1_RALSO      EVFADRGYNADGTLVKRGTPGALLENEEAALSQTLAMVREQRVQSVDGVWVPIRAQTVCL
PXPA_HAEIN       EVFADRHYMPDGSLVPRSQPNAMVESDKEAIQQVLQMVTKGQVNAIDGSLVPVKAESICL
PXPA_NEIMA       EVFADRRYMPDGTLVPRSRPDAQVDSDEEAIAQVLQMVRDGQVKAVDGSLVAVQADSICL
PXPA_BACHD       EVFADRTYQPDGTLTPRSEANALIKESERATEQVIQMVKESKVIAVDGSHIPIEADTICV
PXPA_OCEIH       EVFADRTYQPDGSLTPRTSPNAMIHDTDEAVERVIRMVKENKIEAVDGTDISIIADTICI
PXPA_STAAM       EVFADRRYEDDGQLVSRKESDAVITDTDEALKQVLKMVKENKVISKNNKEVTLQADTICV
PXPA_STAAW       EVFADRRYEDDGQLVSRKESDAVITDTDEALKQVLKMVKENKVISKNNKEVTLQADTICV
PXPA_STAES       EVFADRRYEDDGQLVSRKKTDATITNTDEAIQQALKMVLENKVVSKNGKIIDLKADTICV
PXPA_CAMJE       EVFADRAYNDDGTLVSRKLEGALIHDENLAIKRVIKMIKESKVTSINGKEIDLKADSICV
PXPA_FUSNN       EVFADRGYNPDGTLVNRNLPGAFVKEPDEAIARVIKMIKTKKVTAVNGEEIDIAADSICV
PXPA_PYRAB       EVFADRAYNPDGTLVPRGKPGAVIEDKEEIAERVISMVKDGGVRAINGEWVELRVDTICV
PXPA_PYRHO       EVFADRAYNPDGTLVPRGRPGAVIEDKEEIAERVISMVKDGGIRAINGEWVDLKVDTICV
PXPA_PYRFU       EGFADRAYNPDGTLVPRSRPGAVIEDKEEIAERVISMVKDGGIRAINGEWIELEVDTICV
PXPA_CALS4       EVFADRNINPDGTLVSRKHPNAIIHDEELACKRVLRMVKEGVCEAIDGTLVKVKVDTICV
PXPA2_BRADU      EVFADRAYEDDGNLVSRKKPGAVLHDAKAIADRVVRMVQDGAVVSVTGKVIKMRTDTVCI
PXPA2_AGRFC      LFLADRAYDAEGRLVARGLPGALVKDETSVRARVRRFLTHGQVEAIDGTIIAMPAHSILV
PXPA1_BRADU      LFLADRAYDENGHLVSRKLPNSVVTSTEAVAERVKRFLDSGTVQTIEGKSIKVEARSILI
PXPA1_PSESM      TFLADRAYDENCLLVPRGIAGAVVKDPEQVRARVAQLLQDGTVTTLSGKRVAVNAQSILL
PXPA2_RALSO      SFLADRAYDDQGLLVSRGLPGAVIHDEAQVLARVRRLLTEGTIVTHAGNVLPMQPRSILV
PXPA1_PSEPK      EFYADREYDLSGSIVFTRNVRGYE--PQAVAERVLRACRQGVVRTVEGQDLAIEFDSICL
PXPA2_PSESM      EFYADRAYDLSGSIVFTRNVRAHD--PAEVAARVIRACQQGLVRTVEGDDLAIQFDSICL
PXPA1_PSEAE      EFYADRDYDRSGSIVFTRRVAALD--PQQVADKVLRACREGKVRTVEGEDLDIAFDSVCI
                    .:*       :       .          :              .    :   :: :

PXPA1_AGRFC      HGDSPGAVAIAQEIRRRFEADGIAIRSFASDR------
PXPA3_PSESM      HGDSPAAVEMARELRRVLEQASTSLQPFAGKRS-----
PXPA_STRAW       HGDTPGAVELARRVRSRLEASGVRVAAFA---------
PXPA_STRCO       HGDTPNAARIAARVREALETAGVGIGAFA---------
PXPA_MYCLE       HGDSPNAIQMATAVRDQLNAAGIDIRAFC---------
PXPA_COREF       HGDNPAALELVRTIIDTLRAHDVEVRRAR---------
PXPA_CORGL       HGDNPQALALVEKIVTTLAAHEVQVSHAR---------
PXPA2_PSEAE      HGDNPASLAAVRRIRDALEAA-----------------
PXPA2_PSEPK      HGDNDSSVAAVRQIRQALDGLEV---------------
PXPA3_PSEAE      HGDNPQSLAVLRRLRAALDSL-----------------
PXPA_VIBVU       HGDNPESIALVQRISQAIAKM-----------------
PXPA_VIBCH       HGDNPNAVSLIARIRAALDE------------------
PXPA_VIBPA       HGDNEESIALIQKIRQSLYSGGN---------------
PXPA_DEIRA       HGDNPQAVAIAGAIRAALAENGVTLARLHD--------
PXPA_BACAN       HGDGEKAVQFARKIYRTFEHNKISICAPK---------
PXPA_BACCR       HGDGEKAVQFAERIYRTFKLNGISICAPK---------
PXPA_BACSU       HGDGAHALTFAQKIRKQLKAAGIEVTAISEQRST----
PXPA_BORPE       HGDQPDALVFARGIRLALERDGIAIQAA----------
PXPA_ECOLI       HGDGEHALAFARRLRSAFAEKGIVVAA-----------
PXPA_SHIFL       HGDGEHALAFARRLRATFAKKGIVVAA-----------
PXPA_ECO57       HGDGEHALAFARRLRSAFAEKGIVVAA-----------
PXPA_ECOL6       HGDGEHALAFARRLRATFAEKGIVVAA-----------
PXPA_SALTI       HGDGEYALAFARRLRAAFNARNVHVIA-----------
PXPA_SALTY       HGDGEYALAFARRLRAAFNARNIHVIA-----------
PXPA_YERPE       HGDGVQALAFARCLRDRFQQEGISVIAQ----------
PXPA1_RALSO      HGDGAHALAFARRIRDRLGSEGIAVRAGA---------
PXPA_HAEIN       HGDNQHSLQFAKRIVEELEKNHIKITA-----------
PXPA_NEIMA       HGDGPHAVVFAEKIRQELLAAGIKVSA-----------
PXPA_BACHD       HGDSPTALSFIERLHAQLQVEGVTVTKVSDFLFK----
PXPA_OCEIH       HGDGPKSLEFSRRLSHELKNQGISIQK-REMHHG----
PXPA_STAAM       HGDGEHALLFVSKIREILMKEGIDIQSL----------
PXPA_STAAW       HGDGEHALLFVSKIREILMKEGIDIQSL----------
PXPA_STAES       HGDGKHALEFVTQIRNELMKEGIDIQSL----------
PXPA_CAMJE       HGDNAKALEFVKKIKENLKKEQIQICALENFI------
PXPA_FUSNN       HGDNPKAIEFVDRIRKSLIADGIEVKSLYEFIK-----
PXPA_PYRAB       HGDNPKALEITSHIRKILEEEGVKVVPLKDFIG-----
PXPA_PYRHO       HGDNPKAVEITSYIRKVLEEEGVKIVPMKEFIR-----
PXPA_PYRFU       HGDNPKAVEITAYIRRRLEEEGVKVLPMGDFIK-----
PXPA_CALS4       HGDNPQAVEFAKKIRETLEENGVDILPMGEFV------
PXPA2_BRADU      HGDTHGAVEIARTLRQALKDAGIEVAPFKRGA------
PXPA2_AGRFC      HSDTPGSLELARIIRSEIEASGATLAPAAEHAA-----
PXPA1_BRADU      HSDTPGSVNLAGTVRRVIEQGGGEVTPATVLLN-----
PXPA1_PSESM      HGDTPGAVELARSIRHSIEEQGGVITPVSQLLGS----
PXPA2_RALSO      HGDTPGAVALTQRLRAEIESLGGRIVPISQQLGFSTVP
PXPA1_PSEPK      HSDTPGALDLVEATRKALDAAGIVVRAPR---------
PXPA2_PSESM      HSDTPGALALAQATRQALDGAGIEVRTPR---------
PXPA1_PSEAE      HSDTPGALELVASTRARLEGAGIRIKAPR---------
                 *.*   :          :