CLUSTAL format seed alignment for MF_00692

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SELO_PSEPK        --------------------------------------------------MKALDQLTFD
SELO_PSESM        --------------------------------------------------MKALDELVFD
SELO_PSEAE        --------------------------------------------------MKSLDDLDFD
SELO_VIBPA        --------------------------------------------------MSIWQRVSFT
SELO_VIBVU        --------------------------------------------------MSLWSSVKFA
SELO_VIBCH        --------------------------------------------------MSVWNAVHLS
SELO_ECOLI        ------------------------------------------------------MTLSFV
SELO_ECOL6        ------------------------------------------------------MTLSFI
SELO_SALTI        ------------------------------------------------------MTLSFT
SELO_RALSO        ----------------------------------------MPTSAAVQTDDSLASPFDWP
SELO_SHEON        --------------------------------------------------------MKFK
SELO_XANAC        -----------------------------------------------------MTHLRFD
SELO_XANCP        -----------------------------------------------------MTHLQFD
SELO_XYLFA        -----------------------------------------------------MWPLRFN
SELO_RHIME        -----------------------------------------------------MTAFRFD
SELO_AGRFC        -------------------------------------------------------MMKFD
SELO_BRADU        ----------------------------------------------------MTVHFPFQ
SELO_NITWN        --------------------------------------MSQLAEKSCVTPADAAAPIPFD
SELO_RUEPO        ----------------------------------------------------MTIAIPFD
SELO_BACAN        ---------------------------------------------MTKNN---EAGWNLD
SELO_BACCR        ---------------------------------------------MTKNN---ETGWNLD
SELO_BACHD        ---------------------------------------------MTENKGTPEVGWSFD
SELO_COLP3        ------------------------------------------------------MSLILS
SELO_PSEHT        --------------------------------------------------------MNLM
SELO_COREF        -------------------------------------MSTPTNPEQP--TDHPSAPFTLE
SELO_CORGL        ---------------------------------------------------MNTAPFKLE
F8DYD1_CORRG      ------------------------------------MASSPDSPGSPSSPSAPGTQSLHA
C0XSD3_CORLD      -------------------------------------MSTPT----------------LA
SELO_SYNE7        -----------------------------------------------MPSTNPFLTLPYE
SELO_GLOVI        --------------------------------------MEGGLDTDASVHNNPLLQLDYE
SELO_NOSS1        --------------------------------------MTLAETFNTENHGNPLITLNYE
SELO_TRIEI        -------------------------------------------------MSNPLLSLNYE
SELO_SYNY3        -------------------------------------------------MTNPFLNLTYE
SELO_THEEB        ------------------------------------------------MSGHRFQALEYE
U2Y3Q0_9SPHN      -----------------------------------------------MRAEPQAAPYTPD
G2IMV9_SPHSK      -----------------------------------------------MEHSLQASNYRPE
J7QWA4_METSZ      --------------------------------------------------MPVTELYRPE
V2U0A1_9GAMM      --------------------------------------------------------MIFN
F0KNV3_ACICP      --------------------------------------------------------MQFN
D5VAL7_MORCB      --------------------------------------------------------MKFI
B4WTR0_SYNS7      -----------------------------------------------MDTLNADPDATED
K9P6B2_CYAGP      MITPASGPCPGRATPERPVTTAVPTAEPTAIPTSTFADFAQRVDYSLLDSLRPDPQASGD
W7QRM2_9ALTE      --------------------------MNNQTKVTNLAELAQLADYSLLDFLSADPDSTDS
SELO_MORMI        ---------------------------------------------------MRQKTATIT
SELO_SCHPO        ----------------------------------MSKKLKDLPVSSTFTSNLPPDPLVPT
SELO_YEAST        -------------------------MGEKRTIIKALKNSAASHFIKKLTADTSLSSIQEA
                                                                              

SELO_PSEPK        NR-------------FARLGDAFSTQVLPEPIAD-PRLVVASESAMALLDLDPA-QAELP
SELO_PSESM        NR-------------FARLGDAFSTHVLPEPIDA-PRLVVASESALALLDLAPE-QSELP
SELO_PSEAE        NR-------------FARLGGAFSTEVLPDPIAE-PRLVVASPAALALLDLPAE-TSDEA
SELO_VIBPA        HR-------------FSQLPSAFYTLVEPQPLDN-TRWVAWNGEFAQQFGLPAA-QND-E
SELO_VIBVU        QR-------------YAQLPKVFYRLVTPQPLDN-NRWVIWNGELAQGFALPKH-ADDPQ
SELO_VIBCH        RR-------------FAALPQAFYTPVHPQPLQN-VRWGMWNSRLAQQFGLPEA-PND-E
SELO_ECOLI        TR-------------WRDELPETYTALSPTPLNN-ARLIWHNTELANTLSIPSS-LF--K
SELO_ECOL6        TR-------------WRDELPETYTALSPTPLNN-ARLIWHNTELANTLSIPSS-LF--K
SELO_SALTI        AR-------------WRDELPATYTALLPTPLKN-ARLIWYNDELAQQLAIPAS-LFDAT
SELO_RALSO        GRPHAAPG-------FARLGERFLTRLPPVPMPAAPYLVGFSPEAAAPLGLSRA-GLDTP
SELO_SHEON        QD-------------FFTQLPEFYSQVYPQGISN-PHWLAWSDDAAALIGLHQP-TDE--
SELO_XANAC        NRLRQQLPGDPEEGSRRREVSVAWSAVLPTPVAA-PSLIAHSAEMAQVLGLDAA-EIASA
SELO_XANCP        NRLRAELPGDPEEGPRRREVLAAWSAVQPTPVAA-PTLLAYSADVAQRLGLRAE-DLASP
SELO_XYLFA        NRFIAVLPCDPEVSLRSRQVLEAWSGVAPTPVPV-PCLLAYSSEVAAILNFDAE-ELVTP
SELO_RHIME        NS-------------YARLPANFYARVQPTPVAE-PWLIKLNRPLAGELGLDAE-ALERD
SELO_AGRFC        NS-------------YAHLPERFSAAVLPTPVKA-PRLIAFNRTLAEELLLDVA-DLDDD
SELO_BRADU        NS-------------YSALPDSFFARVAPTPVAA-PRLIKLNRPLAVQLGLDPN-MLETP
SELO_NITWN        NT-------------YARMPEAFYERVKPAAVAA-PRLLRVNDALARQLRIDPA-FLKSP
SELO_RUEPO        NS-------------YARLPGGFYTAQAPQPVRA-PRLVAFNADLARLLGIAPG-EVEEM
SELO_BACAN        HS-------------YTTLPQSFYTEIPPTPVSS-PELVKLNHSLAISLGFNPE-ELKKE
SELO_BACCR        NS-------------YTTLPQSFYTEIPPTPVSS-PELVKLNHSLAISLGLTPE-ELKKE
SELO_BACHD        TR-------------YTDLPSMMFSNVEPEPVEA-PKLVILNDSLAQSLGLDPV-ALQHQ
SELO_COLP3        NN-------------YQALGESFSQQTLPAPVGQ-PSLLLWNEPLAKALTIPFTKDNDAE
SELO_PSEHT        PR-------------YRQVADNFAIEDRPSKVAA-PQLLLWNDSLAKAFNINVV----PE
SELO_COREF        AR-------------FAEEFPEMTTPWRGEDQPD-PELAVLNEDLARLLGIDPD-WLRSP
SELO_CORGL        AD-------------FASALPTMAAPWQGEEAPN-PELVILNDDLAYSLGLDPT-WLRTP
F8DYD1_CORRG      SS-------------FATQVPELAQPWRSASFPD-ATLAITNDDLRNEVPVQ--------
C0XSD3_CORLD      HT-------------FAESLPEMAVPARAAEFPD-PQVVVLNAPLARELGLDPE-WLRSA
SELO_SYNE7        PA-------------FASLGSEFSDPVEAATFPA-HQLRFRNDRLLPILGLDPA-TVTDE
SELO_GLOVI        PA-------------FASLGDDYYDLVAAAPFPE-HRLRFRGDGVLRLLGLDPA-TVGEE
SELO_NOSS1        PA-------------LESLGNDYYDEVTAAEFPQ-LTLRWRNDAILPRLGLNPQ-IVTDE
SELO_TRIEI        PA-------------IQALGGDYYDEVLSAEFPQ-HILRFRNDQLLPKIGLNSQ-DVKDE
SELO_SYNY3        PA-------------LESLGNEFFDPVSAATFPE-HKLRFRNDRLLPMLGLEPS-QVKDD
SELO_THEEB        PA-------------FLSLGEQYWDKVQAATFPQ-HILRFRNDALLPLMGLDPA-EVTDA
U2Y3Q0_9SPHN      PQ-------------ILAIADWLGDPVAAADFPA-TKLRFRNRRWDKAVGLDG---LSDA
G2IMV9_SPHSK      RK-------------IDEIADFMADAVRPADFPD-HVLRFRNDRAAATVGLES---LDDA
J7QWA4_METSZ      TL-------------HEGLGEPFFDRVEPATFPE-HRLRYRNQRWAARVGLDG---LSDA
V2U0A1_9GAMM      PL-------------YPSLNAKLYHQQAPKPLQG-ARAGHFNAALANELQWTIE---EQQ
F0KNV3_ACICP      PL-------------YPSLPSKLFHVQQPSPLRG-AKAGHFNSALADELQWSED---DKN
D5VAL7_MORCB      HD-------------YLKHDERLYRHTLPTPLDN-PKLVSLNTQLIDQLGLSSL---DAT
B4WTR0_SYNS7      GD----------DHRARQVFSGHFVPVTPTPLAE-PEYVAHSSTFFKELGLSDE-LALDE
K9P6B2_CYAGP      GQ----------DHRPRQVFSGHYVPVTPTPLPA-PELVAHSRTLFQELGLSDG-LALDA
W7QRM2_9ALTE      GE----------DHQPREVFSGHYVPVKPTPLAN-PEYIAHSATLFEELGFDEA-LAQDP
SELO_MORMI        RR----------DKS----FTGHYVPVKPTPIKD-PEYVAHSKNLFSELGFADS-MAESA
SELO_SCHPO        VQAMKKADDRILHVPRFVEGGGLFTYLTPSLKAN-SQLLAYSPSSVKSLGLEES-ETQTE
SELO_YEAST        INVVQQYNATDPVRLKLFHTPRMVSQGAHFAFCLPTKKPHYKPLLLSQNALDEFNLVQDQ
                                                                              

SELO_PSEPK        VFAELFSGHKL--------WEEADPRAMVYSGHQFGSYNP-----RLGDGRGLLLAEVLN
SELO_PSESM        LFAEIFSGHKL--------WAEAEPRAMVYSGHQFGSYNP-----RLGDGRGLLLGEVYN
SELO_PSEAE        LFAELFGGHKL--------WSEAEPRAMVYSGHQFGSYNP-----RLGDGRGLLLGEVIN
SELO_VIBPA        LLAV-FSGQSE--------FEPFRPLAMKYAGHQFGVYNP-----DLGDGRGLLLAEIEH
SELO_VIBVU        LLSV-FSGAEP--------FSAFKPLAMKYAGHQFGVYNP-----DLGDGRGLLLGEMQN
SELO_VIBCH        LLLS-LSGQQL--------PADFSPVAMKYAGHQFGVYNP-----DLGDGRGLLLAEMAT
SELO_ECOLI        NGAGVWGGEAL--------LPGMSPLAQVYSGHQFGVWAG-----QLGDGRGILLGEQLL
SELO_ECOL6        NGAGVWGGENL--------LPGMSPLAQVYSGHQFGVWAG-----QLGDGRGILLGEQLL
SELO_SALTI        NGAGVWGGETL--------LPGMSPVAQVYSGHQFGIWAG-----QLGDGRGILLGEQLL
SELO_RALSO        AGLDVFVGNAI--------AAWSDPLATVYSGHQFGVWAG-----QLGDGRALLLAELQT
SELO_SHEON        -LLQGLSGNAA--------VEGASYYAQVYSGHQFGGYTP-----RLGDGRSIILGEAIG
SELO_XANAC        QFAQVFGGNAL--------YPGMQPWAVNYGGHQFGHWAG-----QLGDGRAISLGEAIG
SELO_XANCP        RFAEVFGGNAL--------YPGMQPWAVNYGGHQFGHWAG-----QLGDGRAISLGEAIG
SELO_XYLFA        RFVEVFSGNAL--------YPGMQPYAVNYGGHQFGQWVG-----QLGDGRVITLGELLG
SELO_RHIME        -GAAIFSGNLV------PE--GAEPLAMAYAGHQFGTFVP-----QLGDGRAILLGEVTD
SELO_AGRFC        RLAAIFSGNVV------PQ--GAEPLAMAYAGHQFGGFVP-----QLGDGRAILLGEVID
SELO_BRADU        EGAEILAGKTV------PD--GADPIAMAYAGHQFGQFVP-----QLGDGRAILLGEVID
SELO_NITWN        QGVAVLSGNEI------AP--GSDPIAQAYAGHQFGSFVP-----QLGDGRAILLGEVVD
SELO_RUEPO        --AQVFAGNAV------PQ--GAEPLAQLYSGHQFGNYNP-----QLGDGRAILLGEVLG
SELO_BACAN        AEIAIFAGNAL------PE--GAHPLAQAYAGHQFGHFN------MLGDGRALLIGEQMT
SELO_BACCR        AEIAIFAGNGL------PE--GAHPLAQAYAGHQFGHFN------MLGDGRALLIGEQIT
SELO_BACHD        NSIAVLAGNEV------PK--GAAPLAQAYAGHQFGHFT------MLGDGRAILLGEQIT
SELO_COLP3        LLSQYFSGNQL------IE--GSKPVAQAYSGHQFGHFNP-----QLGDGRAHLLGDIAD
SELO_PSEHT        LRASTFSGNEQ------Q---AIAAVALGYSGHQFGHFSP-----RLGDGRAHLLGAVED
SELO_COREF        AGVEFLLGLNP------EP--TTEMVAQGYAGHQFGQFVP-----SLGDGRALLLGEIRG
SELO_CORGL        EGVQFLLGLNP------EP--LTKAVAQAYSGHQFGQFVA-----SLGDGRALLLGEARS
F8DYD1_CORRG      --DWDLAEG-------------MEGWATAYSGHQFGHFNP-----VLGDGRALLLGETTN
C0XSD3_CORLD      EGTAWLAGA-------------AGGHATAYAGHQFGQFVG-----LLGDGRALLLGDID-
SELO_SYNE7        HFIEAFGRFQ----------GRSPLLAMRYHGYQFGIYNP-----DLGDGRGFLYGQVRG
SELO_GLOVI        HFIEAFGRFA----------GRGPFLAMRYHGYQFGEYNP-----YLGDGRGFLYGQVRG
SELO_NOSS1        DFITAFGLFQ----------GRKPLLALRYHGYQFGEYNP-----NLGDGRGFLYGQVRG
SELO_TRIEI        HFIEAFGKFH----------CVRPFLALRYHGYQFGEYNP-----YLGDGRGFLYGQVRG
SELO_SYNY3        NFVEAFGLFH----------GVRPFLALRYHGYQFGEYNP-----NLGDGRGFLYGQVRG
SELO_THEEB        DFIAAFGQFQ----------GREPFLAMRYHGYQFGEYNP-----HLGDGRGFLYGQFRG
U2Y3Q0_9SPHN      EWVRHFGRFEP------LPGNLPQPLALRYHGHQFRVFNP-----EIGDGRGFLFAQLR-
G2IMV9_SPHSK      SWIDHFGRFQP------LPQAQPEPLALRYHGHQFRVYNP-----DLGDGRGFLFAQLRE
J7QWA4_METSZ      EWIEHLGRFSP------LPGGFARPLALRYHGHQFRVYNS-----DLGDGRGFLFAQLRD
V2U0A1_9GAMM      DWVAICSG--------QKTFAEFPPLAMVYAGHQFGQWAG-----QLGDGRGLLIGQVLD
F0KNV3_ACICP      AWVEICSG--------QRIFPEFPSLAMVYAGHQFGQWAG-----QLGDGRGLLIAQILN
D5VAL7_MORCB      AWADIISGRLSPLT--QIAPHKIQPIAMAYAGHQFGQWAG-----QLGDGRGVLIAQLHN
B4WTR0_SYNS7      KFRHVFSGDLSAAHEPMRQVGWATGYALSIYGTEYIQNCPFGTGNGYGDGRAISVFEGII
K9P6B2_CYAGP      SFRRLFSGDITAAQAPMRPFGWATGYALSIYGSEYIQQCPFGTGNGYGDGRAISVFEGVF
W7QRM2_9ALTE      GFAQLFSGDVSQLPAPMRKIGWATGYALSIYGTEYIQQCPFRTGNGYGDGRAISVLELVT
SELO_MORMI        DFVRMFSGDMSGVPVPMRQVGWASGYALSIYGTEYTQQCPFQTGNGYGDGRAISVLETLI
SELO_SCHPO        AFQQLVVGSNV-------DVNKCCPWAQCYGGYQFGDWAG-----QLGDGRVVSLCELTN
SELO_YEAST        DLEKILSGEKV------YYSDSIFPYSTVYSGFQFGSFAA-----QLGDGRVVNLFDLKD
                                            :    * ::            ****         

SELO_PSEPK        ----DAGEHWDLHLKGAGQTPYSR-MGDGRAVLRSSIREFLASEALHALGIATSRALCVI
SELO_PSESM        ----DAGEHWDLHLKGAGRTPYSR-MGDGRAVLRSSIREFLASEALHALGIPSSRAACVV
SELO_PSEAE        ----QAGEHWDLHLKGAGQTPYSR-MGDGRAVLRSSIREFLASEALPALGIPSSRALCVI
SELO_VIBPA        ----QNGTWFDIHLKGAGLTPYSR-MGDGRAVLRSTIREYLCSEAMAGLGIPTTRALGMV
SELO_VIBVU        ----QQGQWFDIHLKGAGLTPFSR-MGDGRAVLRSTLREYLCSEAMAALGIETTRALGMM
SELO_VIBCH        ----KQGEVFDIHLKGAGLTPYSR-MGDGRAVLRSSLREYLCSEAMAGLGIATTRALALM
SELO_ECOLI        ----ADGTTMDWHLKGAGLTPYSR-MGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIV
SELO_ECOL6        ----ADGTTMDWHLKGAGLTPYSR-MGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIV
SELO_SALTI        ----ADGSTLDWHLKGAGLTPYSR-MGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIV
SELO_RALSO        ----ADG-PCEVQLKGAGLTPYSR-MGDGRAVLRSSIREFLCSEAMAGLGIPTTRALCVI
SELO_SHEON        ----PNG-AWDVALKGGGPTPYSR-HGDGRAVMRSAVREFLVSEALHHLGVPTTRALAVI
SELO_XANAC        ----TDGGRYELQLKGAGPTPYSR-GADGRAVLRSSIREFLCSEAMHHLGVPTTRALSLV
SELO_XANCP        ----VDGGRYELQLKGAGPTPYSR-GADGRAVLRSSIREFLCSEAMHYLGVPTTRALSLV
SELO_XYLFA        ----ADGVYYELQLKGAGPTPYSR-GADGRAVLRSSIREFLCSEAMHHLGIPTTRALSLI
SELO_RHIME        ----AGGRRRDIQLKGAGQTPYSR-RGDGRAALGPVLREYIVSEAMHALGVPTTRALAAT
SELO_AGRFC        ----VNGRRRDIQLKGSGPTPFSR-RGDGRAALGPVLREYIVSEAMFALGIPATRALAAV
SELO_BRADU        ----RDGVRRDIQLKGSGPTPFSR-RGDGRAALGPVLREYIVSEAMYALGIPTTRSLAAV
SELO_NITWN        ----AAGKRFDIQLKGSGRTRFSR-RGDGRAAIGPVIREYIVSEAMAALGIPTTRSLAVV
SELO_RUEPO        ----SDGIRRDIQLKGAGRTPYSR-GGDGRAWLGPVLREYVVSEAMAALGIPTTRALAAV
SELO_BACAN        ----PSGKRFDIQLKGSGPTPYSR-RGDGRAALGPMLREYIISEAMYALDIPTTRSLAVV
SELO_BACCR        ----PSGERFDIQLKGSGPTPYSR-RGDGRAALGPMLREYIISEAMYALDIPTTRSLAVV
SELO_BACHD        ----PNGERFDIQLKGSGRTPYSR-QGDGRAALGPMLREYIISEAMHALGIPTTRSLAVV
SELO_COLP3        ----TQGQRWDIQLKGSGVSDFSR-QGDGRCALGPALREYIMSEAMFALGVPTTRCLAVV
SELO_PSEHT        ----AQNQLWDIQLKGSGATPYSR-GGDGRCALGPAIREYIMSEAMQALGIKTTRCLAVV
SELO_COREF        ----TDGVLRDIHLKGSGRTRYSR-GADGRAALGPALREYLVSEAMHALGVPTTRALAVV
SELO_CORGL        ----ADGVLHDIHLKGSGRTQFSR-GADGRAVLGPVLREYIISEAMHALGVPTTRSLAVI
F8DYD1_CORRG      --------GREVQLKGSGPTPFSR-GGDGFGTLGSMLREYIVSEIMHYAGIPTTRIAAVF
C0XSD3_CORLD      --------GREIQLKGSGPTPFSRPGSDGVGAIGPMLREYAVSEFMHAVGVASTRSLAVL
SELO_SYNE7        ----RNGWLYDFGTKGSGRTPYSR-GGDGKLTLKGGVREVLASEFLQRLGVRTGRCLSLI
SELO_GLOVI        ----LDGELYDFGTKGSGTTPYSR-GGDGRLTLKGGVREVLASEALHHLGVRTSRSLSLI
SELO_NOSS1        ----TDGELYDFGTKGSGRTPYSR-GGDGMLTLKGGVREVLAAEALHQLGVRTSRCLTMI
SELO_TRIEI        ----VDDELYDFGTKGSGRTPYSR-SADGRLTLKGGVREVLAAEILHRHGVRTSRCLSLI
SELO_SYNY3        ----VNGELFDFGTKGSGQTPYSR-GGDGRLTLKGGVREVLAAEALHRLGVKTSRCLSLV
SELO_THEEB        ----VDGQLYDLGTKGSGTTPYSR-GGDGRLTLKGGVREVLASELLHRLGVRTFRSLSLV
U2Y3Q0_9SPHN      ---DGEGRLLDLGTKGSGQTPHSR-SGDGRLTLKGAVREILATEMLEALGAYTSKTFSVI
G2IMV9_SPHSK      DG-DAGGRLLDLGTKGSGLTPYSR-TADGRLTLKGAVREILATEMLEALGVTTSRSFSVI
J7QWA4_METSZ      ---AKDGRLLDLGTKGSGQTPWSR-RGDGRLTLKGGVREILATEMLEALGVDTSKTFSLI
V2U0A1_9GAMM      QQ----GKTIDLHLKGAGKTPYSR-MGDGRAVLRSVIREYLAGHALNALGIASSNAIGFT
F0KNV3_ACICP      TK----GQTIDLHLKGAGPTPYSR-MGDGRAVLRSVVREYLAGHALNALGVASSHAVGFT
D5VAL7_MORCB      KKT---GKLIDLHLKGAGLTSYSR-RGDGRAMLASCIREYLGGHALNGLMIASSDAIGLV
B4WTR0_SYNS7      N-----GQRWEMQLKGGGPTPYCR-GGEGRAVLRSSVREFLAQEYMHALDVPTSRSLTLY
K9P6B2_CYAGP      N-----GRRWEMQLKGGGPTPYCR-GADGRAVLRSSVREFLAQEFMHALGVPTSRSLTLY
W7QRM2_9ALTE      R-----NQRWEMQLKGAGRTPYCR-GGDGRAVLRSSVREFLAQEHMHALGIPTSRSLSLY
SELO_MORMI        K-----GQRWEMQLKGGGRTPYCR-GADGRAVLRSSIREFLAQDHMHALGVPTSRSLSLY
SELO_SCHPO        P---ETGKRFEIQVKGAGRTPYSR-FADGKAVLRSSIREYLCCEALYALGIPTTQALAIS
SELO_YEAST        K---CSGQWQTFQLKGAGMTPFSR-FADGKAVLRSSIREFIMSEALHSIGIPSTRAMQLT
                                **.* :  .*  .:*   :   :**    . :      :       

SELO_PSEPK        GSSTPVWRE---------------TRESAAMLTRLAQSHVRFGHFEYFYYTK--------
SELO_PSESM        SSNTPVWRE---------------KQEYAAMVLRLAQSHVRFGSLEYLFYTK--------
SELO_PSEAE        GSSTPVWRE---------------KKESAATLLRLAPSHVRFGHFEYFYYTR--------
SELO_VIBPA        VSDTPVYRE---------------KTEFGAMLIRMAETHVRFGHFEHLFYTN--------
SELO_VIBVU        VSDTPVYRE---------------QVEQGACLIRLAQTHIRFGHFEHFFYTE--------
SELO_VIBCH        SSETPVYRE---------------REERGALLVRLAHTHVRFGHFEHFFYTD--------
SELO_ECOLI        TSDSPVYRE---------------TAEPGAMLMRVAPSHLRFGHFEHFYYRR--------
SELO_ECOL6        TSDSPVYRE---------------TVESGAMLMRVAPSHLRFGHFEHFYYRR--------
SELO_SALTI        ASDTPVQRE---------------TQETGAMLMRLAQSHMRFGHFEHFYYRR--------
SELO_RALSO        GADAPVRRE---------------TIETAAVVTRLAPSFVRFGHFEHFAANE--------
SELO_SHEON        GSDMPVWRE---------------SQETAAITVRLARSHIRFGHFEFFSHSER-------
SELO_XANAC        GTGDAVVRDMFYDG--------HPQREPGAIVCRVAPSFIRFGNFELPSARG--------
SELO_XANCP        GTGDAVVRDMFYDG--------HPRREPGAIVCRVAPSFIRFGNFELPAARG--------
SELO_XYLFA        ATGDTVIRDMLYDG--------HPAPEPSAIVCRVAPSFVRFGTFELPASRG--------
SELO_RHIME        ATGQPVYR---------------EQILPGAVFTRVAASHIRVGTFQFFAARG--------
SELO_AGRFC        LSGDRVQR---------------EVGLPGGVFTRVAASHIRVGTFQFFAARE--------
SELO_BRADU        VTGEHVIR---------------ETALPGAVLTRVAASHIRVGTFQFFAVRR--------
SELO_NITWN        LTGEQVMR---------------ERVLPGGILTRVASSHLRVGTFQYFAARG--------
SELO_RUEPO        ETGETVRR---------------ESALPGAVLTRVAQSHLRVGTFQVFAARG--------
SELO_BACAN        TTGEPTYR---------------ETKLPGAILTRVASSHIRVGTFQYAAARG--------
SELO_BACCR        TTGEPTYR---------------ETKLPGAILTRVASSHIRVGTFQYAAARG--------
SELO_BACHD        TTGESVFR---------------ETVLPGAILTRVAASHIRVGTFQFVANAG--------
SELO_COLP3        TTGENVYR---------------ERPYDGAVVTRIAASHIRVGTFQYFAARG--------
SELO_PSEHT        GSGETVYR---------------NPPQPGAIVTRLASSHIRVGSFQYLATQG--------
SELO_COREF        TTGRKIQR---------------DRVLPGAVVVRVATSHIRVGSFQYANITG--------
SELO_CORGL        STGRKIQR---------------GSVAPGAVLVRVATSLIRVGSFQYSNISG--------
F8DYD1_CORRG      RTGTEILRN--------------GRPEPGGIAVRVASSHVRVGTFQFSRLLD--------
C0XSD3_CORLD      STGERVLRQ--------------QGYVPGGIVVRVANSHLRVGSVQYAATQS--------
SELO_SYNE7        ETGEELWRGD------------EPSPTRSSVMVRFNRTHIRFGTFERLHYFK--------
SELO_GLOVI        ETGEALWRGD------------EPSPTRSAVLVRTSRSHVRFGTFERLHHFK--------
SELO_NOSS1        ETGLGLWRGD------------EPSPTRSSVMVRMNKSHIRFGTFERLHYFQ--------
SELO_TRIEI        ETGEGLWRGD------------EPSPTRSSVMVRFSRSHIRFGTFERLHFYK--------
SELO_SYNY3        ETGDSLWRGD------------EPSPTRASVMIRFSRSHIRFGTFERLHYHH--------
SELO_THEEB        ETGESLWRGD------------EPSPTRSSVLVRLGRSHIRFGTFERLHYLR--------
U2Y3Q0_9SPHN      ETGEDLWRND------------EPSPTRSAVMVRLSHGHIRIGTFQRLAVLE--------
G2IMV9_SPHSK      ETGEALVRGD------------EPSPTRSAVLVRLSHGHIRIGSFQRLAYRG--------
J7QWA4_METSZ      ETGEALMRGD------------EPSPTRSSVLVRLSHSHIRIGTFQRLAFHD--------
V2U0A1_9GAMM      TSQHAVQR---------------EQLEQGAMLLRTADCHIRFGHFEWINQYA--------
F0KNV3_ACICP      TSTQGVQR---------------EKLELGAMLLRTSECHIRLGHFEWINQYA--------
D5VAL7_MORCB      VSDTHIQR---------------RHIEKAAALLRVSDCHVRLGHFEWVAMYA--------
B4WTR0_SYNS7      VSKSETVTRPWYSQDSHSLEPDVLVDNPVAISTRVAPSFLRVGQLELFARRVGKASPKEN
K9P6B2_CYAGP      VSRSETVRRPWYSANSRSFDPDILVDNPVAITTRVAPSFLRVGQLELFARRA--------
W7QRM2_9ALTE      VSKTEQVDRPWYFADSQSIDPETMVANPVAISTRVAPSFLRVGQLELFARRA--------
SELO_MORMI        VSKTETVKRPWYSQGSRSENPDMLISEAVAISTRVAPSFIRVGQLELFARRS--------
SELO_SCHPO        NLEGVVAQR--------------ETVEPCAVVCRMAPSWIRIGTFDLQGINN--------
SELO_YEAST        LLPGTKAQRR--------------NQEPCAVVCRFAPSWIRLGNFNLFRWRH--------
                                               .   *     :*.* .:              

SELO_PSEPK        -------QPEQQRVLIDH--------------------VLEQHYPECR-EAEQP------
SELO_PSESM        -------QPEHLKTLAEH--------------------VLTMHYPHCQ-EQPEP------
SELO_PSEAE        -------QHDQLKQLAAF--------------------VLEHHFADCN-AAERP------
SELO_VIBPA        -------QLAEQKLLADK--------------------VIEWHFADCA-SAEKP------
SELO_VIBVU        -------QYDELRLLADN--------------------VIEWYMPECT-AHDKP------
SELO_VIBCH        -------QHANLKLLADK--------------------VIEWHFPDCV-QTSKP------
SELO_ECOLI        -------ESEKVRQLADF--------------------AIRHYWSHLA-DDEDK------
SELO_ECOL6        -------EPEKVRQLADF--------------------AIRHYWSHLD-DEEDK------
SELO_SALTI        -------EPEKVQQLADF--------------------AIRHYWPQWQ-DVAEK------
SELO_RALSO        -------KLPELRALADF--------------------VIDRFYPACR-AEPQP------
SELO_SHEON        ------GQADKLTQLLNF--------------------TLKQHYPHLS-CDPAG------
SELO_XANAC        -------DIALLRQWVDF--------------------TIARDFPALAGAGEAL------
SELO_XANCP        -------DVDLLRQWVDF--------------------TLARDFPDLPGSGEDR------
SELO_XYLFA        -------DIDLLRRLVEF--------------------TIMRDYPHLHGAGETL------
SELO_RHIME        -------DMESIRTLADY--------------------VIGRHYPELKTDEKP-------
SELO_AGRFC        -------DDEAIRSLADY--------------------VIDRHYPDAKNTENP-------
SELO_BRADU        -------DTDAIRRLADH--------------------VIARHYPELLGTERP-------
SELO_NITWN        -------DVENLRALADY--------------------AIARHYPDVCSAGDP-------
SELO_RUEPO        -------EIAHLKRLTDY--------------------AIARHYPDAQGP----------
SELO_BACAN        -------SIEDLQSLADY--------------------TIKRHYPEIEA-HENR------
SELO_BACCR        -------SIEDLKSLADY--------------------TIKRHYPEIES-HENR------
SELO_BACHD        -------SEEELKALADY--------------------TLARHFPEVEADRENR------
SELO_COLP3        -------DTDSLKKLTNY--------------------AINRHFPELIANSSENSSDN--
SELO_PSEHT        -------DVAGLKNLADL--------------------AIERHYPKIQATGPE-------
SELO_COREF        -------GIDLSRRLADH--------------------AITRHYPRLVERFPESGPE---
SELO_CORGL        -------GIELSQHLANY--------------------TITRHFPSLVAELSAPTPA---
F8DYD1_CORRG      -------EHESGKQQKDKGKATDPVLPRLVNYVLRTIVTDSSITDSSSTASSIAELS---
C0XSD3_CORLD      -------EE------------------------------------LTAKVVAAAGFS---
SELO_SYNE7        -------RADLVRQLLDH--------------------VIATYYSHLLGD----------
SELO_GLOVI        -------RKDLIQKLLDY--------------------VIAVYYPHYGAE----------
SELO_NOSS1        -------RSDLIKKLLDH--------------------VIEHYYRHLAHE----------
SELO_TRIEI        -------RPDLTKKLLNH--------------------VINCYYSNLKKENISQKDPF--
SELO_SYNY3        -------QTEQIAQLLDH--------------------VIVTYYPEVSGSNSD-------
SELO_THEEB        -------RPDLIQRLLDH--------------------VIAYYYPHLLEIPDP-------
U2Y3Q0_9SPHN      -------EHAALEQLVAY--------------------CLEQYPGNLPPADAPGR-----
G2IMV9_SPHSK      -------ERDHLVRLIDY--------------------CLHHLLAR-----EPG------
J7QWA4_METSZ      -------DAAAIERLLDH--------------------VCRYYFPALA---DLPA-----
V2U0A1_9GAMM      -------PELLNEFTQKA---------------------IEWYFPECLTAEQP-------
F0KNV3_ACICP      -------PELLSEFTQKC---------------------IEWHYPECLETENP-------
D5VAL7_MORCB      -------ADYFETFVIKI---------------------IQSYYLHLYDTHQNTA-----
B4WTR0_SYNS7      RSNAHPKALEELRMIVSH--------------------LIEREYKSDIDQNLSFT-----
K9P6B2_CYAGP      RSGAHPEALHELELIVQH--------------------LIERNYRQEIDPALEFA-----
W7QRM2_9ALTE      LVNEHDNALKELEQIVLH--------------------LIDREYHTQISPELALA-----
SELO_MORMI        RSNEHPKAMEELEKIVLH--------------------LIDREYADVIDTQLATP-----
SELO_SCHPO        -------QIESLRKLADY--------------------CLNFVLKDGFHGGDTGN-----
SELO_YEAST        -------DLKGLIQLSDYCIEELFAGGTQFEGKPDFNIFKRDFFPDTETKIDEQVEKDET
                                                                              

SELO_PSEPK        ---------------YLAMFRTIVERNAELIARWQAYGFCHGVMNTDNMSILGITFDFGP
SELO_PSESM        ---------------YLAMFREIVERNAELIAKWQAYGFCHGVMNTDNMSILGITFDFGP
SELO_PSEAE        ---------------YAAMFRQVVERNAELIARWQAYGFCHGVMNTDNMSILGITFDYGP
SELO_VIBPA        ---------------YAAMFGEIVQKTADMIAYWQAYGFAHGVMNTDNMSILGQTFDYGP
SELO_VIBVU        ---------------YLAMFEQVVARTATMIAQWQAVGFAHGVMNTDNMSILGQTFDYGP
SELO_VIBCH        ---------------YAAWFSQVVERTALMIAQWQAYGFNHGVMNTDNMSILGETFDYGP
SELO_ECOLI        ---------------YRLWFSDVVARTASLIAQWQTVGFAHGVMNTDNMSLLGLTLDYGP
SELO_ECOL6        ---------------YRLWFTDVVARTASLIAQWQTVGFAHGVMNTDNMSLLGLTLDYGP
SELO_SALTI        ---------------YALWFEEVAARTGRLIAEWQTVGFSHGVMNTDNMSILGLTIDYGP
SELO_RALSO        ---------------YLALLREVGRRTAALIAQWQAVGFCHGVMNTDNMSILGLTLDYGP
SELO_SHEON        ---------------YKAWFLQVVQDSAKMIAHWQAIGFAHGVMNTDNMSILGDSFDFGP
SELO_XANAC        ---------------YAGWFAQVCERTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGP
SELO_XANCP        ---------------IASWLGQVCERTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGP
SELO_XYLFA        ---------------YVDWFAEICTRTAELVAHWMRVGFVHGVMNTDNMSILGLTIDYGP
SELO_RHIME        ---------------YLALLKAVAARQAALIARWLHVGFIHGVMNTDNMTISGETIDFGP
SELO_AGRFC        ---------------YLALLRGIAERQCALIARWMMVGFIHGVMNTDNMAVSGETIDFGP
SELO_BRADU        ---------------YHALLAGVVARQAELVARWLLVGFIHGVMNTDNSSISGETIDYGP
SELO_NITWN        ---------------YLAFFDAVVATLARLSARWMLVGFIHGVLNTDNTAIAGETIDYGP
SELO_RUEPO        ----------------MGLLAAVRDAQARLIARWMGVGFIHGVMNTDNSSIAGETIDYGP
SELO_BACAN        ---------------YTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGP
SELO_BACCR        ---------------YTALLQEVIKRQASLIAKWQLAGFIHGVMNTDNITISGETIDYGP
SELO_BACHD        ---------------YLALLQKVIKRQAELIAKWQLVGFIHGVMNTDNMTISGETIDYGP
SELO_COLP3        -SDALKADNVISSQQVLEFFSAVLSKQIPLVLSWLRVGFIHGVMNTDNTTISGETIDYGP
SELO_PSEHT        --------------RYLAFLAAVIKNQVELVVSWMRVGFIHGVMNTDNTLVSGETIDYGP
SELO_COREF        --------------RYAWFFRQVMDAQAQTVARWMRLGFVHGVLNTDNTLVSGETIDYGP
SELO_CORGL        --------------TYVSLFKAILQRQADTVGKWTRLGFVHGALNTDNTLISGETVDYGP
F8DYD1_CORRG      --------------GPASIITHAVRTQASLVASWMKVGFVHGVMNTDNMSLAGETIDYGP
C0XSD3_CORLD      --------------TPTKLLREVMDRQLELVVKWMRIGFVHGVMNTDNTALSGETIDYGP
SELO_SYNE7        ------------PEADAKFYAELTERTADLAAQWMAAGFCHAVLNTDNLSIVGESFDYGP
SELO_GLOVI        ------------PERYALFYRELVGRTAELAAQWMAVGFTHAVLNTDNMSITAESFDYGP
SELO_NOSS1        ------------SDKYALFYAELVKRVAELVAQWMAAGFCHAVLNTDNMSITGESFDYGP
SELO_TRIEI        ------------QDCYFLFYLELVKRIAKLVAQWMAAGFCHGVLNTDNMSITGESFDYGP
SELO_SYNY3        ------------DSAHIAFFRVLVERVAKLVAQWMAAGFCHGVLNTDNMSITGESFDYGP
SELO_THEEB        ------------KERNCAFYRELVARTADLAAQWLVAGFCHGVLNTDNMAITGESFDYGP
U2Y3Q0_9SPHN      ------------DEPAVILLNQVVERLADLAASYVTAGFVHGVLNTDNMNISGESFDYGP
G2IMV9_SPHSK      ------------PVPALTLLDAVVERTADLAASYMIAGFVHGVLNSDNIAITAESFDYGP
J7QWA4_METSZ      ------------PERALAFLEAVTARVARLGAGYMASGFVHGVLNSDNINVTGESFDYGP
V2U0A1_9GAMM      ---------------ILAFVDQVIERTAKMIAQWQLVGFAHGVMNTDNLNITGSTLDFGP
F0KNV3_ACICP      ---------------ILSFAKKVVECIAIMIAKWQLVGFAHGVMNTDNLNITGSTLDFGP
D5VAL7_MORCB      --------------NISQLLHEIAANTARMIAKWQLIGFCHGVMNTDNLNITGTTLDFGP
B4WTR0_SYNS7      -------------DQLVELAKLFRQRLTSLVANWLRVGYCQGNFNSDNCAAGGFTLDYGP
K9P6B2_CYAGP      -------------DQVVELARLFRGRLTSLVANWMRVGYCQGNFNSDNCAAGGYTLDYGP
W7QRM2_9ALTE      -------------DKVIQLATAFRNRLTDLIANWLRVGFCQGNFNSDNCAAGGYTLDYGP
SELO_MORMI        -------------EKIVLLAREFRGRLTSMVANWIRVGFCQGNFNSDNCAAGGFTLDYGP
SELO_SCHPO        --------------RYEKLLRDVAYRNAKTVAKWQAYGFMNGVLNTDNTSILGLSIDYGP
SELO_YEAST        EVSTMTGDNISTLSKYDEFFRHVVSLNANTVAHWQAYGFANGVLNTDNTSIMGLTIDYGP
                                                   :   *: :. :*:**    . :.*:**

SELO_PSEPK        YAFLDDFDANFICNHSDDRGR-YSYANQVPIAHWNLSALAQALTTVIE------------
SELO_PSESM        FAFLDDFDEHFICNHSDHEGR-YSFSNQVPIAQWNLSALGQALTPFVS------------
SELO_PSEAE        YAFLDDFDANHICNHSDDAGR-YSFSNQVPIAHWNLAALAQALTPLVE------------
SELO_VIBPA        FGFLDDYEPGYICNHSDYQGR-YAFEQQPRIALWNLSALAHALSPLVE------------
SELO_VIBVU        FGFLDDYEPGYICNHSDYQGR-YAFDQQPRVALWNLSALAHALSPLIE------------
SELO_VIBCH        FAFLDDYDPNFICNHSDYQGR-YAFDQQPRIGLWNLSALAHALSPLID------------
SELO_ECOLI        FGFLDDYEPGFICNHSDHQGR-YSFDNQPAVALWNLQRLAQTLSPFVA------------
SELO_ECOL6        FGFLDDYEPGFICNHSDHQGR-YSFDNQPAVALWNLQRLAQTLSPFVA------------
SELO_SALTI        FGFLDDYDPGFIGNHSDHQGR-YRFDNQPSVALWNLQRLAQTLTPFIE------------
SELO_RALSO        FGFLDGFDANHICNHSDTGGR-YAYAQQPQIAYWNLFCLAQALLPLCGSDPTAF------
SELO_SHEON        FAFLDTFQEDFICNHSDPDGR-YAFGQQPGIGLWNLQRLAQALTPVIA------------
SELO_XANAC        YGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLGRLAQALAPLFPD-----------
SELO_XANCP        YGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLGRLAQALSPLFGD-----------
SELO_XYLFA        YGWIDNNDLDWTPNVTDAQSRRYRFGAQPQVAYWNLGCLARALAPLFSD-----------
SELO_RHIME        CAFMDDYDPKTVFSSIDQFGR-YAYANQPAIGQWNLARLAETLVTL--------------
SELO_AGRFC        CAFLDEYHPNKVFSSIDAQGR-YAYNNQPGIAQWNIARLAECLLPL--------------
SELO_BRADU        CAFMDAYNPAQVFSSIDEMGR-YAYANQPRIALWNLTRLAECLLPL--------------
SELO_NITWN        CAFIDAYRPDKVFSSIDQFGR-YAFENQPAAVAWNLARFAEALLPL--------------
SELO_RUEPO        CAFMDTYHPDTVYSSIDRYGR-YAYSNQPDIAVWNLAQLATALIQQ--------------
SELO_BACAN        CAFMDNYDQGTVFSSIDTQGR-YAYGNQPYMAAWDLARLAESLIPI--------------
SELO_BACCR        CAFMDNYDQGTVFSSIDTQGR-YAYGNQPYMAAWDLARLAESLIPI--------------
SELO_BACHD        CAFMDVYDPETVFSSIDTRGR-YAYGNQPRIGAWNLARFAEALLPL--------------
SELO_COLP3        CAMMNAYHPETVFSSIDRNSR-YAFGKQISIMQWNMTRLAETLLPL--------------
SELO_PSEHT        CAMMNSFDFDTVFSSIDKQGR-YAFGNQPNIANWNCARLAESLIPL--------------
SELO_COREF        CAFMDRYREDAVFSSIDTHGR-YKFSNQPLILGWNLARLAETLIPL--------------
SELO_CORGL        CAFMERYRGDAKFSSIDTYGR-YKFENQPMILGWNMARLVETLLPL--------------
F8DYD1_CORRG      CAFVDNFDPAAKFSSIDTAGR-YAFGQQPTIAMWNIARLAEALCGTDLSLGTKT------
C0XSD3_CORLD      CAFTERFAPAAKFSSIDSTGR-YAFGNQPNIIAWNLTRLAEAL-----------------
SELO_SYNE7        WAFLDRFDPKFTAAYFDHSGR-YRYENQPGICQLNLELLQVPLGMV--------------
SELO_GLOVI        YAFIDRFDPGFTAAYFDHYGR-YSYGNQPLVCRINLEALQLPLSMV--------------
SELO_NOSS1        YAFIPTYNPYFTAAYFDYYGR-YCYIQQPSICQWNLEMLQVPLRAV--------------
SELO_TRIEI        YSFIPTYNPKFTAAYFDYSGL-YRYSHQPLVCKSNLQLLQEALAAV--------------
SELO_SYNY3        YGFVPTYDLNFIAAYFDYGGR-YRFGNQPAVCRWNLERLQVSLSSV--------------
SELO_THEEB        YAFLERYDLGFTAASFDYYGR-YAYGNQPAICAWNLEKLQIPLSWV--------------
U2Y3Q0_9SPHN      WRWLPQWEMGFTAAYFDHSGL-YAFGRQVEALSWNCAQLAVALRPL--------------
G2IMV9_SPHSK      WRFAPRWQPGFTAAYFDQSGL-YAFGRQAEAIHWDVAQLAQSLVEL--------------
J7QWA4_METSZ      WRFAPVYDPTFTAAYFDESGL-YAFGRQPGALGWNLSRLAECLIPL--------------
V2U0A1_9GAMM      YGFMERFRPNWINNHSDHQGR-YSYQNQPSIGHWNLWVWINNLVPLAKA-----------
F0KNV3_ACICP      YGFMERFRPNWINNHSDYQGR-YTYQNQPSIGHWNLWTWLNNLIPLAEP-----------
D5VAL7_MORCB      FAFMEGFNPTWINNHSDHTGR-YVYQNQPTIGHWNLAVVYHHFKRLVN------------
B4WTR0_SYNS7      FGFCEIFDPWFQPWTGG--GEHFSFFNQPSAAEANYHMFWQSVRPLLE------------
K9P6B2_CYAGP      FGFCELFDPRFQPWTGG--GQHFSFFNQPVAAEANFQMFWASLRPLLEG-----------
W7QRM2_9ALTE      FGFCELFEPMFQPWTGG--GRHFAFLNQPYAAEANYKMFCRSLEPLLQS-----------
SELO_MORMI        FGFCDVFNPYYQPWTGG--GNHFSFMNQPNAAQRNFDMFCSALRPLLVS-----------
SELO_SCHPO        FGFLDVYNPSFTPNHDDVFLR-YSYRNQPDIIIWNLSKLASALVELIGACDKVDDLQYME
SELO_YEAST        FAFLDKFEPSFTPNHDDTAKR-YSFANQPSIIWWNLQQFAKDLACLLGPEARDLELLLKG
                                  .     : :  *      :       .                 

SELO_PSEPK        -----------------VEPLKEALGLFLPLYQAHYLDLMRRRLGLTTAEDDDMV-----
SELO_PSESM        -----------------VEALRETIGLFLPLYQAHYLDLMRRRLGLTVAQDQDDK-----
SELO_PSEAE        -----------------VDELRASLDLFLPLYQAHYLDLMRRRLGLGVAAENDHA-----
SELO_VIBPA        -----------------REDLEQALSQFEGRLSQQFSRLMRSKLGLKTKIAEDGR-----
SELO_VIBVU        -----------------RDDLELALAQYEPTLGKVFSQLMRQKLGLLSQQEGDSE-----
SELO_VIBCH        -----------------KDDLEAALGSYSERLNLHFSRLMRAKLGLATQQEGDGE-----
SELO_ECOLI        -----------------VDALNEALDSYQQVLLTHYGERMRQKLGFMTEQKEDNA-----
SELO_ECOL6        -----------------VDALNEALDSYQQVLLTHYGQRMRQKLGFMTEQKEDNA-----
SELO_SALTI        -----------------IDALNRALDRYQDALLTHYGQRMRQKLGFFTEQKDDNA-----
SELO_RALSO        -----TDLSDEAQAQPAIDAAQEALLVYRDTYGEAFYARYRAKLGLTQAHDGDEA-----
SELO_SHEON        -----------------SDDLIAALNQYQHALVQHYLALMRAKLGLVQQADSSAEQD---
SELO_XANAC        -----------------QAPLQHGLDRFRDTYLACDRHDTAAKLGLAECRDEDLQ-----
SELO_XANCP        -----------------AAPLQAGLDQFRDTYLACDRRDTAAKLGLAECQDEDLH-----
SELO_XYLFA        -----------------AASLQAGLERFRATYLAAERRDAAAKLGFAACFDEDLE-----
SELO_RHIME        ---------FDPVADTAVNLANDALGEYGTIFQKHWLDGMRRKIGLLTDE----------
SELO_AGRFC        ---------LDPEVEKAAELANAVLADFAAAFPQRWLTGMREKLGLTTEE----------
SELO_BRADU        ---------FGEEQEKAVEQAQDILGAFPETFSKAYQAGLRKKVGLFTER----------
SELO_NITWN        ---------IADGGAKAIECANASIAAFDDHFNAAYLSGMRRKLGLVREM----------
SELO_RUEPO        ---------AEDK-EAVVEEATEIVHAMPELLERAWLEVFAAKIGIARPG----------
SELO_BACAN        ---------LHEDEEEVLKIAQDEISKFSVQYEKQWFLGMKKKLGLFSNE----------
SELO_BACCR        ---------LHEDEEEALKIAQDEISKFSVQYEKQWFLGMKKKLGLFSNE----------
SELO_BACHD        ---------LADDQDEAIKLAEAEISNYAEQFEHHWLNGMRAKLGLFNEE----------
SELO_COLP3        ---------VDSDEDDAVEKIEPLLTQFHQDLQQGYLTMMAAKIGIDEPA----------
SELO_PSEHT        ---------VNDDDEQAVALMTPIIDGFAEQFNVEFSAMWATKLGLAGTD----------
SELO_COREF        ---------FGDTPDAGVDRAQEMINTFTDRYNDALHAELAAGLGLDADA----------
SELO_CORGL        ---------LGATPDEGMTAAQEALVEFDDLCEQAIRKEFATALGLDES-----------
F8DYD1_CORRG      -----SNTDAPITDVLTVDEAAEILHTFPKLYEEALAREFGGPLPAEGE-----------
C0XSD3_CORLD      ------------LPLMGEAAAREILGLIQERWDHFWQLHFAGAEEAIAAA----------
SELO_SYNE7        ---------------MSAADLEAGIAGFGDRYQATYSRLMLRRLGFEAD---QLHS----
SELO_GLOVI        ---------------IPIADLEAGLAIFDTHYAAHYTARMLAKLGFGA-----LGP----
SELO_NOSS1        ---------------IDKADMEAGLAKFSEYCHAEYNSLMLKKLGFEE-----LKT----
SELO_TRIEI        ---------------IDRKNMRSALEKFDDFYLHEYRQLMMRRLGFKK-----LAE----
SELO_SYNY3        ---------------IPSKAMTEALEDYEKIYLGYYITLIARRLGISSTLGDRLDP----
SELO_THEEB        ---------------IPLEEMAAALKTFGDRCQTTYLKLMLKRLGWAD-----LPL----
U2Y3Q0_9SPHN      ---------------AESQPLVAALERFGPLYQQNLVRRFLWRLGVAPL-----SP----
G2IMV9_SPHSK      ---------------AETDALVTSLRRFPEIYVARMSERFLWRLGHDAP-----DG----
J7QWA4_METSZ      ---------------IGLKTAEKVLGTFPTRIQQEFRAALLNRLGLASA-----GE----
V2U0A1_9GAMM      -----------EDREQFKQDLVKALEQFEPKFLAFYQQGLAAKMGLPDFHKD--------
F0KNV3_ACICP      -----------EQKDKFKEELARCLEQFEPIFLEHYGQGLCQKMGLPHFHKD--------
D5VAL7_MORCB      -----------------QDDIDDALMTYQEVFENTYHHGLCQKLGIKPSHQ---------
B4WTR0_SYNS7      -------------DAEALEQFDQVRRGFAEAMQQQFQKIWAAKLGLTEFNPE--------
K9P6B2_CYAGP      -------------NTEALAKLDQLREGFAEAMGQELDAMWASKLGLITYDAE--------
W7QRM2_9ALTE      -------------TPEALAQLEQICAEFKPIMQQKLEKMWSQKLGLAQYNSE--------
SELO_MORMI        -------------HQQDLLAFDEIQSEFLAVMDTKMKAMWATKLGLINLKTESDKA----
SELO_SCHPO        QLHN-STDLLKKAFAYTSEVFEKIVEEYKNIVQNDFYDLMFKRVGLPSDSSN--------
SELO_YEAST        ELNSVDDALEKTMIERVQKLVELSANEYKYVFTTRYAQIMSQRLGVDLDLEKCMSSTNLK
                                                                              

SELO_PSEPK        ---------------LVERLLQCMQRGGVDYSLFFRKLGEQ-----PVAEALKV-ARDDF
SELO_PSESM        ---------------LVSQLLQLMQNSGVDYTLFFRRLGDQ-----PAAQALRA-LRDDF
SELO_PSEAE        ---------------LVQELLQRMQGSAVDYSLFFRRLGEE-----TPERALAS-LRDDF
SELO_VIBPA        ---------------LFESMFELLNQNHTDYTRFFRALSNL-----DKQPA-QE-VIDLF
SELO_VIBVU        ---------------LFNAMFALLAENHTDYTRFFRTLSQL-----DREDE-QT-VIDLF
SELO_VIBCH        ---------------LFADFFALLANNHTDYTRFLRELSCL-----DRQGN-EA-VIDLV
SELO_ECOLI        ---------------LLNELFSLMARERSDYTRTFRMLSLT-----EQHSAASP-LRDEF
SELO_ECOL6        ---------------LLNELFSLMARERSDYTRTFRMLSLT-----EQHSAASP-LRDEF
SELO_SALTI        ---------------LLNELFSLMAREGSDYTRTFRMLSHT-----EQQSASSP-LRDTF
SELO_RALSO        ---------------LFGDLFKLLHTQRADYTLFFRHLADVRRDDTPAQAQART-VRDVF
SELO_SHEON        ----------QQDLELIGRFTVLMEKNQLDYSHTWRRFGQL-----DPSSLHSS-LRDDF
SELO_XANAC        ---------------LIDALRALMRESEMDMTLTFRGLIDLS---PDHPD-PAQ-LREAF
SELO_XANCP        ---------------LIDDLRALMREAEMDMTLTFRGLVDLS---PQQPD-ASV-LREAF
SELO_XYLFA        ---------------LFDALRTCMHQAEMDMTLTFLGLADWE---PNMPDSLSL-WAEAF
SELO_RHIME        ----------DEDLDLVQSLLTLMQNGKADFTLTFRRLAASAENATADT-----------
SELO_AGRFC        ----------EGDMDLIQSLLSLMQASEADFTLTFRRLSHAANGDAE-------------
SELO_BRADU        ----------DGDEALIQDLLDAMAKNQADFTLTFRRLGDAAGDPAAD------------
SELO_NITWN        ----------EGDLELASDLLTRMSENGADFTLTFRALCGAADDTKGDA-----------
SELO_RUEPO        ----------EGDKALVSELLTRMAREQADFTNTFRALGAP-------------------
SELO_BACAN        ----------EQDQSLIEQLLKMMEKFKADYTNTFRSLTLNT------------------
SELO_BACCR        ----------EQDHSLIEQLLKMMEKYKADYTNTFRSLTLDA------------------
SELO_BACHD        ----------SEDLSLIKDLLEVMHKHKADFTNTFRALTFDE------------------
SELO_COLP3        ----------EGDGKLINDLITLMKEQKLDYTQTFTALTDSLN-----------------
SELO_PSEHT        ----------TADKELIAELLQLLKEHQLDYTNTFDALTESLT-----------------
SELO_COREF        ----------PDTAGLIESYLELMRTHSPDVTTLNRTLSEWSV-----------------
SELO_CORGL        ------------DTGTVEQFRELLYLHNPDITTLLRALTD--------------------
F8DYD1_CORRG      -----------------------------DLRQWWKEAGS--------------------
C0XSD3_CORLD      ----------------------------GDITQFNLDHGL--------------------
SELO_SYNE7        ----------AIADDLIITTLQLLLRAPIGYNEFFARLRAQF------------------
SELO_GLOVI        ----------VLGPELVKATLNYLEAAQAGYHGFFQALAASF------------------
SELO_NOSS1        ----------PEAEELLSLTLKFLQESQVGYHQFFYEMARTF------------------
SELO_TRIEI        ----------ADADKLLQLTIKMLTDSQVGYHDFFLELRQKF------------------
SELO_SYNY3        ----------ELWEKLVGQTLQCLAQSQWSYPDFFAQLRLNF------------------
SELO_THEEB        ----------ELGRSLVVETQAFLSRSLISYPQFFISLRQEF------------------
U2Y3Q0_9SPHN      ----------ERDLQLVATAEAGMRETAASPDLFFFTHQGGR------------------
G2IMV9_SPHSK      ----------ESAQAFVIAAIGALQQSDVAIDRFFFDWRHGP------------------
J7QWA4_METSZ      ----------DADAALAKAFVDFLTVTQAPFERTFFDWRGGM------------------
V2U0A1_9GAMM      ------------SFDCGMAFLKIMQSEQLDYTQSFLLLQ------------DKQ-YRAIQ
F0KNV3_ACICP      ------------SLDCSFAFLRILQTEQLDYTQSFIRLQ------------NKE-YKTLR
D5VAL7_MORCB      ------------AIQLGYRLLMLMQNERLDYTNTFRALIAVADHGENRTQFTHE-YTLLA
B4WTR0_SYNS7      ---------------LFKKLMQLMTQSEVDYTIFFRELSHIPDDISALKKSFYG------
K9P6B2_CYAGP      ---------------LVQDLLQLMVASKVDVTIFFRRLSDIPEHVSALQESFYL------
W7QRM2_9ALTE      ---------------LLIELLQLMVKTSVDYNMFFRQLSQVPQDISSLEISFYQ------
SELO_MORMI        -----------LCNVLIKELQTLMMQAPVDYTIFFRELSSIPDDIGPLKKSFYSNLYNDA
SELO_SCHPO        -------------KILITDLLQILEDYELDMPNCFSFLSRNSPSSMENEEYAAKLMQACI
SELO_YEAST        DIEHAAEKAKEFCDVIVEPLLDILQATKVDYNNFFIHLQNYKGPFFIKDKSDTATLFGAF
                                                                              

SELO_PSEPK        IDLA-------GFDAWGADYLARCGREP-----------------------------GNA
SELO_PSESM        VDIK-------VFDDWAQAYQARIAAEEN----------------------------GTE
SELO_PSEAE        VDRE-------AFDRWAEAYRRRVEEEG-----------------------------GDQ
SELO_VIBPA        IDRE-------AAQAWLDLYLARCELEVDEI--------------------------GEP
SELO_VIBVU        IDRD-------AAHGWLSRYLERVAMEQTAS--------------------------GEA
SELO_VIBCH        LDRE-------AAKTWLTRYLERAARELGQE--------------------------GRP
SELO_ECOLI        IDRA-------AFDDWFARYRGRLQQDE--------------------------------
SELO_ECOL6        IDRA-------AFDDWFARYRGRLQQDE--------------------------------
SELO_SALTI        IDRA-------AFDAWFDRYRARLRTEA--------------------------------
SELO_RALSO        FDRD-------SADAWLAAYRQRLQTEP--------------------------------
SELO_SHEON        IDLN-------EFDAWYQVYQARLGKVT--------------------------------
SELO_XANAC        YDEDKRVADAPQLQQWLQRYAARLQQDP--------------------------------
SELO_XANCP        YDETKRAAQAPALGAWLQRYAARCLQDG--------------------------------
SELO_XYLFA        YDPVKRDAQAPMLRDWLQRYAARLSVDP--------------------------------
SELO_RHIME        -ELASLFEEPQALSPWLEHWRRRLEREPQ-------------------------------
SELO_AGRFC        -PFRGMFIDIAGADAFLTRWRERAGREGI-------------------------------
SELO_BRADU        -DARAEFMDPAAFDEWARRWRERLAAEPQ-------------------------------
SELO_NITWN        -EVRGLFADPSAFDQWTERWRQRLSLEGQ-------------------------------
SELO_RUEPO        -RARDQFTDPTAYDSWAEDWRQRLTQEAT-------------------------------
SELO_BACAN        -IENTALFESPEFKEWYKLWQSRLERQEE-------------------------------
SELO_BACCR        -IENTALFESPEFKEWYKLWQSRLDRQEQ-------------------------------
SELO_BACHD        -QEETGLHDKLEFTEWHERWQARLGRQEQ-------------------------------
SELO_COLP3        -DNTTEEPLTDVLNEWLPHWNSRIESF---------------------------------
SELO_PSEHT        -GGMS---IPEVLVQWAGKWQKRTDD----------------------------------
SELO_COREF        -----ESTPPAGFEEWIPRWLAAQPDL---------------------------------
SELO_CORGL        -----NTAPPSGFEAFVHDWKTQDPDI---------------------------------
F8DYD1_CORRG      ------------------------------------------------------------
C0XSD3_CORLD      ------------------------------------------------------------
SELO_SYNE7        ----QPSWRSDLSAILPDWITTDLEALPE-------------------------------
SELO_GLOVI        ----DRSWQSDQGA-----IPAPVVGAPE-------------------------------
SELO_NOSS1        ----SIKWRDEPGLVLSG-SDIVPPSGTD-------------------------------
SELO_TRIEI        ----SPEWRDDISQIFA---DFEQP-----------------------------------
SELO_SYNY3        ----SPSWRDNADLI------LENVDLLG-------------------------------
SELO_THEEB        ----SPEWAADVGHLFSG--SPTLTPADQ-------------------------------
U2Y3Q0_9SPHN      ----AAQGELA-------------------------------------------------
G2IMV9_SPHSK      ----RADGPYAGTP----------------------------------------------
J7QWA4_METSZ      ----ASAERAKRSPSATH------------------------------------------
V2U0A1_9GAMM      D-----DCLNTRQVENFLQQYHTIRENQD-------------------------------
F0KNV3_ACICP      D-----DCLDIRQFDEFLSQYQSIREHQD-------------------------------
D5VAL7_MORCB      NLTNILSATSYDIWQNWVNDYLDCLKQQS-------------------------------
B4WTR0_SYNS7      ---KPLQQLEEQWQSWLKSWRDLVINDGNL------------------------------
K9P6B2_CYAGP      ---PCSEELDAQWTSWLQRWRAQVTSSGDP------------------------------
W7QRM2_9ALTE      ---SATAELKQQWINWLEKWQIQTKVAAEP------------------------------
SELO_MORMI        ADDPDTLALEKYWIEWLEKWQMLLNSTCDAKG-------------------------ISS
SELO_SCHPO        CLNPNNERVRNESVKAFTNWVGRYSEATKTQ-----------------------------
SELO_YEAST        DEEYLGMFFNSKQLQQMAETEEAFAAGEKVFDANGELRLLNEKLQEIRNWTQDYLTLVPP
                                                                              

SELO_PSEPK        EGRRER---MHAVNPLYVLRNYLAQKAIEAAE------------AGDYSEVRRLHQVLAR
SELO_PSESM        QARKER---MHAVNPLYILRNYLAQNAIEAAE------------KGDYEEVRRLHQVLCT
SELO_PSEAE        ESRRRR---MHAVNPLYVLRNYLAQQAIEAAE------------QGDYTEVRLLHQVLSR
SELO_VIBPA        ISAEQRSEQMRQTNPKYILRNYLAQLAIDKAE------------EGDFSEVHRLAEILRH
SELO_VIBVU        KSAQQRCEQMRAVNPKYILRNYLAQQAIDKAQ------------QGDFSEVHTLAKLLKN
SELO_VIBCH        ISTRERCQAMRQVNPKYILRNYLAQQAIEFAE------------RGDFEEMQRLATVLAS
SELO_ECOLI        VSDSERQQLMQSVNPALVLRNWLAQRAIEAAE------------KGDMTELHRLHEALRN
SELO_ECOL6        ITDSERQQLMQSVNPALVLRNWLAQRAIEAAE------------KDDMTELHRLHEALRN
SELO_SALTI        VDDALRQQQMQRVNPAIVLRNWLAQRAIDAAE------------QGDMAELHRLHEVLRQ
SELO_RALSO        APDAARAEAMRRVNPKYVLRNHLAEIAIRRAG------------EKDFSEVENLRAVLAR
SELO_SHEON        -DVEAWQQQCNRVNPKYILRNYLAQEAIIAVD------------EGNLAQLQRLHQVLRQ
SELO_XANAC        LPPDARRARMRLANPRYVLRNYLAQQAIDRAE------------QGDPSGVQELLEVMRH
SELO_XANCP        ASDAVRASRMRAANPRYVLRNYLAQQAIDQAE------------QGDLSGVHALLEVMQR
SELO_XYLFA        LPVAERHERMRLANPRYVLRNYLTQQAIECAE------------QGDLIELHALLEVMRR
SELO_RHIME        -PATERAAAMRSVNPAFIPRNHRVEQAIAAATE-----------DADFSLFEALLDVTSR
SELO_AGRFC        -SDSERSAAMLSINPAIIPRNHRIEELIEAAVE-----------DGDFEPFHAMLTAIAT
SELO_BRADU        -SAAERQTAMNAVNPLFIPRNHRVEAVIQAAVN-----------DDNYALFEELVKVLAK
SELO_NITWN        -SAEVRRTDMLSVNPMFIPRNHRIEAAIRDA-E-----------AGRFETFHELVEVLSH
SELO_RUEPO        -PE----AVIRAANPAFIPRNHRIEQMITAA-V-----------EGDYTLFERLNTVLAR
SELO_BACAN        -SKENAYEMMKNNNPSIIPRNHRVEEALEAAVT-----------NGDYSVMEKLLEALSN
SELO_BACCR        -SKENAYEMMKNNNPSIIPRNHRVEEALEAAVT-----------NDDYSVMEKLLEALSN
SELO_BACHD        -TKDDSHNLMKMSNPAVIPRNHRVEEALEAAVE-----------QEDYQVMERLLKVLAN
SELO_COLP3        --KSSAHTLMVSNNPIVIPRNHHVEAFLDSCQE-----------TGDLTALNKFLAVLRQ
SELO_PSEHT        ----RSYTVMRAANPRVIPRNHVIEKILSEYNK-----------TGSSELLHEFMQVMHT
SELO_COREF        -------INMQKTNPVYVPRNHLVEDALAEAV------------EGRWEAFTTLLGLVTD
SELO_CORGL        -------EAMRAVNPLFIPRNHLVEAALADAV------------EGNLEKFHELLAAVTN
F8DYD1_CORRG      --------ARNDYLELAIPRNFEIEQAIEAAA------------AGDVSVGAELVASIRE
C0XSD3_CORLD      --------PVGR-APIFIPRNHMLQRAITSAER-----------DGDLGPYFELLRAVTD
SELO_SYNE7        -AQWQGWRDRYHQLLTHLPESQLPLIQQQLAQA-----------NPEIAPIRPVVESVWD
SELO_GLOVI        -A-FELWRESYFRALASLSDSELLRVGERLNRH-----------NPTTVLLRPAIEAVWA
SELO_NOSS1        -ANFDNWCVLYHKILNNFDYEQVKIIAQNLTHY-----------NPKTSLLRPTIEEAWE
SELO_TRIEI        -ELIDPWRQYYYHLLQTYSDNELEEMTERLQQY-----------NPQQSLIRPVIESVWE
SELO_SYNY3        -ADWSTWRSIYQQVLKQLPPESLAAVPTVLEQA-----------NPLTDLLRPRIETVWQ
SELO_THEEB        -KLLEAWKRCYFERLQQATPPQRVAIPQTLRAA-----------NPLVIVTRPHIEQIWQ
U2Y3Q0_9SPHN      ------------DALQGFQPLE---RNDSYWSG-----------NHPEALLIDEVEAICS
G2IMV9_SPHSK      -------WETVRDAMAPLIPRPGA-LDHDYWRG-----------GAPCSMHIDEVEAIWS
J7QWA4_METSZ      --YEAEAFMPLHAALAEHRPAPTARLDHPYFQR-----------AAPCTMLIDEVEALWA
V2U0A1_9GAMM      -TQQLD-AAMRLVNPRYILRNHMAQTAIEAAQ------------RDDFSEVERLFDLLAQ
F0KNV3_ACICP      -TDELD-ANMQKANPIYILRNHMAQRAIEAAE------------RDDFSEVDRLFKLLNH
D5VAL7_MORCB      -TKQTAIKTLQQTNPIYILRNHMAERAIVSAH------------QGDFDEVARLFALLDN
B4WTR0_SYNS7      ---AEISAKMKQTNPKYAWREWLIVPAYQQAM------------QGDYTFVKELQEVLSY
K9P6B2_CYAGP      ---GETAAAMQRVNPAVTWREWLIAPAYEQAA------------QGDYGLVRELQKVFRH
W7QRM2_9ALTE      ---TVLSAHMKGINPKYTWREWLVVPAYQQAE------------SGDYSLISKLQQVLTN
SELO_MORMI        RASEDIAMQMKLVNPKYVLREWFVMPAYQQAT------------AGDYSLIQELQAVMTQ
SELO_SCHPO        -EDSSRLASMKKVNPHFTLRNWVLEEVIKEAY------------IGKFELFKKVCKMAAC
SELO_YEAST        TETAARASLAKKANPLFVPRSWVLEEVVDDLMYSQRDGLQDPSSELDTSALKKLYLMSVN
                                                                              

SELO_PSEPK        PFE----EQPGMQAYAERPPEWGKHLE----ISCSS------
SELO_PSESM        PFT----EQPGMEGYAQRPPDWGKHLE----ISCSS------
SELO_PSEAE        PFE----EQPGMERFTRRPPDWGRHLE----ISCSS------
SELO_VIBPA        PYD----SQPEFEAYAKLPPEWGKKME----ISCSS------
SELO_VIBVU        PYD----EQAEMEAYAHLPPEWGKKMV----ISCSS------
SELO_VIBCH        PYA----EHPEFERYAKLPPEWGKKLE----ISCSS------
SELO_ECOLI        PFS----DRD--DDYVSRPPDWGKRLE----VSCSS------
SELO_ECOL6        PFS----DRD--DDYVSRPPDWGKRLE----VSCSS------
SELO_SALTI        PFT----DRD--DDYASRPPEWGKRLE----VSCSS------
SELO_RALSO        PFD----DHPGFEHYAGPAPDWAASLE----VSCSS------
SELO_SHEON        PFT----EQIEHEELAKRPPDWGQGLI----MSCSS------
SELO_XANAC        PYD----DQPGRDAFAARRPEWARDRAGCSMLSCSS------
SELO_XANCP        PYD----DQPRRESFAAKRPDWARDRAGCSMLSCSS------
SELO_XYLFA        PYD----FQLGREAYAMRRPEWARSRIGCSMLSCSS------
SELO_RHIME        PYE----DQPGHAAYAAPPEPG-EEVLQTFCGT---------
SELO_AGRFC        PFE----ERPDNFVYMQPPMSH-ERVFRTFCGT---------
SELO_BRADU        PYE----DQPDYAAYADPPLPD-QRVLQTFCGT---------
SELO_NITWN        PFD----DQPKFAGYAKPPRPE-EEVRQTFCGT---------
SELO_RUEPO        PYA----DQPDHIDLTRPPSAS-EIVPATFCGT---------
SELO_BACAN        PYA----YATEQEEYCVPPVPT-NRPYRTFCGT---------
SELO_BACCR        PYA----YSTDQEEYCAPPAPT-NRPYRTFCGT---------
SELO_BACHD        PFA----HSPEQKAYAKLPAPC-AIPYRTYCGT---------
SELO_COLP3        PYT----EIAETKNYQDAPVDG-DKDYHTFCGT---------
SELO_PSEHT        PYE----NTDKLAKFQDAPSS--DKEYYTFCGT---------
SELO_COREF        PFT----RQAGMEVYERPGPDGFEDTYMTFCGT---------
SELO_CORGL        PFD----PTAGPDELRLPSEEGFEEDYMTFCGT---------
F8DYD1_CORRG      KKW----QDPGPP----AEDAG---PYVTYCGT---------
C0XSD3_CORLD      PFN----PAAGPEWMKGPEGDE---LFVTYCGT---------
SELO_SYNE7        PIA----IDDNWEPLEALLNRWRHDGDGAADGVVVPNAN---
SELO_GLOVI        AID----QNDDWQPFYDLIGRLRKPYAIA-------------
SELO_NOSS1        PIV----QEDNWQPFYDLVKSIQSRG----------------
SELO_TRIEI        AIT----LEDNWQPFYDLLQQIYD------------------
SELO_SYNY3        AIA----EDDNWQPFNDLVQKLQSGN----------------
SELO_THEEB        AID----QEDDWSRFRATLELMQV------------------
U2Y3Q0_9SPHN      PID----SHDDWSTLETKIAAIRRMGNAMGDPLPPAGQKPIG
G2IMV9_SPHSK      AIA----ERDDWTPLAAKVDAVRAMGAAHGAPPPAPGRI---
J7QWA4_METSZ      AIA----ERDDWTPLYAKIAAIDEMRSAYE------------
V2U0A1_9GAMM      PFT----HQPERERPADLAPLPSDVPDVMVSCSS--------
F0KNV3_ACICP      PYT----RQPELEQPQDLGPLPSDVPDVAVSCSS--------
D5VAL7_MORCB      PYQ----QQTI--ATVDDTRMAFANETVAVSCLS--------
B4WTR0_SYNS7      PYDEQ--SQEVEDKYYRLQPKAFSNVGGVSHYSCSS------
K9P6B2_CYAGP      PYDAL--PTELAATYDRLKPREFFNAGGVSHYSCSS------
W7QRM2_9ALTE      PYDEQ--AEEIEKQFYRLRPTELFGIGGISHYSCSS------
SELO_MORMI        PYAEQ--SKELEDKYYRLKPLEFFEVGGLSHLSCSS------
SELO_SCHPO        PFEDT--WGFSKEEEDYLCYNTTPSKSQIQCSCSS-------
SELO_YEAST        PYDRTKWDVTLRPELETKWADLSHQDDAKFMMQASCSS----