CLUSTAL format seed alignment for MF_00693

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y541_BACAN       ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGE-PD-PESNQALRVVLERAK
Y539_BACCR       ---MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGE-PD-PESNQALRVVLERAK
YEEI_BACSU       ---MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGE-PD-PESNQALKVVLERAK
Y3259_BACHD      ---MGRKWNNIKEKKAAKDKNTSRIYAKFGREIYVAAKQGE-PD-PELNQALKFVLERAK
Y669_STAAM       ---MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGE-PN-PESNQALRLVLERAK
Y388_LISIN       ---MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGD-PD-PHSNQKLRFVIERAK
Y369_LISMO       ---MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGD-PD-PHSNQKLRFVIERAK
Y2866_ENTFA      ---MGRKWANIKEKKAAKDANNSRVYAKFGIEIYVAAKSGD-PD-PHANQKLRFVIERAK
YEEN_ECOLI       ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGE-PD-PELNTSLKFVIERAK
YEEN_SHIFL       ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGE-PD-PELNTSLKFVIERAK
YEEN_ECO57       ---MGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGE-PD-PELNTSLKFVIERAK
YEEN_SALTI       ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGE-PD-PESNSALKFVIERAK
YEEN_SALTY       ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGE-PD-PESNSALKFVIERAK
YCDB_LACLA       ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGE-PD-PESNSSLKFVIERAK
Y1691_STRA3      ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQGE-PD-PESNSALKFVLDRAK
Y316_STRP1       ---MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGE-PD-PELNTALKFVIDRAK
Y1789_STRMU      ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQGE-PD-PESNSALKFVLERAK
Y1922_STRPN      ---MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGD-PD-PESNSALKFVIDRAK
Y2806_VIBCH      ---MGRSFEVRKASMAKTQGAKIKVYSKYGKEIYVCAKNGG-TD-PDMNLSLRHLITKAK
Y5184_VIBVU      ---MGRSFEVRKASMAKTAGAKIKVYSKYGKEIYVCAKNGG-ID-PDMNLSLRHLITKAK
Y4011_VIBPA      ---MGRSFEVRKASMAKTAGAKIKVYSKYGKEIYMCAKNGG-SD-PDMNLSLKHLIAKAK
Y162_HELPY       ---MGRAFEYRRAAKEKRWDKMSKVFPKLAKAITLAAKDGG-SE-PDTNAKLRTAILNAK
Y162_HELPJ       ---MGRAFEYRRAAKEKRWDKMSKVFPKLAKAITLAAKEGG-SE-PDTNAKLRTAILNAK
Y1172_CAMJE      ---MGRAFEYRRASKEARWDKMSKLFPKLAKAIQVAAKEGG-TD-PDMNPKLRSAIATAK
Y627_BACTN       ---MGRAFEYRKAAKLKRWGHMAKTFTRLGKQIAIAVKAGG-PE-PENNPTLRSVIATCK
Y3727_AGRFC      -MAGHSQFKNIMHRKGKQDSVRSKMFSKLAREITVAAKTGM-PD-PNMNARLRLAIQNAK
Y2753_RHIME      -MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKTGL-PD-PTMNPRLRLAIQNAK
Y3945_RHILO      -MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKSGT-PD-PSMNPRLRLAIQNAK
Y321_BRUME       -MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGL-PD-PAMNPRLRLAIQNAK
Y1534_BRADU      -MAGHSQFKNIMHRKGRQDAQKSKLFGKLAREITVAAKLGT-PD-PAMNPRLRAAVIAAR
Y3243_CAUVC      -MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGL-PD-PAMNPRLRLAVNNAK
Y681_RICCN       -MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGS-SNNPENNPRLRNALTAAR
Y455_RICPR       -MAGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGA-SNVPENNPRLRKALNAAR
YEBC_ECOLI       -MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGG-GD-PDANPRLRAAVDKAL
YEBC_ECOL6       -MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGG-GD-PDANPRLRAAIDKAL
YEBC_SALTY       -MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGG-GD-PDANPRLRAAVDKAL
Y2055_YERPE      -MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGG-GD-PGANPRLRAAIDKAL
Y315_HAEIN       -MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGG-GD-VSANPRLRAAVDKAL
Y980_PASMU       -MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGG-GD-VNANPRLRTAVDKAL
Y2432_SHEON      -MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVSAREGG-SD-PDSNPRLRIAIDKAL
Y1214_PSEPK      -MAGHSKWANIKHRKERQDAKRGKVFTKWIRELTVAAKQGG-PD-PASNPRLRLALDKAL
Y3980_PSESM      -MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGG-GD-PGSNPRLRLALDKAL
PMPR_PSEAE       -MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAARQGG-GV-PADNPRLRLAVDKAL
Y1566_COXBU      -MAGHSKWANIKHAKARQDAKRGKVFTKLIREITVAARLGG-ED-IDSNPRLRAVVDKAF
Y1902_NEIMA      -MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGG-GD-PGANPRLRLALEKAA
Y1648_NEIMB      -MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGG-GD-PGSNPRLRLALEKAA
Y210_NITEU       -MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARLGG-GD-PNSNPRLRLAMDKAF
Y2190_RALSO      -MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAARLGG-GD-VDSNPRLRLAIDKGT
Y3151_XANAC      ----MGRGPSIEGRKNASDAKRGKMFTKIIREISVAARAGG-GD-PSNNPRLRTAMDKGL
Y3027_XANCP      ----MGRGPSIEGRKNASDAKRGKIFTKIIREISVAARAGG-GD-PSNNPRLRTAMDKGL
Y1906_XYLFA      ----MGRGPSIEARKNASDSKRGKIFTKIIRQIGVAARAGG-GD-PSNNPSLRVVIDKAL
Y885_XYLFT       ----MGRGPSIEARKNASDSKRGKIFTKIIRQIGVAARAGG-GD-PSNNPSLRVVIDKAL
Y1575_AQUAE      -MAGHSHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGG-PN-PEFNPRLRTAIEQAK
Y1661_FUSNN      -MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGG-GD-PNFNPRLRLAIEKAK
Y025_BORBU       -MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGG-GD-IESNPRLRVAVNKAK
Y720_LEPIN       -MSGHSKWATIKRKKDAIDSKRGAIFTRVGKEITVAAKMGG-GD-PEGNPRLRLAILKAK
Y1665_CHLTE      -MSGHSKWATIKRKKAATDQKRGSLFTKLVKEITIAAKMGG-GD-PTGNPRLRLAIDTAR
Y474_TREPA       -MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISVAARMAG-GD-PQANPRLRTAILKAR
YRBC_BACSU       -MAGHSKWKNIQKRKNAQDAKRGKIFMKLAKEIYVAAKEGG-AD-PEANSALRLVIEKAK
Y2038_OCEIH      -MAGHSKWKNIQKRKNAQDAKKGKIFMRHAKDIYIAAKQGG-GD-LGTNAALRTAVEKAK
Y663_ENTFA       -MSGHSKWSNIQGRKNAQDAKRGKIFQKVSREIYMAAKAGG-PD-PAMNPALRLAVDKAK
Y2253_LACPL      -MSGHSKWHNIQGRKNAQDAKRGKVFQKISRELYMAVKAGG-PD-PDSNAQLRLVMDKAK
Y1570_LISIN      -MAGHSKWNNIQGRKNAQDSKRSKVFQKLAREIFVAAKKG--PD-PNLNPSLRLVMDKAK
Y1535_LISMO      -MSGHSKWNNIQGRKNAQDSKRSKVFQKLAREIFVAAKKG--PD-PSLNPSLRLVMDKAK
Y2295_CLOAB      -MSGHSKWHNIQAKKGKADAKRGKVFTKIGKEIAVAVKTGG-AN-LDANSKLRDCVAKAK
Y2215_CLOTE      -MSGHSKWHNIQAKKGKMDAKRGKIFTKIGRELIIASKEGG-SN-PDTNSKLRDVIAKAR
YU82_HATHI       -MSGHSKWHNIQAKKSKVDAKRGKIFTKIGKEIAIAAKNGG-PN-PDANPKLRDVIAKAK
Y1954_CLOPE      -MSGHSKWHNIQAKKGKMDAKRGKIFTKIGKEIAVAVKEGG-AN-LDGNSRLKDAVAKAK
Y466_THEMA       -MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGG-GN-IETNPRLRAAVERAR
Y1135_CALS4      -MAGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGG-GD-PETNSKLKLAIERAK
Y4276_NOSS1      -MAGHSKWANIKRQKAVVDAKKGKTFTQLSRAIILAARSGV-PD-PSGNFQLRTAIDKAK
Y989_SYNY3       --MGGRKWQSIKRQKARVDAQKGKTTTQLSRAIIVAARQGI-PD-PAGNFQLRTAIEKAR
Y175_THEEB       -MAGHSKWANIKRQKARVDAQKGKIFARLSRAIIIAARHGG-GD-PAGNFQLRSAIEKAK
Y1776_COREF      -MAGHSKWATTKHKKAANDAKRGKEFAKLVKNIEVAARMGG-GD-PSANPTLDDMIKKAK
Y1663_CORGL      -MSGHSKWATTKHKKAANDAKRGKEFAKLIKNIEVAARTGG-GD-PSANPTLDDMIKKAK
Y475_MYCLE       -MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGG-GD-PVGNPTLYDAIQKAK
Y2603_MYCTU      -MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGG-GD-PAGNPTLYDAIQKAK
Y6832_STRAW      -MSGHSKWATTKHKKAVIDAKRGKLFAKMIKNIEVAARTGG-AD-PAGNPTLFDAIQKAK
Y1521_STRCO      -MSGHSKWATTKHKKAVIDAKRGKLFAKLIKNIEVAARMGG-VD-IEGNPTLYDAIQKAK
Y726_BIFLO       -MSGHSKWATTKHKKAAIDAKRGKLFAKLIKNIEIAARLGG-GD-PDGNPSLYDAIYKAK
Y266_TROWT       -MSGHSKWATIKRKKAVNDAQRSKNFAKLIRLIEVAAKQGG-PD-LAGNPGLAEAVQKAK
Y2548_DEIRA      -MAGHSKWAQIKRKKGANDKKRSAMYSKHIRAIQAAVRSGGSGD-PAGNLSLKNAIAAAK
Y742_CHLMU       -MAGHSKWANTKHRKERADHKKGKIFSRTIKELISAVKMGG-PD-PKSNARLRMIIQKAK
Y457_CHLTR       -MAGHSKWANTKHRKERADHKKGKIFSRTIKELISAVKMGG-PD-PKSNARLRMIIQKAK
Y169_CHLCV       -MAGHSKWANTKYRKERADHKRGKIFSRTIKELMAAVKMGG-PD-PKTNARLRVVIQKAK
Y573_CHLPN       -MAGHSKWANTKHRKERADHKKGKIFSRIIKELISAVKLGG-AD-PKSNARLRMVIQKAK
Y472_MYCH2       -MAGHSKWANIKHRKGAQDALKAKIFNKFSKEIMVAVAKGG-SD-PNSNPALRLIISKAR
Y624_MYCPU       -MAGHSKWANIKHRKGAQDAARAKIFQKFAKEIYVAAVAGG-PD-VDSNPALRLAVNKAK
Y332_MYCGE       ----MPRKHLIANQTNKKQQTSAKQLQKLAKRIASAVKKGG-TN-IQSNPHLKVAVDLAL
Y478_MYCPN       ----MPRKHLIASQTNKKQQSNAKQLQKLAKRIAAAVKKGG-SN-IDANPQLKVAVELAL
Y802_MYCPE       ----MPRKHLIASGINKKQQTQAKLGNKLAKEIKAAAKVGG-PN-PEANPRLKAAIDKAL
Y295_UREPA       ----MPRKHLIASGINKKQQQQAKIWMKCAKEIKAAAKMGG-PN-PEANSRLKVAIERAL
                                            :    :  .   .        *  *   :    

Y541_BACAN       TYNVPRTIIDRAVEKAKGGS--E-ENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRA
Y539_BACCR       TYNVPRTIIDRAVEKAKGGS--E-ENYDELRYEGFGPNGAMVIVDTLTNNVNRTAADVRA
YEEI_BACSU       TYSVPKNIIERAIEKAKGGA--E-ENYDELRYEGFGPNGSMIIVDALTNNVNRTAPEVRA
Y3259_BACHD      TYNVPKAIIERAIEKAKGGS--D-ETFDELRYEGFGPSGSMVIVDALTNNVNRTASEVRA
Y669_STAAM       TYSVPNHIIEKAIDKAKGAG--D-ENFDHLRYEGFGPSGSMLIVDALTNNVNRTASDVRA
Y388_LISIN       TYNVPKHIIDRAIEKAKGTG--D-ETYSELRYEGFGPNGSMIIVDALTNNVNRTASDVRA
Y369_LISMO       TYNVPKHIIDRAIEKAKGTG--D-ETYSELRYEGFGPNGSMIIVDALTNNVNRTASDVRA
Y2866_ENTFA      TYNVPKHIIDRAIEKAKGSA--D-EQYSELRYEGFGPNGSMVIVDALTNNVNRTAADVRA
YEEN_ECOLI       QAQVPKHVIDKAIDKAKGGG--D-ETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRT
YEEN_SHIFL       QAQVPKHVIDKAIDKAKGGG--D-ETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRT
YEEN_ECO57       QAQVPKHVIDKAIDKAKGGG--D-ETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRT
YEEN_SALTI       QAQVPKHVIDKAIDKAKGGG--D-ETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANIRT
YEEN_SALTY       QAQVPKHVIDKAIDKAKGGG--D-ETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANIRT
YCDB_LACLA       QAQVPKHVIDKAIDKAKGGG--D-ETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANVRT
Y1691_STRA3      QAQVPKHVIDKAIDKAKGNT--D-ETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRT
Y316_STRP1       QAQVPKHVIDKAIDKAKGNT--D-ETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRT
Y1789_STRMU      QAQVPKHVIDKAIDKAKGNT--D-ETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANLRT
Y1922_STRPN      QAQVPKHIIDKAIDKAKGNT--D-ETFTEGRYEGFGPNGSMLIVDTLTSNVNRTAANVRA
Y2806_VIBCH      KDQVPAHVIEKALDKASGGA--G-EDYQPARYEGFGPGGASVIVDCLTDNGNRTYQDVRQ
Y5184_VIBVU      KDQVPSHVIEKALDKASGGG--G-EDYQPARYEGFGPGGISVIVDCLTDNGNRTFQDVRQ
Y4011_VIBPA      KDQVPAHVIEKALDKANGGG--G-EDYVPARYEGFGPGGTSVIVDCLTDNGNRTFQDVRQ
Y162_HELPY       AQNMPKDNIDAAIKRASSKE----GNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKS
Y162_HELPJ       AQNMPKDNIDAAIKRASSKE----GNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKS
Y1172_CAMJE      ANNMPKDNIDAAIKRASGKD--S-ADIKNIHYEGKAAHGALVIVECMSDNPTRTVANVKA
Y627_BACTN       RENMPKDNIERAIKNAMGKD--Q-SDYKSMTYEGYGPHGIAVFVDTLTDNTTRTVADVRS
Y3727_AGRFC      AQSMPKDNIERAIKKAS-GA--DSENYDEVRYEGYGPGGVAVVVEALTDNRNRTASNVRS
Y2753_RHIME      AQSMPKDNIERAVKKAA-GG--DAENYEEVRYEGYGPGGVAVIVEALTDNRNRTASNVRS
Y3945_RHILO      AVSMPKDNIQRAINKAS-MG--DAENYEAVRYEGYGPGGVAVIVEALTDNRNRSASNVRA
Y321_BRUME       AQSMPKDNIERAIKKAA-GN--DGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRA
Y1534_BRADU      AENMPKDNIERAIKKAL-GS--DGENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRS
Y3243_CAUVC      AESLPKDVIERAIKKSQ-MG--DAADYSEIRYEGVAAGGVGIIVEVLTDNKNRAAANVRS
Y681_RICCN       SQNLPKERIDKAINSANDSS--NNENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRS
Y455_RICPR       SQNLPKERIDKAINSANDAS--NNESYMEIRYEGYAPNGIAIIVEALTDNKNRTASEVRS
YEBC_ECOLI       SNNMTRDTLNRAIARGVGGD--DDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRH
YEBC_ECOL6       SNNMTRDTLNRAIARGVGGD--DDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRH
YEBC_SALTY       ANNMTRDTLNRAIARGVGGD--EDSNMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRH
Y2055_YERPE      SNNMTRDTLNRAIARGVGGD--EDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRH
Y315_HAEIN       SNNMTRDTINRAIDRGVGGG--DDTNMETKIYEGYGPGGTAVMVECLSDNANRTISQVRP
Y980_PASMU       SSNMTRDTINRAIERGVGGG--DDTNMETKIYEGYGPGGTAVMVECLSDNANRTISQVRP
Y2432_SHEON      GGNMTRDTIERAIKRGAGEL--EGQQLETIIYEGYGPGGTAVMVETMTDNRNRTVSGVRN
Y1214_PSEPK      GANMSRDIIDRAVARGAGTN--ESDNVEELSYEGYGPGGVAIMVEAMTDNRNRTAAAVRH
Y3980_PSESM      GANMTRDTIDRAVARGVGAS--DGDDVEELGYEGYGPGGVAVMVETMTDNRNRTAAAVRH
PMPR_PSEAE       TANMTRDTIDRAIARGVGSN--DADNMVELSYEGYAPSGVAIIVEAMTDNRNRTAAEVRH
Y1566_COXBU      AANMPKDTITRAIKRGAGSG--AGDNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRH
Y1902_NEIMA      ENNMPKDNVQRAIDKGTGNL--EGVEYIELRYEGYGIGGAALMVDCLTDNKTRTVADVRH
Y1648_NEIMB      ENNMPKDNVQRAIDKGTGNL--EGVEYIELRYEGYGIGGAALMVDCLTDNKTRTVADVRH
Y210_NITEU       GHNMPKDNVERAIKRGCGEL--EGVNYEEIRYEGYGISGAAVMVDCMTDNRTRTVAAVRH
Y2190_RALSO      DANMPKDNIQRAIQRGVGGL--EGAHYEEIRYEGYGISGAAIIVDCMTDNRTRTVAEVRH
Y3151_XANAC      SSNMSKDVMERAIKKSTGEL--EGVEYEEVRYEGYAPGGVAVIVDCLTDNRVRTVADVRH
Y3027_XANCP      SSNMSKDVIERAIKKATGEL--EGVEYEEVRYEGYAPGGVAVIVDCLTDNRVRAVADVRH
Y1906_XYLFA      ASNMSKDVIERAIKKAIGEM--EGVQYEEVRYEGYAPGGVAVIVDCLTDNRLRTVSDVRH
Y885_XYLFT       ASNMSKDVIERAIKKAIGEM--EGVQYEEVRYEGYAPGGVAVIVDCLTDNRLRTVSDVRH
Y1575_AQUAE      KANMPWENIERAIKKGAGEL--EGEQFEEVIYEGYAPGGVAVMVLATTDNRNRTTSEVRH
Y1661_FUSNN      AGNMPKDILERAIKKGSGEL--EGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRM
Y025_BORBU       VANMPKDNIEKAIKKGIGGN--EGVEYFEITYEAYAPYGVALMIKCLTDNKNRTSSDVKS
Y720_LEPIN       SVNMPKDNIERAIRKGTGEL--EGVTYEECLYECFGPGGIAIMVSAVTDKKSRTTPEIKS
Y1665_CHLTE      ANSMPMDNIQRAIKRGTGEL--EGATYEEITYEGYGPGGIAIIIETATDNRNRTVADIRH
Y474_TREPA       AANMPKDNIERAIKKGTGEL--SGSSYEELVYEGYAPGGVAVLVEVLTDNKNRAAANVRN
YRBC_BACSU       GANMPNENIDRAIKKAAGGQ--DGSSYEEITYEGYGPSGIAVMVECVTDNKNRTASNVRT
Y2038_OCEIH      ADNMPNDNIDRNIKKATGSL--DGATYEEITYEGYGPGGVAVIVNVLTDNKNRTAAEVRH
Y663_ENTFA       SANMPNDNIARAIKKASSAG--EGEHYDEVTYEGYGPGGVAVLVHALTDNRNRTATNVRV
Y2253_LACPL      AANMPKDNIKRAVDKGSGSG---AENYEEVTYEGYGPGGIAVLVHALTDNKNRTAAAVRS
Y1570_LISIN      AVNMPNDNIKRAIDKAAGNT--SGENYDEVTYEGYAPGGIAVLVHALTDNKNRTSTNVRV
Y1535_LISMO      AVNMPNDNIKRAIDKASGNT--SGENYDEVTYEGYAPGGIAVLVHALTDNKNRTSTNVRV
Y2295_CLOAB      AANMPMDTINRAIKKGAGEL--EGVNYEEIIYEGYGPAGVAMLVNVLTDNKNRSASDVRY
Y2215_CLOTE      ANNMPQDTISRAIKKGAGEL--EGVNYEEMTYEGYGPNGVAFVVSTLTDNKNRTAGNVRA
YU82_HATHI       ANNMPKDSIERAIKKAAGEL--AGVNYEEILYEGYGPDGIAVLVQALTDNKNRSAGNVRH
Y1954_CLOPE      AANMPNDNIQRAIKKAAGEG--DSVNYESIVYEGYGPSGVAVMVEVLTDNKNRSAGNVRS
Y466_THEMA       AENMPKENIERAIKRGTGEL--EGVDYQEVIYEGYAPGGVAVYIRALTDNKNRTAQELRH
Y1135_CALS4      AFNLPSENIQRAIKRGTGEL--GGAKLEEVIYEGYGPAGTAIIVEALTDNKNRTAGEIRH
Y4276_NOSS1      AAGIPNDNIERAIAKGAGTFGGDNASLEEIRYEGYGPGGVAILIEALTDNRNRTAADLRV
Y989_SYNY3       AAGVPNDSIDRAIAKGAGTYEDGESNYEEMRYEGYGPGGVAVLIEALTDNRNRTAADLRA
Y175_THEEB       AAGIPSENIERAIAKGTGTL-DSDAPLEAIRYEGYGPGGVAFLIEALTDNRNRTAADLRA
Y1776_COREF      KASVPNDNIERARKRGSGEE-AGGADWVPIMYEGYGPNGVAVLIECLTDNRNRAATEVRT
Y1663_CORGL      KASVPNDNIERARKRGSGEE-AGGADWMNIMYEGYGPNGVAMLIECLTDNRNRAATEVRT
Y475_MYCLE       KSSVPNGNIERARKRGAGEE-VGGADWQVITYEGYAPNGVAVLIECLTDNRNRAAGEVRV
Y2603_MYCTU      KSSVPNENIERARKRGAGEE-AGGADWQTIMYEGYAPNGVAVLIECLTDNRNRAASEVRV
Y6832_STRAW      KSSVPNKNIDSAVKRGAGLE-AGGADYETIMYEGYGPNGVAVLIECLTDNRNRAASDVRV
Y1521_STRCO      KQSVPNKNIDSAVKRGGGLE-AGGADYETIMYEGYGPNGVAVLIECLTDNRNRAASDVRV
Y726_BIFLO       KASMPADNIARAVKRGAGAE-DGAANYEDIVYEGYAPAGVGLIIECLTDNRNRAAAEVRS
Y266_TROWT       KNSVPNDNIDRAIKRGSGLT-GEHINYVSLVYEVKAFDGVALLVECLTDNKNRCAAGIRS
Y2548_DEIRA      TDTVPADNIENAIKRAVGAG-EGAAEYKEQTYEGYGPGGTAIFIETLTDNVNRTVADIRA
Y742_CHLMU       DQNIPNENIERNLKKASSAD---QKNYEEVTYELYGFGGVGIIVEAMTDNKNRTASDMRV
Y457_CHLTR       DQNIPNENIERNLKKASSAD---QKNYEEVTYELYGFGGVGIIVEAMTDNKNRTASDMRV
Y169_CHLCV       DQNIPNENIERNLKKATSAD---QKNFEDVTYELYGFGGVGIIVEAMTDNKNRTASDMRI
Y573_CHLPN       ENNIPNENIERNLKKATSAE---QKNFEEVTYELYGHGGVGIIVEAMTDNKNRTASDMRI
Y472_MYCH2       AKSMPKSNIEKAIAKGEGST-SNGENFKEIIYSGTLSHGISVIVVILTDNINRAIASLQA
Y624_MYCPU       SKSMPKVNIEKAIAKASGNS-KSSSTYSEYIYSGTVSKGVQILVICLSDNFNRLSSNIKS
Y332_MYCGE       AKGLSMDSIKRNIHGSEKDT----TKISEFCYEIFGPNGVGIIVFGLTDNPNRLLSSLNG
Y478_MYCPN       AHGLSADSIKRNIHGSEKDP----TKLSEFCYEIFGPNGVGIIVFGLTDNPNRLLSSLNG
Y802_MYCPE       QNNLSKESIEKNINGSIKDP----SSLTDAEYEGYGPNGLRIIIKTLSDNDNRTISSLRG
Y295_UREPA       NNNLSRDSIERNINGASKDI----DNLKELTYEGYGPNGLAIIVRALTDNEQRTISAIRG
                    :.   :      .               *.     *  .     :.:  *    :. 

Y541_BACAN       AFSK-NSGNMGVNGSVAYMFDATAVI---------GLEGKTSDEVLEILMEA--------
Y539_BACCR       AFSK-NSGNMGVNGSVAYMFDATAVI---------GLEGKTSDEVLEILMEA--------
YEEI_BACSU       AFGK-NGGNMGVSGSVAYMFDATAVI---------GVEGKTADEALEILMEA--------
Y3259_BACHD      AFGK-NGGNMGVSGSVAYMFDQTAII---------GVQGKTEEDVLELLMEA--------
Y669_STAAM       AFGK-NGGNMGVSGSVAYMFDHVATF---------GIEGKSVDEILETLMEQ--------
Y388_LISIN       AYSK-NGGNMGVSGSVAYMFDNTAIF---------GVEGKDADELLELLMEA--------
Y369_LISMO       AYSK-NGGNMGVSGSVAYMFDNTAIF---------GVEGKDADELLELLMEA--------
Y2866_ENTFA      AFGK-NGGNMGVSGAVSYMFDNTGII---------GFAGDDADEILEYLMEK--------
YEEN_ECOLI       IFNK-KGGNIGAAGSVSYMFDNTGVI---------VFKGTDPDHIFEILLEA--------
YEEN_SHIFL       IFNK-KGGNIGAAGSVSYMFDNTGVI---------VFKGTDPDHIFEILLEA--------
YEEN_ECO57       IFNK-KGGNIGAAGSVSYMFDNTGVI---------VFKGSDPDHIFEILLEA--------
YEEN_SALTI       IFNK-KGGNIGAAGAVSYMFDNTGVI---------VFKGTDPDHIFEILLDA--------
YEEN_SALTY       IFNK-KGGNIGAAGAVSYMFDNTGVI---------VFKGTDPDHIFEILLDA--------
YCDB_LACLA       TFHK-NGGNIGAAGAVSYMFDNTGVI---------VFEGTDPDHIFEILLDA--------
Y1691_STRA3      AYGK-NGGNMGASGSVSYLFDKKGVI---------VFAGDDADTVFEQLLEA--------
Y316_STRP1       AYGK-NGGNMGASGSVSYLFDKKGVI---------VFAGDDADSVFEQLLEA--------
Y1789_STRMU      AFGK-NGGNMGAAGSVSYMFDKKGVI---------VFAGDDADSIFEQLLEA--------
Y1922_STRPN      AFGK-NGGNMGASGSVSYLFDNKGVI---------VFGGEDADAVFEQLLEA--------
Y2806_VIBCH      CFVK-TGAKIGTPGVVAHMFDHQAVF---------QFQGDDEEAILEALMMA--------
Y5184_VIBVU      CFVK-TGAKIGTPGVVAHMFDHQAVF---------QFKGDDEESFLEALMMA--------
Y4011_VIBPA      CFVK-VGAKIGVEGSVSHMFDHQAVF---------QFKGEDDEVILETLMME--------
Y162_HELPY       YFNKTQGASIVPNGSLEFMFNRKSVFECLKN--EVENLKLSLEDLEFALIDY--------
Y162_HELPJ       YFNKTQGASIVPNGSLEFMFNRKSVFECLKS--EVENLKLSLEDLEFALIDY--------
Y1172_CAMJE      IFSK-NGGEVLQNGSLGFMFTRKAVF-------HLEKFAGDLEELELDLIDA--------
Y627_BACTN       VFNK-FGGNLGTMGSLAFLFDHKCMF----T--FKIKDGMDMEELILDLIDY--------
Y3727_AGRFC      IFTK-AGGALGETGSVSFSFDRVGEITYK-----AEVG--DADKVMEAAIEA--------
Y2753_RHIME      TFTK-AGGALGETGSVSFSFDRVGEITYK-----LSAG--DADKVMEAAIEA--------
Y3945_RHILO      AFTK-AGGAMGETGSVSFMWDRVGEIYYP-----ASAG--SADKVMEAAIEA--------
Y321_BRUME       AFTK-SGGSLGETGSVSFMFDRVGEIVYK-----PEAG--DADKVMEAAIEA--------
Y1534_BRADU      FFTK-SGGNLGETGSVSFMFDRTGIIEYD-----RSVA--SDDAVLDAAIEA--------
Y3243_CAUVC      YFTK-MGGNMGATGSVTFNFDRVGQISYP-----AKAA--SEDDMMEAAIEA--------
Y681_RICCN       SFTK-YGGSLGETGSVNYLFNHCGVIQYP-----INIA--SNKDILEAVIEA--------
Y455_RICPR       SFTK-YGGILGETGSVNYLFNHCGVIQYP-----INIA--SNEDIFEAAIQA--------
YEBC_ECOLI       AFSK-CGGNLGTDGSVAYLFSKKGVISFE------KG---DEDTIMEAALEA--------
YEBC_ECOL6       AFSK-CGGNLGTDGSVAYLFSKKGVISFE------KG---DEDTIMEAALEA--------
YEBC_SALTY       AFSK-CGGNLGTDGSVAYLFSKKGVISFE------KG---DEDTIMEAALEA--------
Y2055_YERPE      AFTK-TGGNLGTDGSVSYLFTKKGVISYA------PGL--EEDTVMDAALEA--------
Y315_HAEIN       SFTK-CGGNLGTEGSVGYLFSKKGLILIA------EA---DEDALTEAAIEA--------
Y980_PASMU       SFTK-CGGNLGTEGSVGYLFSKKGLILIT------SG---DEDVIMEAAIEA--------
Y2432_SHEON      AFSK-SGGNLGTDGSVAYLFTKRGVLSYA------PGT--DEDALMDAALEA--------
Y1214_PSEPK      AFTK-CGGNLGTDGSVAYLFERKGQISFA------PGV--EEDALMEAAMEA--------
Y3980_PSESM      AFTK-CGGNLGTDGSVAYLFDRKGQISFA------AGV--DEDSLIEAAMEA--------
PMPR_PSEAE       AFSK-CGGNLGTDGSVAYMFERKGQISFA------PGV--DEEALMDAALEA--------
Y1566_COXBU      AFSK-CDGNLGTEGSVAYLFKQRGLITFP------PNS--DEEKIMEIALEV--------
Y1902_NEIMA      AFTK-NGGNLGTDGCVAFNFVHQGYLVFE------PGV--DEDALMEAALEA--------
Y1648_NEIMB      AFTK-NGGNLGTDGCVAFNFVHQGYLVFE------PGV--DEDALMEAALEA--------
Y210_NITEU       AFTK-HGGNLGTDGSVAYLFKHCGQLLFA------PGV--GEAQLLEAALEA--------
Y2190_RALSO      AFDK-HGGNMGTQGSVAFMFDHVGQFIFA------PGT--PEDKLMDAALEA--------
Y3151_XANAC      AFSK-CGGNMGTEGSVAFMFKRLGVLSFA------AGI--DEDTLTDAAIDA--------
Y3027_XANCP      AFSK-CGGNMGTDGSVAFMFKRLGVLSFA------AGA--DEDAVTEAAIEA--------
Y1906_XYLFA      AFSK-CGGNMGTEGSVAFMFKRLGVLSYAH-----AIA--DEERITEAAIDA--------
Y885_XYLFT       AFSK-CGGNMGTEGSVAFMFKRLGVLSYAH-----AIA--DEERITEAAIDA--------
Y1575_AQUAE      VFTK-HGGNLGASGCVSYLFERKGYIEVPA-----KE--VSEEELLEKAIEV--------
Y1661_FUSNN      TFTR-KDGNLGADGAVSWMFKKKGVITVKA-----EG--IDADEFMMAALEA--------
Y025_BORBU       VLAK-GGGSLGTPGSVSYMFYRKGLIVYNL-----EK--YLEDEIMEFALEV--------
Y720_LEPIN       ILTK-LGGSLATSGSVSRLFEKKGVIVLES-----SQ--ISEDELVDVAVGG--------
Y1665_CHLTE      LMSR-GGGSLGESGSVGWMFKRKGSIEVPR-----SA--ISEDDLMELLLDA--------
Y474_TREPA       LFSR-NGGNLGSAGSVSYMFNRKGVIEYDS-----EQ--VDEEALMELALEA--------
YRBC_BACSU       AFNK-NGGSLGESGCVAFLFERKGFITIDR-----TERQIEEDELMLDVLEA--------
Y2038_OCEIH      AFKK-NGGNLGENGSVSFMFDRKGYIVIEN-----EEGTLDEDTITMDALEA--------
Y663_ENTFA       AFTR-NGGSLGETGSVNYMFDRKGYIVIKR-----EDHAIEEDDMLEVVLEA--------
Y2253_LACPL      AFTH-HGGALAATGAVSYMFDRKGYIVISR-----EDLDTDEDTMLMDVLDA--------
Y1570_LISIN      AFNK-NGGSLGETGSVSYMFDRKGYLVILR-----EGLTVDEEEFMLEAIEA--------
Y1535_LISMO      AFNK-NGGSLGETGSVSYMFDRKGYLVILR-----EGLTVDEEEFMLEAIEA--------
Y2295_CLOAB      CFDR-NGGNLGASGCVAWMFQRKGQIVIEK-----ND-SIDEDELMMKVLDF--------
Y2215_CLOTE      AFSK-HGGNLGETGCVGWMFQSKGQMIIER-----NE-DMDEDEIMMVALDA--------
YU82_HATHI       AFSK-HGGNLGSTGCVSFMFQTKGQIVIEK-----ND-ELDEEELMMMALEC--------
Y1954_CLOPE      AFTK-GGGNMGTSGCVGFMFQKKGEIVIEK------A-ELDEDEIMMMALDA--------
Y466_THEMA       LFNK-YGGSLAESGSVSWIFERKGVIEISR-----DK-VKDLEELMMIAIDA--------
Y1135_CALS4      IFDR-NGGTLGAAGSVTWMFDKVGVIVVEK-----TD-SINEEDLMMVAIEA--------
Y4276_NOSS1      AFSK-NGGNLGETGCVSWMFDQKGVCVVSGV------V--DEDQLLEASLEG--------
Y989_SYNY3       AFSK-KGGNLGETGCVSWMFSQKGVIRLVGE------L--EEEKLLEALLEG--------
Y175_THEEB       AFNK-QGGNLGETGCVGWMFEQWGIVTVTAP------R--DEEAFLEALLAA--------
Y1776_COREF      AMSK-NGGNLGETGSVSYMFTRTGIVQVKK-----GEL--TEDDVLIAVLEA--------
Y1663_CORGL      AMTK-NGGNLGESGSVSYMFTRTGVVTVQK-----GDL--SEDDVLMAVLEA--------
Y475_MYCLE       AMTR-NGGAMADPGSVAYLFSRKGVVTLEK-----NGL--TEDDVLAAVLDA--------
Y2603_MYCTU      AMTR-NGGTMADPGSVSYLFSRKGVVTLEK-----NGL--TEDDVLAAVLEA--------
Y6832_STRAW      AMTR-NGGNMADPGSVSYLFNRKGVVIVPK-----GEL--SEDDVLGAVLDA--------
Y1521_STRCO      AMTR-NGGSMADPGSVSYLFNRKGVVIVPK-----GEL--AEDDVLGAVLDA--------
Y726_BIFLO       TLTK-GNGSLATSGSVSFNFERKGQIVVPS-----EGV--DFDKLFETAAEA--------
Y266_TROWT       IVTR-SGCSMVNPGSLAYNFKRKGIVVLQDRDANGNLL--SEDLVLSAVLEA--------
Y2548_DEIRA      VFNK-RGGSMGNSGSVAWQFEKKGIILLRD----------ASEAAQEVAIEN--------
Y742_CHLMU       AVNK-RGGALVEPGSVLYNFSRKGACYVPK----SS---IDEASLLTHVIDC--------
Y457_CHLTR       AVNK-RGGALVEPGSVLYNFSRKGACYVPK----HS---IDEASLLTHMIDC--------
Y169_CHLCV       AVNK-RGGSLVEPGSVLYNFARKGACYISK----SS---IDEATLLSHVIDV--------
Y573_CHLPN       AINK-RGGSLVEPGSVLYNFARKGACTVAK----SS---IDEEVIFSYAIEA--------
Y472_MYCH2       LFRR-ANGQIGKQNSIPYLFEQKGYLEIEK----NN---LDEDDLMLFSLDN--------
Y624_MYCPU       YFNK-AGGQLSKQGSIPYVYQQKGLIEIDK----KL---ISEDKITEIALEA--------
Y332_MYCGE       YLAK-LKGQLAKPNSVKINFQEEGIIFVN------KNN-YLKDDLIE--LLIL-------
Y478_MYCPN       YIAK-LKAQLAKPNSVKINFEEKGIALVK------HNN-FTQDELIE--LLIS-------
Y802_MYCPE       YFSK-LKGEIAKPNSVKNSFIYGGEIIIS------NKD-LTEDDLMEKILLSLEKIEVTD
Y295_UREPA       YFSK-LQGQIAKPNSVSMLFNECGQLLIN------KET-KSLDEWFE--ILI--------
                    :     :   . :   :                                        

Y541_BACAN       -DVDARDILEEE--DAVIVYAEPDQFHAVQSALKDA-GVEEFTVAELTMLA-QNDVTLPE
Y539_BACCR       -DVDARDILEEE--DSVIVYAEPDQFHAVQSALKGA-GVEEFTVAELTMLA-QSDVTLPE
YEEI_BACSU       -DVDVRDILEED--DSAIVYAEPDQFHAVQEAFKNA-GVEEFTVAELTMLA-QSEVTLPD
Y3259_BACHD      -DLDVRDLVQED--EVTIVYAEPDQFHAVQEAFKQT-GVEEFVVAEISMIP-QTEVSLSQ
Y669_STAAM       -DVDVNDVIDDN--GLTIVYAEPDQFAVVQDALRAA-GVEEFKVAEFEMLP-QTDIELSE
Y388_LISIN       -DIDVRDILDED--GQAIIYAEPEDFHKVQEGLKAA-GIEEFTVAEIEMIP-QNDIQLSG
Y369_LISMO       -DIDVRDILDED--GQAIIYAEPEDFHKVQEGLKAA-GIEEFTVAEIEMIP-QNDIQLSG
Y2866_ENTFA      -DIDVRDVVEED--GQIIVYTEPEDFHHAQEALKEK-GIEEFTVTELEMVP-QNEVTLEG
YEEN_ECOLI       -EVDVRDVTEEE--GNIVIYTEPTDLHKGIAALKAA-GITEFSTTELEMIA-QSEVELSP
YEEN_SHIFL       -EVDVRDVTEEE--GNIVIYTEPADLHKGIAALKAA-GITEFSTTELEMIA-QSEVELSP
YEEN_ECO57       -EVDVRDVTEEE--GNIVIYTEPTDLHKGIAALKAA-GISEFSTTELEMIA-QSEVELSP
YEEN_SALTI       -EVDVRDVTEEE--GNIVIYTEATDLHKGIAALKAA-GITEFSTTELEMIA-QSDVELSP
YEEN_SALTY       -EVDVRDVTEEE--GNIVIYTEATDLHKGIAALKAA-GISEFSTTELEMIA-QSEVELSP
YCDB_LACLA       -EVDVRDVTEEE--GNIVVYTEPTDLHKGIAALKEA-GITEFSTTELEMIP-QSEVELSP
Y1691_STRA3      -DVDVDDVEAEE--GTITVYTAPTDLHKGIQALRDN-GVEEFQVTELEMIP-QSEVVLEG
Y316_STRP1       -DVDVDDVEAEE--GTITVYTAPTDLHKGIQALRDN-GVEEFQVTELEMIP-QSEVVLEG
Y1789_STRMU      -DIDVEDVEAED--GSVTVYTAPTDLHRGIEALRAG-GVAEFQVTELEMIP-QSEVTLEG
Y1922_STRPN      -DVDVDDVEAQE--GTITVYTAPTDLHKAIVALRES-GIEEFQVTELEMIP-QSEVELSG
Y2806_VIBCH      -DAEVTDIEHED--GVITVFAPNTEFFKVKTALNEAFPDLTLDVEEITFVP-QNRTVVSG
Y5184_VIBVU      -DCDVTDIELED--GVITIYAPNTEFFKVKTALNTEFPDLVIDVEEITFVP-QNYSPVPE
Y4011_VIBPA      -DVDVTDVELED--GVITVFAPHTEFFKTKTALNAAFPDLTIDVEEITFVP-QTQTPVAG
Y162_HELPY       -GLEELEEVEDK----IIIRGDYNSFKLLNEGFESL--KLPILKASLQRIA-TTPIELND
Y162_HELPJ       -GLEELEEVGDK----IIIRGDYNSFKLLNEGFESL--RLPIIKAGLQRIA-TTPIELND
Y1172_CAMJE      -GLEELEQNEEE----LVISGDYTAFGELSSAIEAK--GLVLKKAGLEYIP-NNPVSFSE
Y627_BACTN       -DVEDEYEQDDEE-GTITIYGDPKSYAAIQKHLEEC--GFEDVGGDFTYIP-NDLKEVTP
Y3727_AGRFC      -GADDVESSED----GHTIICGFEAMNEVSKALEGVLG--EAESVKAIWKP-QNTVPVDE
Y2753_RHIME      -GADDVETDEE----GHTITCGFEDIGEVSKALEGALG--EAETVKAVWKP-QNTVPVDE
Y3945_RHILO      -GADDVESDEE----GHTIYCAFENLGEVSKALEAALG--EAESVKLIWRP-QNNVPVDE
Y321_BRUME       -GAEDVQSGED----GHVILCAFEDIGEVSKALEAALG--EAESIKTIWKP-QTNTELDE
Y1534_BRADU      -GADDVVSGEG----GHEIYASTEGYRDVAKALEAKFG--EPRKAALIWKP-QNTVAVDD
Y3243_CAUVC      -GADDVTSDMDEEGEGHTVYTAFESLNDVAAALEAKFG--AASNTKIAWRP-KMQVPVTG
Y681_RICCN       -GGHDIISDDT----THTIYTDIENFSKVLEFLTGKYG--IPEDSYIGWIP-LNTIIIDD
Y455_RICPR       -GGNDIISDYI----THTIYTDIENFYKALGFLTDKYG--IPEDSYIGWIP-VNTIIIDD
YEBC_ECOLI       -GAEDVVTY-DD--GAIDVYTAWEEMGKVRDALEAAGL--KADSAEVSMIP-STKADMDA
YEBC_ECOL6       -GAEDVVTY-DD--GAIDVYTAWEEMGKVRDALEAAGL--KADSAEVSMIP-STKADMDA
YEBC_SALTY       -GAEDVVTY-DD--GAIDVYTAWEEMGKVRDALEAAGL--KADSAEVSMIP-STKADMDA
Y2055_YERPE      -GADDIVVY-DD--GAIDVFTAWESLGAVKDALDATGL--VAEGAEVSLIP-STKAELDA
Y315_HAEIN       -GADDIQPQ-DD--GSFEIYTAWEDLGSVRDGIEAAGF--KVQEAEVTMIP-STTVDLDI
Y980_PASMU       -GADDVQVQ-ED--GSFEVYTAWEELGAVRDGIESAGI--KIDNAEVTMIP-STTVELDA
Y2432_SHEON      -GAEDVVSY-DD--GAIDVFTEPTAFYEVKDALDAAGF--VSDNAEIAMIA-STKAELDA
Y1214_PSEPK      -DADDVVAN-DD--GSFDVFTSFNSFYAVRNALEEAGF--KAADAEIVMQP-TTSAELDQ
Y3980_PSESM      -DADDVVTN-DD--GSIDVFTSFSGFYAVRNALEAAGF--MAADAEIVMLP-TTSAVLDL
PMPR_PSEAE       -GADDVVVN-DD--GSIDVFTTFADFISVNEALAAAGF--KGDEAEVTMIP-STTATLDL
Y1566_COXBU      -GAEDVTTN-DD--GSIDVTTLPEDFEKIRNAMKAADL--NPSHAEVTVLA-STEVGLDK
Y1902_NEIMA      -GAEDVVTN-DD--GSIEVITAPNDWAGVKSALEAAGY--KSVDGDVTMRA-QNETELSG
Y1648_NEIMB      -GAEDVVTN-DD--GSIEVITAPNDWAGVKSALEAAGY--KSVDGDVTMRA-QNETELSG
Y210_NITEU       -GAEDVISN-DD--GSLEVITGPDTFVSVRDTLEKAGF--KAELAEVTWKP-ENEVLLQG
Y2190_RALSO      -GAEDVVTN-DD--GSIEVLCPPNDFAKVKAALEGAGF--KAELAEVIMKP-QTEVEFTG
Y3151_XANAC      -GADDVVVYPED--GAIDVLTAPDAFAQVRDALVATGL--EPAHAEITFRA-DNDIAVDG
Y3027_XANCP      -GADDVVVYPED--GAIDVLTAPDTFAQVKQALATAGF--EPAHAEITFRA-ENDIAVDG
Y1906_XYLFA      -GAEDVMVYTED--DEIEVITTPEAFSRVKEEMAALGL--MPYHAQITFRA-DSDIVVDG
Y885_XYLFT       -GAEDVMVYIED--DEIEVITTPEAFSRVKEEMAALGL--MPYHAEITFRA-DSDIVVDG
Y1575_AQUAE      -GAEDVQPG-E---EVHIIYTVPEELYEVKENLEKLGV--PIEKAQITWKPISTVQINDE
Y1661_FUSNN      -GAEDVTED-D---GYFEVTTEYTEFQTVLENLKNAGY--QYEEAEISMIPENTVEITDL
Y025_BORBU       -GAEDILVS-N---NEAEVITSPDDFDKVLSFLKTK-F--KEEVAEIALIP-ENKISLNK
Y720_LEPIN       -GAEDVINE-G---DVYRVISVPDNYETVLHALNEKGL--KSEESEIRYIPLVSSEIADK
Y1665_CHLTE      -GLEELESD-DE--QYFTVLTDVKDLEPVKKALEEAGI--PFENAKIDMIP-DNYVELDV
Y474_TREPA       -GAEDIQNA-G---GVLTVTTVPGTFETVLESLQAKGW--ESLSAGISMVP-DTYLALDE
YRBC_BACSU       -GGEELRIE-E---DLYEVFTEPEHFEEVKTALE-SKY--LISSAEVTMLP-NTYAEADD
Y2038_OCEIH      -GAEDVVPQ-E---GAFELYTEPEDFQEVVKYLEENDY--TLADSEVTLFP-QNYNQLSQ
Y663_ENTFA       -GGEDIETS-P---EVFEIYTAPEDFTAVRDALEQAGY--SLAQAELTMVP-QTLLTLND
Y2253_LACPL      -GGDDLQSS-D---EAFEIYTDPKQLAAVRDALEANGY--KLETAELTMIP-ENLTDVPA
Y1570_LISIN      -GADDVEVS-D---DVFEVFTEPGAFSDVKDALQQAGY--TFATAELSMFP-TVYNEIAE
Y1535_LISMO      -GADDVEVS-E---DVFEIFTDPATFSEVKEALQEAGY--TFATAELSMFP-TVYNEIAE
Y2295_CLOAB      -GAEDFASE-E---EVFIITTAQEEFSNVREALEKENF--EFVSAELTMVP-DNTVKLSL
Y2215_CLOTE      -GAEDFESS-E---EVFEIITTPESFGEVREKLEAEGF--EFISAEVTMIP-DTTIEISM
YU82_HATHI       -GAEDFQSE-D---EVYIITTSPEDFGSVRETLEEKGL--EFLEAEVKSIP-DTYTVIDE
Y1954_CLOPE      -GAEDFASE-E---EVFIVTTSPEDFGTVREALEAEGL--EFLEAAVKMIP-DTETAINE
Y466_THEMA       -GAEDIKDA-E---DPIQIITAPENLSEVKSKLEEAGY--EV-EAKVTFIP-KNTVKVTG
Y1135_CALS4      -GAEDFSAD-E---GEFEIITDPSNFQEVREAIEKAGY--KISEAEITMLP-KNTIKLSP
Y4276_NOSS1      -GAESYEMTEDET---AEVFTEVANLEILNQTLKDQGF--KVTDAELRWIP-SNHLEVTE
Y989_SYNY3       -EGESYEWLDEEDGGGVEVFSAVNQLENLNQVLQNHGF--TIAETELRWLP-ENTIEIAE
Y175_THEEB       -DVETYEILEEVA----EVRCPVPALETVSETLKEHGY--TVLDTESRWIP-MNTVEITD
Y1776_COREF      -GAEEVNDLGE----VFEITCEPTDLEAVKAALVDAGI--EIEDADSDFRA-SVEVPLDA
Y1663_CORGL      -GAEEVNDNGD----LFEVTCAPTDIQAVRDALVEAGI--EVEDSESDFRA-SVQVPLDA
Y475_MYCLE       -GAEEVNDLGD----SFEVIAEPGDLVAVRTALQDAGI--DYESAEASFQP-SVSMPVDL
Y2603_MYCTU      -GAEDVNDLGD----SFEVISEPAELVAVRSALQDAGI--DYESAEASFQP-SVSVPVDL
Y6832_STRAW      -GAEEVNDLGE----SFEVVSEATDLVAVRTALQDAGI--DYDSADANFVP-TMQVELDE
Y1521_STRCO      -GAEEVNDLGE----SFEVLSEATDLVAVRTALQEAGI--DYESADANFVP-TMQVELDE
Y726_BIFLO       -GAEDVTDDGE----VFTVVTGPSDLFTVRKALQEAGF--DYDSADQVMQP-KNEVELSL
Y266_TROWT       -EVDDIVPTGDC---GFEIIAEPSNLSAVCNALRDSGI--QYRSVETVYVP-NSTVSLPE
Y2548_DEIRA      -GAEDIQESDE----GLEISTAPNDLYAVQDALSAAGY--AVESGQITMLP-TNTVAVAG
Y742_CHLMU       -GGEDLDSEDE---EFFLVLCEPTDLASVKEALLAKGV--TCSEEKMIYVP-LRLVDCDE
Y457_CHLTR       -GGEDLDSDDE---EFFLVLCEPTDLASVKEALLAKGV--TCSEERLIYVP-LRLVDCDE
Y169_CHLCV       -GAEDLDNDDE---ENFIVLCDPVELASVKEKLVALGV--TCSEEKLIYVP-LRLVDCDE
Y573_CHLPN       -GAEDLDTEDE---ENFLVICAPSELASVKEKLISQGA--TCSEDRLIYLP-LRLVDCDE
Y472_MYCH2       -GAEDFQSDEE----NYMIYCQPRKISELKNEIEKKFS-PNFRAVEISYFP-NEWVELDQ
Y624_MYCPU       -GAEDIQAEDN----YYSITCEPSSFNQVSEFIEKATGFSEFLTREVSYIA-SDYVELDD
Y332_MYCGE       DNINLIDVDYDE--ECFEISLHSNSYFHAKELLKKNN--FSIVDSEIKLVP-LLTVDLDR
Y478_MYCPN       NNINLLDLNEDD--DSFEVVVDSPSYFALKDLLVKNS--FTIEASELRLIP-LLTVELNA
Y802_MYCPE       NDEPIQETNQHE--DCFQIIVMPKYFYKIRQELETLG--LKIIESEIKYIP-TDYVDLNK
Y295_UREPA       -DQSIIDINEDD--KIIEILVKPEDFSTVKLILEKNN--ADIKSAEIKLIP-NDFISLDE
                                   :             :                 .         

Y541_BACAN       -DAQAQFEKMVDALEDLEDVQQVYHNVDLGE------------
Y539_BACCR       -DAQAQFEKMVDALEDLEDVQQVYHNVDLGE------------
YEEI_BACSU       -DAKEQFEKLIDALEDLEDVQQVYHNVDLGE------------
Y3259_BACHD      -EDQEQFEKLIDVLEDLEDVQQVYHNVDLGE------------
Y669_STAAM       -ADQVTFEKLIDALEDLEDVQNVFHNVDLK-------------
Y388_LISIN       -EDLEKFEKLIDALEDLEDVQKVYHNVELED------------
Y369_LISMO       -EDLEKFERLIDALEDLEDVQKVYHNVELED------------
Y2866_ENTFA      -DDLGNFEKMLDVLEDLEDVQKVHHNVDLPE------------
YEEN_ECOLI       -EDLEIFEGLVDALEDDDDVQKVYHNVANL-------------
YEEN_SHIFL       -EDLEIFEGLVDALEDDDDVQKVYHNVANL-------------
YEEN_ECO57       -EDLEIFEGLVDALEDDDDVQKVYHNVANL-------------
YEEN_SALTI       -EDLEIFEGLVDALEDDDDVQKVYHNVANL-------------
YEEN_SALTY       -EDLEIFEGLVDALEDDDDVQKVYHNVANL-------------
YCDB_LACLA       -EDLEIFEGLIDALEDDDDVQKVYHNVANL-------------
Y1691_STRA3      -DDLETFEKLIDALESDDDVQKVYHNVADF-------------
Y316_STRP1       -DDLETFEKLIDALESDDDVQKVYHNVADF-------------
Y1789_STRMU      -EDLETFEKLIDALEDDDDVQKVYHNVDGL-------------
Y1922_STRPN      -EDLETFEKLYSVLEDDEDVQKIYTNVDGF-------------
Y2806_VIBCH      -EDAEKFQKFLDMLDDCDDVQQVYHNADIE-------------
Y5184_VIBVU      -EDAEKFQKFLDMLDDCDDVQQVYHNAEM--------------
Y4011_VIBPA      -EDAEKFQKFLDLLDDCDDVQQVYHNAEL--------------
Y162_HELPY       -EQMELTEKLLDRIEDDDDVVALYTNIE---------------
Y162_HELPJ       -EQMELTEKLLDRIEDDDDVVALYTNIE---------------
Y1172_CAMJE      -EQLSDIEKLLDKLEDDDDVQAVYTNID---------------
Y627_BACTN       -EQRETLDKMIERLEEFDDVQTVYTNMKPEEGGNEE-------
Y3727_AGRFC      -EKAQSLMKLIDNLEDDDDVQNVYSNFEVSEEILAKLSA----
Y2753_RHIME      -EKAQSLMKLIDNLEDDDDVQNVYSNFEVSDEVLAKLSA----
Y3945_RHILO      -ERAQSLMKLVATLEDDDDVQSVYANFEVDDETLAKLSAA---
Y321_BRUME       -EKARSVLKLLSVLEDDDDVQNVYTNFEVSDEVMEKLSA----
Y1534_BRADU      -ETGEKLLKLMDLLNEHDDVQNVYANFEVSDALVAKMGG----
Y3243_CAUVC      -DAVATLMKLLDMLDEDDDVQAVYSNEDISDEDLAKLG-----
Y681_RICCN       KEKAEKLLKLVEVLEESDDVQRVFGNYELSDDVYEIIQGEP--
Y455_RICPR       KEKAKKLLKLIAVLEENDDVQRVFGNYMLSEDVYEIIQEE---
YEBC_ECOLI       -ETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL------
YEBC_ECOL6       -ETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL------
YEBC_SALTY       -ETAPKLLRLIDMLEDCDDVQEVYHNGEISDEVAATL------
Y2055_YERPE      -ETAPKLLRLIDMLEDSDDVQEVYHNGEISDEVAATL------
Y315_HAEIN       -ETAPKLLRLIDMLEDCDDVQNVYHNGEICDEVASQL------
Y980_PASMU       -ETAPKLLKLIDMLEDCDDVQNVYHNGEISDEIAAML------
Y2432_SHEON      -ETAEKFMRLIDTLEEHDDVQEVYHNAEISDEIMESLG-----
Y1214_PSEPK      -DGAEKVLKLIDMLEDLDDVQNVYSNAQISDEIMENLG-----
Y3980_PSESM      -ETAEKVLKLIDMLEDLDDVQNVYSNAEIPDEVMEQLG-----
PMPR_PSEAE       -ETAQKVLKLIDMLEDLDDVQNVYSNADIPDDVMAQLG-----
Y1566_COXBU      -DSAEQMLRLTEMLEDLDDVQNVYSNADYPEEVL---------
Y1902_NEIMA      -DDAVKMQKLIDALEDLDDVQDVYTSAVLNLD-----------
Y1648_NEIMB      -DDAVKMQKLIDALEDLDDVQDVYTSAVLNLD-----------
Y210_NITEU       -DDAVKMQKLLDALEDIDDVQDVYTSAVLDT------------
Y2190_RALSO      -DDAAKMQKLLDALENLDDVQEVYTNAVIGE------------
Y3151_XANAC      -DTAVQVRKLLDMLEDLDDVQDVYSNVDQAALGA---------
Y3027_XANCP      -DTAVQVRKLLDMLEDLDDVQDVYSNVDQASLGA---------
Y1906_XYLFA      -DTAIQVRKLLDILEDLDDVQDVYSNVDQVTLGKR--------
Y885_XYLFT       -DTAIQVRKLLDILEDLDDVQDVYSNVDQVTLGKR--------
Y1575_AQUAE      -ETAQKVIKLLNALEELDDVQQVIANFEIPEEILQKVG-----
Y1661_FUSNN      -ETAKKVMALYDALEDLDDSQNVYSNFDIPDEILEQLD-----
Y025_BORBU       -DQAEKIILLVEKLEDFDDVQEVIHNLEIPEELS---------
Y720_LEPIN       -EVAEKIMKLIDQLDGHDDVTSVTSNFELASSLEKEFE-----
Y1665_CHLTE      -ENARKALKLIDALENSDDVQAVYSNMDMSESVMSVLEEE---
Y474_TREPA       -ETARKVLKMIDRLEEEEDVQAVYSNADIPSELVL--------
YRBC_BACSU       -QAVEKLETLIDVLEDDDDVQEVYTNYRS--------------
Y2038_OCEIH      -EDEAKMMKLIDALEDSEDVQDIHHNLEESN------------
Y663_ENTFA       -EQKAQLERLVDKLEDDDDVSEVFTSAENL-------------
Y2253_LACPL      -DKVEKLQHMIDELEDNDDVSEVYEAANYPD------------
Y1570_LISIN      -NNQTQFDKMMEALEDDDDVQEVYTNAEIN-------------
Y1535_LISMO      -NNQTQFDKMLEALEDDDDVQEVYTNAEIN-------------
Y2295_CLOAB      -EDSERVQKLIDKLEDSDDVQDVYHNAEFDEAFEG--------
Y2215_CLOTE      -ERAAGLQKLIDKLEDDDDVQNVYHNAEFPEEWEG--------
YU82_HATHI       -NTAGKFQKMLDVLEDDEDVQDVYHNAEFPEGWEE--------
Y1954_CLOPE      -DDAKKFQKMLDLLEDDDDVQEVYHNAEFPEGWDE--------
Y466_THEMA       -KDAEKVLEFLNALEDMDDVQEVYSNFEMDDKEMEEILSRLEG
Y1135_CALS4      -EDYEKFEKLIDKLEDNDDVQNVYHNVELEDE-----------
Y4276_NOSS1      PDQARSLLKLIDTLEGLDDVQNVTSNFEMSENLMAVSFA----
Y989_SYNY3       PDQAKALMQMIDTLESLDDVQSVTSNFELTEELLALAG-----
Y175_THEEB       EDTARRVLKLMDALENLDDIQSVATNVTMSDALMEAMYV----
Y1776_COREF      -EGARKIFRLVDALEDSDDVQNVYTNITLSDEVLAELENDE--
Y1663_CORGL      -DGARKIFKLVDALEDSDDVQNVYTNIDLSDEVLTELEND---
Y475_MYCLE       -DGARKVFKLVDALEDSDDVHNVWTNADVSDEVLAALDGE---
Y2603_MYCTU      -DGARKVFKLVDALEDSDDVQNVWTNVDVSDEVLAALDDE---
Y6832_STRAW      -EGARKIFKLIDALEDSDDVQNVFANFDVSDEVMEKVDA----
Y1521_STRCO      -EGARKIFRLIDALEDSDDVQNVFANFDVSDEIMEKVDA----
Y726_BIFLO       -EDARKVSKLIDNLDDLDDVQNIYSNWTASDEVMAQLDEE---
Y266_TROWT       -QKYDRIIRMIEALEESDDVQGVYTNLSGKDLACE--------
Y2548_DEIRA      -DDARKLLTLVEYLEELDDVQNVYTNADLPEDEED--------
Y742_CHLMU       -EAGKSNLALIEWLENIDDVDDVYHNMT---------------
Y457_CHLTR       -ETGKSNLALIEWLENINDVDDVYHNMA---------------
Y169_CHLCV       -KDGEANLALIEWLEQIDDVDEVYHNMA---------------
Y573_CHLPN       -KDGEANLALIDWLEQIEDVDDVYHNMS---------------
Y472_MYCH2       -ENTEKILNQIDNFLDDEDIQNVYHNLKFA-------------
Y624_MYCPU       -ESSEKVMAFIEKLENDEDVQAVYHNLG---------------
Y332_MYCGE       -NQQTLLSRFLNACEEDDDIQFVVHNANPWEE-----------
Y478_MYCPN       -EQHTLLNRFLNACEEDDDIQTVVHNAL---------------
Y802_MYCPE       -EDYARLERFLDSCNEDDDVQWVISNFGEVIE-----------
Y295_UREPA       -YARERLVRFVNACENDDDISWVITNYEEEL------------
                                  :*   :