CLUSTAL format seed alignment for MF_00694

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KDGD_AGRFC            ------------------------MNPEQIKTALGSGLLSFPVTHFD-AEGR-----FAA
KDGD_RHIME            ------------------------MSPEEIKSRVGSGLLSFPVTHFT-SDYK-----LNL
S6HCC2_9GAMM          ------------------------MHYLELKQKISSGLLSFPVTHFDKSTFN-----FDK
X6KWA9_9RHOB          -----------------------MIAPTELRDIIRSGLLSFPVTPFD-ADDT-----FNA
KDGD_XANCP            --------------------MSSRYTPSEMAQALGAGLLSFPVTHFD-ADMA-----FDE
KDGD_XANC8            --------------------MSSRYTPSEMAQALGAGLLSFPVTHFD-ADMA-----FDE
KDGD_RALSO            ---------------------MSRYTPSEFAHQIGTGLLSFPVTHFK-SDLS-----FDE
KDGD_BRADU            ---------------------MSKMTPQEMAQTIGSGLLSFPVTPFK-ADYS-----FDE
KDGD_RHOJR            ---------------------MATASPHEIAHKLGSGLLSFPVTHFK-DDHS-----FDE
KDGD_PSECP            ---------------------MAKYTPNELADTLKEGLLSFPVTSFD-ANLQ-----FDE
KDGD_ARTS2            ---------------------MAKHSPQELASVLKDGLLSFPVTSFD-SQLQ-----FDE
KDGD_CORGL            ---------------------MARFSPQDLADHLKDGLLSFPATAFQ-DDLE-----VDE
KDGD_PSEPK            ------------------------MNPQELKSILSHGLLSFPVTDFN-AQGD-----FNP
KDGD_PSESM            ------------------------MNPQELKSILSSGLLSFPVTDFN-AQGD-----FHR
KDGD_PSEPU            ------------------------MNPQELKSILSEGLLSFPLTDFD-VAGD-----FRA
KDGD_LEPCP            ------------------------MSPQELKNVLQSGLLSFPLTDFD-RELN-----FAP
KDGD_ACIBT            ------------------------MDALELKNIISDGLLSFPVTDFD-QNGD-----FNK
KDGD_ACIBS            ------------------------MDALELKNIISDGLLSFPVTDFD-QNGD-----FNK
A0A370KXJ7_9BRAD      --------------------MTAPLSPEALKARLACGLLGFPLTDFA-TDGS-----FAP
F2JVA7_MARM1          ----------------------MSFSTEQMRTALSDGLLSFPVTDLD-ENGQ-----FNA
F6D0P7_MARPP          ----------------------MALSIDTIRSSLSDGLLSFPITDFD-EQGV-----FQP
D2AQE7_STRRD          --------------------------------MDLSGVLFFPVTPFD-AGGA-----LAG
A0A239M664_9ACTN      --------------------------------MNLSGVLFFPVTPFG-ADGA-----LAG
Q47P66_THEFY          --------------------------------MDFNGILFFPLTPFD-ERGD-----VNE
A1R9V3_PAEAT          --------------------------------MNFDGVLFFPVTPFA-EDGT-----VDV
B0RGN4_CLAMS          ------------------MTTTDTATTPAGLLPPLEGVLFFPVTPFD-AADR-----VDV
C5BYU1_BEUC1          --------------------------------MIAPGILFFPVTPFD-AAGR-----VAP
D0L597_GORB4          ---------------------------------MLDGVLFFPVTPFG-PDGE-----VDY
A0R5B6_MYCS2          ---------------------------------MLDGVLFFPVTPFT-ASGD-----VDV
D3Q7W2_STANL          --------------------------------MKLKGLLSFPLTPFS-ATDT-----VDL
G0FWA7_AMYMS          ---------------------------MAQNEIELDGLLAFPLTPFT-EDLE-----VNL
KDGD1_STRAW           ----------------------MTSAPLAARLSIPSGPLFFPVTAYR-PDGA-----LNL
KDGD1_STRCO           ----------------------MTSAPLAARLTVPSGPLFFPVTAYG-PDGG-----LDL
A0A1N7GPX9_9ACTN      --------------------------------MTFDGLLFFPVTPCD-EEER-----LGL
C7QB47_CATAD          ---------------------------MQSLVDRLDGLLFFPVTPFA-RGAGDRPGGVDL
KDGD2_STRAW           MSADTDTDTDTGTGTGPDTDTGTAAVVERLRGGMARGVLSFPLTSFH-DDGS-----LDL
KDGD2_STRCO           ---------MTSAGPGSDPGTGRAAVVRRLREGMAASVLSFPLTSFH-EDGS-----FDA
V6KLQ2_STRNV          ---------------MAGLSVETEDVAQRLREAMKGGVLSFPVTSFA-PDGE-----LDL
D7B7P1_NOCDD          ---------------MSDVGTD-PDLPARLAEGMRRSVLSFPLTPFA-EDGS-----FAP
A0A4R2CP45_9ACTN      --------------------------------MQLDRLSSFPVTAFD-ADGA-----LAL
A0A1H6E4W8_9ACTN      ---------------------------MAPPALSLAGLLAFPVTPFT-ESGE-----VDL
KDGD_BACSU            ---------------------------MSRIRKAPAGILGFPVAPFN-TQGK-----LEE
KDGD_BACLD            ---------------------------MSQLRKAPEGILGFPVAPFN-REGK-----LEE
D5DPJ8_BACMQ          -----------------------------MNRKAPTGILGFPVAPLN-NQGK-----LDE
KDGD_OCEIH            -----------------------------MNRKAPTGILGFPVTPFD-NQGN-----IDE
A0A3A9K5S7_9BACI      ---------------------------MNSQRKSPTGILGFPITPFD-EHGR-----IDE
A0A2N6RDB2_9BACI      ---------------------------MAETKKAPTGILGFPTAPFN-EQGN-----IDE
Q5WKU3_BACSK          -----------------------------MQTNKLTGILGFPVSPFD-KNGA-----LDE
A0A2T4Z7Z5_9BACL      --------------------------MTTEKRVFPHGIHGFPVAPFT-AEGK-----LDM
M7NIL6_9BACL          ---------------------------MGIKRQSPTGILGFPVAPLK-ENGE-----LDL
A0A3S0C5N3_9BACL      --------------------------MNQEHTISLAGIMGFPVTPFD-DREQ-----VNE
                                                              ** :             .  

KDGD_AGRFC            DSYREHVEWLAGYK-------APVLFAAGGTGEFFSLKPDEIPTIVAAAKEVA-GETAIV
KDGD_RHIME            ESYRRHVEWLSGFE-------AAALFAAGGTGEFFSLSPNEVGQVTRAAKDVS-GEVPII
S6HCC2_9GAMM          KAYQDHISWQTQYD-------AAGLFAAGGTGELFSLTPREIPEIVAAAKEVA-GEIPIL
X6KWA9_9RHOB          GAFSAHLEWLSPHK-------IAGLIVAGGTGELFSLTPSEVVDVVRTARAAQ-PGQPVI
KDGD_XANCP            PAYRSNLDWLSSHP-------AAGLFAAGGTGELFSLTLDEVDRAVRAAVTQTAGRMPVI
KDGD_XANC8            PAYRSNLDWLSSHP-------AAGLFAAGGTGELFSLTLDEVDRAVRAAVTQTAGRMPVI
KDGD_RALSO            AAYRANLSWLFSHE-------AAGLFAAGGTGEFFSLTPAETDRVVRAAVAETGGRLPVI
KDGD_BRADU            ATYRANMDWLCGYD-------VAGLFAAGGTGEFFSLTPTEVPQIVKIAVEETKGRVPVL
KDGD_RHOJR            AAYRENIGWLGQFD-------ASGLFAAGGTGEFFSLTPPEVEQVVRAAVQEAPDGLPVI
KDGD_PSECP            ENYRKHLAWQASFP-------VAGLFAAGGTGEGFSLTPAESERVVRTAVDEVGSRVPVL
KDGD_ARTS2            ENYRKHLAWQASYP-------VAGLFAAGGTGEGFSLTPAESARVVRAAVEEVGSTVPVL
KDGD_CORGL            AAYVEHIEWQSSYP-------VAGLFAAGGTGEGFSLTVEENHRVTQLAVQASSPEVPVL
KDGD_PSEPK            AGYIKRLEWLAPYG-------ASALFAAGGTGEFFSLAASEYSQVIKTAVDTCATSVPIL
KDGD_PSESM            AGYIKRLEWLAPYG-------ASALFAAGGTGEFFSLAASEYSEIIKTAVDTCATSVPIL
KDGD_PSEPU            DTYAKRLEWLAPYG-------ASALFAAGGTGEFFSLQASEYSEIIKVAVDTCRGEVPIL
KDGD_LEPCP            KPYAERLKWLQPYG-------ASALFAAGGTGEFFSLEPGEYSDVIKVALDTCRGRTPII
KDGD_ACIBT            SSYAKRLEWLAPYG-------ASALFAAGGTGEFFSLTGNEYSEVIKTAVDTCKGSVPII
KDGD_ACIBS            SSYAKRLEWLAPYG-------ASALFAAGGTGEFFSLTGNEYSEVIKTAVDICKGSVPII
A0A370KXJ7_9BRAD      QPFGDRVRFLGGQG-------CAALFVASGAGEFFSLTRDEYAAVLATAVSARDGDIPLF
F2JVA7_MARM1          ETFKSRVEWFVEKG-------VSTVFVAGGTGEFFSLSYEEFKQVVEVAVEAVGGRVPVI
F6D0P7_MARPP          ETYKQRIEWFIEHG-------VSSVFVAGGTGEFFSLELEEYTEICRIAVETVAGRVPVI
D2AQE7_STRRD          DVLAEHLRRGLEHR-------PGGVFVACGTGEFSALSEAEHARAVRIATETVGGRVPVL
A0A239M664_9ACTN      DVLAEHLRLGLEHQ-------PGGVFVACGTGEFSALSEAEHAEAVRIATETVNGRVPVL
Q47P66_THEFY          AAFEQHVASGLDHG-------AGGVFAACGTGEIHALSAEEHARVVRRAVAVTAGRVPVI
A1R9V3_PAEAT          ALLKEHITSRLPFG-------PGGVFPACGTGEFHALSIDEIRTVVTAAVEAVAGAVPVV
B0RGN4_CLAMS          DVFGAHVAHGLDQG-------AGAAFVACGTGEFHALDIDEYAQAVRAGVAAAGGRHLVI
C5BYU1_BEUC1          EPLAAHVSSRVED--------CGAVFAACGTGEFAALDAAEVGLVVRTAVAAAAGRRAVL
D0L597_GORB4          DRLAEHINRGVAAG-------PGGVFVACGTGEFHALGLSEFGEIVRRTVETVAGRVPVF
A0R5B6_MYCS2          DLLAQHVARGVEAG-------PGGVFIGCGTGEFHALEPEEMRTVVRTAVDAAAGRVPVY
D3Q7W2_STANL          DVYERHLRAQIDAG-------PSGLFVACGTGEFTALSPAEYRQVVSCAVRVAGGRVPVV
G0FWA7_AMYMS          DALAENVESHIAAG-------AGALFVACGTGEFSSLSPAEHASVLTRAREVAAGRVPVW
KDGD1_STRAW           DVYREHVRRGVE-------AGAAAVFACCGTGEFHALAPEEFERCVGAAVEETAGRVPVV
KDGD1_STRCO           DVYRTHVRRGVE-------AGAAAVFACCGTGEFHALTPEEFAACVRAAVEESAGRVPVL
A0A1N7GPX9_9ACTN      EVFRRHVRQGVE-------AGCGAVFACCGTGEFPALSLRDYAACVAAAVEEAAGRVPVV
C7QB47_CATAD          EVYREHLRSRLAFLDAPERPGPAAVFACCGTGEFQALDVDEFAECVRAAAEVAAGRVPVV
KDGD2_STRAW           DGFRAHLETQLA-------AGPGAVFPACGTGEFFSLDEDEYRQVVTAAVELTAGRVPVV
KDGD2_STRCO           DGYRAYVAERLA-------AGPGALFPACGTGEFFSLDEDEYRQAVAIAVEETAGSVPVV
V6KLQ2_STRNV          AAYRAYLTAQFD-------TSPGAVFPACGTGEFSGLDEDEYRAVVATTVEVADGRLPVV
D7B7P1_NOCDD          EAFEAHLEHQLA-------AGPGAVFVGCGTGEFFSLGLDEFGDAVATAVRRVGGSVPVV
A0A4R2CP45_9ACTN      GPYREHLRHQID-------AGPAAIFACCGTGEFFSLTLDEYAAAVRAAVQEAAGALPVF
A0A1H6E4W8_9ACTN      SRFRTHLTDVLATE-------PSAIFVACGTGELASLTATEHQAVVRAAVDHVAGAAPVL
KDGD_BACSU            EALFQNIEFLLNEG-------LEAIFIACGSGEFQSLSQKEYEQMVEVAVSAAGGKVPVY
KDGD_BACLD            EALYENIRFLLDEG-------LEAVFIACGSGEFQSLSTKEYEQMVEIAVSAADGKVPVY
D5DPJ8_BACMQ          KALEANIQFLLDEG-------LEAIFIACGSGEFQSLNTKEYTAMLEVAISVVNRKVPVY
KDGD_OCEIH            LALSQNIKYLLDSG-------LEAIFVACGAGEYHSLENGEYESIIEIATSTVKGQVPVY
A0A3A9K5S7_9BACI      QALSRNVEFLINNG-------LEAIFICAGSGEFQSLNRNEYELMVDIAVSTTKNKVPVY
A0A2N6RDB2_9BACI      QALAANIKFLIDSG-------LSSIFIACGSGEFNALNKAEYQTMLEVAVAVTNKKVPVY
Q5WKU3_BACSK          NALHRNITFLIEEG-------LEAIFVACGAGEFHAISKAEYGAILDVAVDATQKRVPLY
A0A2T4Z7Z5_9BACL      DALERTITFLIEEG-------LQSIFIACGSSEFHAVSTHEYKEMLETAVSVADGRVPVY
M7NIL6_9BACL          KGLEANIDFLLESG-------LQSVFVACGAGELHALTQEEYKVMVEAVVKQVDGRVPVY
A0A3S0C5N3_9BACL      NAFQANVRFLVSHG-------LDSIFVGAGSGEYQSLTVHEYAQLLTAAISETNGGVPVF
                            :                  :   *:.*  .:   :                 : 

KDGD_AGRFC            SGCGYGTEIAVDIARSVEKVGADGILLLPHYLIDAPQEGLYAHIKKVCQSVGIGVMVYNR
KDGD_RHIME            AGCGYGTSLAVETAKIVEEAGADGILLLPHYLTEAPQEGIYAHVKAVCDSTGLGVILYNR
S6HCC2_9GAMM          SGCGYGTRMAIEIAKATEAKGADGLLLLPHYLIGATQEGLFNHIKSVCDSVSMGIIIYNR
X6KWA9_9RHOB          AGCGYGTKLACEMAKGIEEAGGDGILLLPHYLIGAPQDGIEAHIRAVCKSTNMGVIVYNR
KDGD_XANCP            APAGYGTAIAVAMAQAAERNDADGILLFPPYLTECDADGVAEHVERVCKATSLGVIVYGR
KDGD_XANC8            APAGYGTAIAVAMAQAAERNDADGILLFPPYLTECDADGVAEHVERVCKATSLGVIVYGR
KDGD_RALSO            APAGYGTAMAKEYCQAAEAAGADGILLLPPYLTEASADGVAAHVEQVCKSTRLGVIVYNR
KDGD_BRADU            AGTGYGTAIAREIAVGAEKAGADGLLLLPPYLTHSEQDGLAAHVEAVCAAVKIGVIVYNR
KDGD_RHOJR            APAGYGTSTAVQMARSAESVGAHGILLLPPYLTEASQDGLVAHVKEVCAATTLGVTIYSR
KDGD_PSECP            ASAGGSTAQAIENAKAAEAAGADGILLLPPYLTEADQAGLVEHVSAVCRATSLGVIIYNR
KDGD_ARTS2            ASAGGSTAQAIENAQAAEAAGAEGILLLPPYLTEADQGGLIEHVSAVCSATSLGVIIYNR
KDGD_CORGL            GSATGSTKSAIANAQGAEAAGAEGVLLLPPYLTECDAEGLYNHAAAVCESTSLGVIVYNR
KDGD_PSEPK            AGVGGSTRQAIEYAQEAERLGAKGLLLLPHYLTEASQDGVAAHVEAVCKSVNIGVVVYNR
KDGD_PSESM            AGVGGATRQAIEYAQEAERLGAKGLLLLPHYLTEASQDGVAAHVEAVCKSVKIGVVVYNR
KDGD_PSEPU            AGTGGPTRQAIAYAQEAERLGAAGVLLLPHYLTEASQEGLVSHVEQVCKSVDFGVVVYNR
KDGD_LEPCP            AGAGGGTRVAIQYAQEAERLGAQGVLLLPHYLTEASQEGLIAHVQAVCRSVRFGVTVYNR
KDGD_ACIBT            AGAGGPTRQAIEQAKEAERLGAHGILLMPHYLTEASQEGLIEHVKQVCNSVDFGVIFYNR
KDGD_ACIBS            AGAGGPTRQAIEQAKEAERLGAHGILLMPHYLTEASQEGLIEHVKQVCNSVDFGVIFYNR
A0A370KXJ7_9BRAD      GAAGGGTRDAIEHAAIAQRAGVDGLLLLPPYLTEVSQEGLRAHVTAICRSTDLGIILYSR
F2JVA7_MARM1          AAAGKSVPEARKFVAAAEEAGADGILLMPPFLTECPEDGVIEYATQVMTGSNLHFIYYNR
F6D0P7_MARPP          ASAGRSVLEAKTFVKAAEDAGCDGILLMPPFLTECPEDGVVEYASQIMQSSAIQFIYYNR
D2AQE7_STRRD          AGAGGPIGAALAQARAAGDAGADGLLLMPPYLASGPREGYAAYVAAVSEV--LPTIVYQR
A0A239M664_9ACTN      AGAGGPIGTALAQARAAGDAGADGLLLMPPYLASGPHEGYTAYVAAVAEV--LPTIIYQR
Q47P66_THEFY          AGAGGSVSTAIEQATAARELGADGVLLLPPYLVHAPQRGLVEYVRAVTSAVDIPVIVYQR
A1R9V3_PAEAT          SGAGGPLGHAIAAAKVAEEAGADALLVLPPYLVTGPTDGVVAYVEAIAAASSLPVIVYHR
B0RGN4_CLAMS          AGVGGPLGHARRCAQLATELGADGILVLPPYLVAGPQDGLAAYVEAVAHATPLPLIAYHR
C5BYU1_BEUC1          GGAGGPLPHAIACAREIADAGGSGILLLPPYLTAGSPAGLGAYVRAVLDATDLPVILYHR
D0L597_GORB4          AGAGGSLVQAKEFAASAKANGANGILLLPPYLVTMPPAGLVEYTRAVAQTTDLPVIVYNR
A0R5B6_MYCS2          AGAGGPVASAKAFAQVAAESGADGLLLLPPYLVEMPQAGLVGYTRAVSAVTDLPLVVYNR
D3Q7W2_STANL          AGAGGGPRLAREFAVAAEHAGADGIMLLPPYLVESTPAGLVEHVRYVAAATGLSITIYQR
G0FWA7_AMYMS          VGAGGGAASARAGIATAQAGGADGVLLLPPYLVTGPSSGLVDFVRYAVGHSSVPVIVYHR
KDGD1_STRAW           AGAGYGTALAVRFARLAQDAGADGLLAMPPYLVVAGQEGLLRHYRELAAATSLETIVYQR
KDGD1_STRCO           AGAGYGTALAVRYARLAEQAGADGLLAMPPYLVLAGQEGLVRHYREVAAATPLPVIVYQR
A0A1N7GPX9_9ACTN      AGTGYGTAMAVEFARAAEDGGASALLALPPYLVQAGQDGLRRHYEAIADGARLPIILYQR
C7QB47_CATAD          AGVGYGAALAASFSAAAKEAGADGLLVMPPYLVAGGAAGLRDHYTAVAEATDLDLIIYQR
KDGD2_STRAW           AGTGYGWAQAARFARIAEDAGADALLVLPHYLVAAPQDGLVGQLERLAERTRLPLIAYQR
KDGD2_STRCO           AGTGYGWAQALRFARIAEDAGADALLVMPHYLTAAPQDGLVAQMERIAAGTRLPLIAYQR
V6KLQ2_STRNV          AGTGYGWAQALRFARIAEEAGADALLVMPHYLVEASQDGLVEQLRRIADGTRLPLIAYQR
D7B7P1_NOCDD          AGAGHGTPLAVEFARVAREAGADALLLLPPYLIGGTQTGLVEHTRAVAEAAGLPVIVYQR
A0A4R2CP45_9ACTN      AGTGYGTAMARQFAAAAREAGADGLLVLPPYLIKPSQQGLLDHFRGLAATAGLPLIAYQR
A0A1H6E4W8_9ACTN      AGVGGGTRTAAEFARAAQAAGADGLLALPPYLQVGPPAGLVEHYRQVAAATDLGVILYQR
KDGD_BACSU            TGVGGNLSTALDWAQLSEKKGADGYLILPPYLVHGEQEGLYQYAKTIIESTDLNAILYQR
KDGD_BACLD            TGVGGNLSTALEWARISEEKGADGYLILPPYLIHGEQEGLYQYTKTIIESTDLNAIIYQR
D5DPJ8_BACMQ          TGVGGNLSTALEWARISEEKQADGYLILPPYLIEGEQEGLYNYLKAIIEHTNLNAIVYQR
KDGD_OCEIH            TGVGGNLSDAVHKAKLSEKHGVDGYLIMPAYLINGEQEGIYQYVHSIATSTDLNAIVYQR
A0A3A9K5S7_9BACI      TSIGGNISTSIELAEISKDKGADGYLIFPPYLIDPEQEGLYNYYKTLIRSTDLNAIIYQR
A0A2N6RDB2_9BACI      SGVGGSIAEAVELVRLSEDLGVDGYLILPPYLIEGEQEGLYNYYKTIVGSSDLNAILYQR
Q5WKU3_BACSK          TGVGGNIQDALSFARLSEEKGADGYLILPPYLINGEQNGLHAYLSAIIESTSLHAIVYQR
A0A2T4Z7Z5_9BACL      SGVGGNISHALELGTISAQVGVDGYLILPPYLVQGEQEGLYHYFKMIATNTDLDAIIYQR
M7NIL6_9BACL          TGVGGNISHALEQAEISEEAGADGYLILPPYLIDPSQDGLYNYLKAIIESTDLSAIVYQR
A0A3S0C5N3_9BACL      AGAGGNIRDAVERAQLAEKLGADGLLLLPPYLIIPEQEGLFQYYQTIAGSTSLPVIVYQR
                               :             . : :* :*      *             .    * *

KDGD_AGRFC            DNSVLQADTLARLCDECPNLVGFKDGTGDIGLVRQITAKMGDR-------LMYLGGMPTA
KDGD_RHIME            ANSVANADTVARLAEACPNLIGFKDGTGKVDLVRHVTAKLGDR-------LCYIGGMPTH
S6HCC2_9GAMM          ANSVVNATTVQRLADACPNLIGFKDGTGDINKVREICALLGDR-------LVFIGGMPTH
X6KWA9_9RHOB          GQSVVSADTLARLVEDCPNLIGFKDGTGDIDTVKRITVGLGDR-------LAYIGGMPTH
KDGD_XANCP            ANARLDDVALARVAERCPNLVGYKDGIGDVERMTRIYARLGDR-------LLYVGGLPTA
KDGD_XANC8            ANARLDDVALARVAERCPNLMGYKDGIGDVDRMTRIYARLGDR-------LLYVGGLPTA
KDGD_RALSO            ANQVLDENHLERLAERCPNLVGFKDGVGDLELMTRIYSRLGER-------FTYIGGLPTA
KDGD_BRADU            DNAILQPDTLARLAERCPNLVGYKDGIGDIELMTRVYTKLGDR-------LTYIGGLPTA
KDGD_RHOJR            ANAVYTEAAVAELADSCPNLVGFKDGVGNIEQMTRIYASLGDR-------LTYIGGLPTA
KDGD_PSECP            ANAIYKDTTVATLADRHANLIGFKDGVGDLEHDARVYAKLGDR-------LFYLGGLPTA
KDGD_ARTS2            ANAIYKDTTVAALADRHESLIGFKDGVGDLEHDARVYAKLGDR-------LFYLGGLPTA
KDGD_CORGL            ANAIYSPEVIARLSERYPNFIGFKDGTGNIEHLAKITTLCGDR-------LFYLGGLPTA
KDGD_PSEPK            NVCRLNADLLEKLAERCPNLIGYKDGLGDIELMVSIRRRLGER-------FSYLGGLPTA
KDGD_PSESM            NVCRLTPTLLEQLAERCPNLIGYKDGLGDIELMVSIRRRLGDR-------FSYLGGLPTA
KDGD_PSEPU            NVCRLNADSLEKLADRCPNLIGFKDGVGDIESMVSIRRRLGER-------LTYLGGLPTA
KDGD_LEPCP            GACKLTPASLLVLAETCPNLIGFKDGIGDIETFVSIRQTLGER-------FAYLGGLPTA
KDGD_ACIBT            SVSRLNLDSIQKLTEMCPNLIGFKDSSGQIDMMTAVTQTIGDR-------LSYLGGLPTA
KDGD_ACIBS            SVSRLNLDSIQKLTEMCPNLIGFKDSSGQIDMMTAVTQTIGDR-------LSYLGGLPTA
A0A370KXJ7_9BRAD      ANGRVRPETLFRLVDDCPNLIALKDGVGEVEDLWAMRTRLSGR-------LAFLNGMPTA
F2JVA7_MARM1          GNGVLSAESVKELAARNPNLVALKDGTGNIAALNDTIKTVDDR-------LVYIGGVPTA
F6D0P7_MARPP          ANGILSAESVQQLADQNDNFIALKDGVGNIAALNDIIKTVGDR-------LTYIGGVPTA
D2AQE7_STRRD          GPVVLDPEQAVELA-RLPGVVGIKDGVGDIDRMQRTVLAVREERPD----FLFFNGLPTA
A0A239M664_9ACTN      GSVVLEPDQAVELA-RLPGVVGIKDGVGDIDRMQRIVLAVREEQPD----FLFFNGLPTA
Q47P66_THEFY          GTMVFTPDSAAELA-EIPTVVGFKDGVGDVGTMRQIVLTVRQRRGDN---FVFFNGLPTA
A1R9V3_PAEAT          GTAKFTADAITRLT-ANPKVVGFKDGIGDVGLAQEIVSAINASGRT---DFALFNGLLTA
B0RGN4_CLAMS          GQAQFTEATVERLL-ALPTLAGIKDGAGDVALFQRFVLAARRAGRD---DVQFFNGLLTA
C5BYU1_BEUC1          ATASYTPELLAELA-ADPRVIGIKDGVGDIALAQRLVLA--AADRP---DFLFFNGLLTA
D0L597_GORB4          SNAVFDEAGAVAVA-QLPTVIGFKDGTGDLDNVSRIVIAVKAALAGTGKDFLFFNGLPTA
A0R5B6_MYCS2          NNARFTEGSAIEVA-KLPNVVGFKDGTGDFDQVARIVRAVTDALENEGKPFQFFNGLPTA
D3Q7W2_STANL          ANAVLDTDAAVALL-DIDTVTGIKDGRGDVDAMLRLVTAVRTSGHPRSGDIGFLNGLPTA
G0FWA7_AMYMS          GTGVFTAPAAASLL-DIPSVVGLKDGYGDVECMTRIVTTIRSLDTERARNFLFFNGLPTA
KDGD1_STRAW           DNAVFTPEAVVELA-RTDGIIGFKDGLGDLDLMQRVVSAVRTEVPGD---FLYFNGLPTA
KDGD1_STRCO           DNAVFTPESVVELA-RTDGVVGLKDGLGDLDLMQRIVSAVRTELPGEE--FLYFNGLPTA
A0A1N7GPX9_9ACTN      DNAVFEPETVAALA-RHPGVIGLKDGYGDLGLMRRIIEAAPSE-------MLYFNGLPTA
C7QB47_CATAD          DNVTFTPEVVADLA-EVPNIVGFKDGKGDLDLMQRIVSAVRDRHGEGK--LMYFNGLPTA
KDGD2_STRAW           GQVTYSVESLRRIA-RIPGVVGLKDGHSDLDRLQRLTLAAPEG-------FLFFNGAATA
KDGD2_STRCO           GQVAYTAESVRRLT-RVPGVIGLKDGHSDLDRLQRAVLAAPDD-------FLFFNGAATA
V6KLQ2_STRNV          GPVTFTPEGLRRIA-DIPTVIGLKDGHSDLDRLQRLTLAAPDG-------FLFFNGAATA
D7B7P1_NOCDD          AQALYEPETLARIA-RIPGVIGFKDGIGDLDRMQRLVRAVPEG-------LLFFNGTPTA
A0A4R2CP45_9ACTN      DNAIFTADSVAELA-RIPGVVGFKDGLGDLDLLQRMMAAAPE--------LTYFNGLPTA
A0A1H6E4W8_9ACTN      GTAIFTPESVAELA-EVDNIVALKDGHGDMELLQLIQTATAGR-------LPLLNGMPTA
KDGD_BACSU            DNAVLSVEQIKRL-TECEQLVGVKDGVGNMDLNINLVYTIGDR-------LGWLNGMPMA
KDGD_BACLD            DNAVLTLEQIQRL-TDLEQLVGLKDGIGDMALNISLSYTIGDR-------LGWLNGMPMA
D5DPJ8_BACMQ          DNAILQLPTLEKL-TELNQLVGLKDGYGNMELNIELTQSLRKR-------LGWLNGMPMA
KDGD_OCEIH            DNVVMNLDTIEKL-VEIPQIVGFKDGHGSMEHIIEFTQSIGNK-------IGWLNGMPMA
A0A3A9K5S7_9BACI      GKAVFTVDTIERL-AEFPQFVGLKDGIGNMELNIELTQSLGGR-------LEWINGMPFG
A0A2N6RDB2_9BACI      DNAVLQLPTIKRLLDEYPQIVGIKDGHGNMELNLELTQTLGNR-------VEWLNGMPFA
Q5WKU3_BACSK          DNAVLEGDTLESL-LVYPQLVGLKDGIGNMEQNIEFTQRFGER-------LLWLNGMPMA
A0A2T4Z7Z5_9BACL      DNAVFQVETVMNL-AEIPQIIGFKDGYGNVERNIELTQTIGDR-------LEWFNGMPFA
M7NIL6_9BACL          DKCILTKETLLAL-CELPQLVGFKDGVGNMEFNTEAVQLIGDR-------LEWINGMPLA
A0A3S0C5N3_9BACL      DNAVFTLSTLERL-AQIPNVIGFKDGLGNFELNLEFVQMIGKG-------LQWMNGMPLA
                                  :      . . **. ...                    .  ..*    

KDGD_AGRFC            ELFAEAYLGAGFTTYSSAVFNFVPGLANEFYAALRAGERATCERILVDFFYPFMAIRNRA
KDGD_RHIME            ELFAEGFNGVGVTTYSSAVFNFVPELAQRFYRAMRAGDRAVMEGILHTFFFPFAALRDRK
S6HCC2_9GAMM          EMFAEAYDAMGVTTYSSAVFNFVPEMALNFFQAMRNKDKAFMNKVLVDFFYPFAKIRDRG
X6KWA9_9RHOB          ELFAQAFRGAGVDTYSSAVFNFVPETALAFHAAFKAGDDATCEQMLRDFYYPFAKIRDRK
KDGD_XANCP            ETFALPYLEMGVTTYSSAIFNFLPEWALSFYAAVRARDHATIYRELNDFVLPYTVLRNRR
KDGD_XANC8            ETFALPYLEMGVTTYSSAIFNFLPEWALSFYAAVRARDHATIYRELNDFVLPYTVLRNRR
KDGD_RALSO            ETFAMPYLTMGVTTYSSAIFNFVPKFALDFYAAVRAADHAKAYAMLNDFVLPYIALRNRK
KDGD_BRADU            ETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRDHATIHAGLKDFILPLIAIRNRK
KDGD_RHOJR            EMFALPYLALGVTTYSSAIYNFVPKFAIDFYNALRSGDNAFVINALNEFVIPYCNLRNKK
KDGD_PSECP            ETFALPLLQLGMSTYSSAMYNFVPQFALDFYQDVRNQDRAAVNKKLNDFVIPYLDIRDRV
KDGD_ARTS2            ETFALPLLQLGMSTYSSAMYNFVPQFALDFYQDVRNHDRVAVNKKLNDFVIPYLDIRDRV
KDGD_CORGL            ETFALPLLQMGMSTYSSAMFNFIPDFALSFYADVRAQDSAAVKQKLSDFVLPYLDIRDRA
KDGD_PSEPK            EVYAAAYKALGVPVYSSAVFNFVPKTAMDFYNAIARDDHATVAKLIDDFFLPYLDIRNRK
KDGD_PSESM            EVYAAAYKALGVPVYSSAVFNFVPKLAMDFYHAIARDDHEAVGKYIDDFFLPYLEIRNRK
KDGD_PSEPU            EVYAAAYKAMGVPVYSSAVFNFIPKTAMDFYRAVASEDHETVGKLIDDFFLPYLDIRNRC
KDGD_LEPCP            EVFAGAYKAMGCPVYSSAVFNFIPKTAMEFYNAHAAGDSATCDRLIRDFFLPYIALRNKN
KDGD_ACIBT            EVFAAPYKALGCPVYSSAVFNFIPKTAMEFYNALRSDDFETTNRLIKDFFLPLIKIRDRK
KDGD_ACIBS            EVFAAPYKALGCPVYSSAVFNFIPKTAMEFYNALRSDDFETTNRLIKDFFLPLIKIRDRK
A0A370KXJ7_9BRAD      EVYAPSYRAMGVPTYSSAVYNFAPRAAMAFFNAVQTGDLALIDRMMQAFFIPYGRIRARQ
F2JVA7_MARM1          EIFAEAYLSIGVNTYSSAVFNFMPDMAMSFYKSLRAGETENVKKIIQDFFIPFCRLRDTK
F6D0P7_MARPP          EIFAEAYLAIGVNTYSSAVFNFMPDMANRFYKALRAGEQETVTAIVKDFFVPFCRLRDEK
D2AQE7_STRRD          ELTMPAYRGIGVELYSSAVFCFAPEIATAYLNGD--------ERLIKEFYAPLVRLRDKV
A0A239M664_9ACTN      ELTMPAYRGIGVELYSSAVFCFAPEIAVAYLNGD--------EHLIKEFYAPLVRLRAKV
Q47P66_THEFY          ELTFHAYQGIGVPLYSSAAFAFVPEVATAFYRAAHAG-EELADRLLRDFYDPLVRLRDRV
A1R9V3_PAEAT          ELTQGAYRGLGIPLYSSAAFAMAPEIAKAYYDAYVSGDEERRHALLEGFYAPLVRLRDQT
B0RGN4_CLAMS          ESSQAAYRAIGVPLYSSAVFAMAPRVASAFHAAYRADDLERQRFLLDEFFTPLVRLRDET
C5BYU1_BEUC1          ELTQAAYRAIGVGLYSSAVYAAAPEVALAFHAALERGDDAARTTLLREFFAPFVRLRDAV
D0L597_GORB4          EITQQAYRALGVTLYSSATFAFAPDLALAFYNSLETGNTELTEALLREFFHPLVRLRNKV
A0R5B6_MYCS2          EVSQQAYRAIGVTLYSSATFAFAPDVSLAFYRALEDGKEPLVAALLRSFFHPLVRLRNKV
D3Q7W2_STANL          ELSAHAYRAIGVDSYSSASLCFVPDIASAFYRAFATGDEALSRLLLAEFYLPFARLRGQV
G0FWA7_AMYMS          EVSAKAYAAIGVARYSSAVHCFAPEIAHRFHRALGEGDTRVMDALLTGFYLPLVALRDET
KDGD1_STRAW           ELTGLAYRGIGITLYSSAVFCFAPEIALAFHKALNSGDDATVNRLLDGFYRPFVDLRAQG
KDGD1_STRCO           EQTQLSYRALGVPLYSSAVFCFAPEIAVAFHRALREGDDATVHRLLDGFYRPFVELRARG
A0A1N7GPX9_9ACTN      ELSQPGYRDLGVVRYSSAVFCFLPGLALACYWALRDGRDDVANRLIEGFYRPLAGLRSEG
C7QB47_CATAD          EMSQLAYAGVGVPGYSSAVFCFVPDVALAFYHGYRNGDTSLVNALLDRFYRPLVELRAKA
KDGD2_STRAW           EIQARAYAAVGVPAYSSAVHAFAPEIAGAFHAALRDGHGKAVEKLLREFYVPFVELRDRV
KDGD2_STRCO           EVQARAYAAVGVPAYSSAVHAFAPEIANAFLAALRGGDTGTVDKLLRDFYVPLVELRDRV
V6KLQ2_STRNV          EIQARAYATVGVPAYSSAVHAFAPEIANTFFHALRDGDDATVHKLLRDFYVPFVELRDRV
D7B7P1_NOCDD          ELQARSYAAIGVPAYSSAVHAFAPEIATAFFHALRAGDTAATDALLDGFFIPWVRLRDRG
A0A4R2CP45_9ACTN      EVTARSYAAIGVRAYSSAVHCFAPEIAHAYEAGL--------DELLPEFYLPLVKLRDKG
A0A1H6E4W8_9ACTN      EVFARSYAGLGARAYSSAVLAFVPEVATAFFLAFETGDDATQELLLREFYAPLADLRKTT
KDGD_BACSU            EVTMPAYLPIGFHSYSSAISNYIPHISRMFYDALKNGNDELVKELYRHVILPINDIRKQR
KDGD_BACLD            EVTMPAYAPIGFTSYSSAISNYIPHISRMFYEALLNGNDRLVKEIYEQVIIPINEIRKLR
D5DPJ8_BACMQ          EVTMPAYAPIGFNSYSSAISNYVPHISRMFYNALLSHDQELLSELYQNIILPINDIRKQK
KDGD_OCEIH            EVTMPAYIPLGFDSYSSAISNYIPHISRKFYDALLEGDETTVNEIYQEVILPINRIRRQG
A0A3A9K5S7_9BACI      EITMPGYFGTGFHSYSSAIANYIPHIARTFFEALKRNDKELVDELYKNVLFPINNLRKQR
A0A2N6RDB2_9BACI      EITMPAYKGIGFNSYSSAMSNYLPHVSRLYFDALLEGNDQLANEIYLDVLLPINHIRKQR
Q5WKU3_BACSK          ELTMPAYWPIGFHSYSSAISNYIPHISRCFFEALKRGDHEAVRTLYKDVLLPINVIRRQK
A0A2T4Z7Z5_9BACL      EITMPVYHALGYRSYSSAMSNYLPHISRLFYQALLNGDQKRLSQLYREVILPINRIRKQR
M7NIL6_9BACL          EVTMAAYYNLGYRTYSSAISNYIPHISAKYFEALQQGDGKTVRELHEEVILPIHSIRKRK
A0A3S0C5N3_9BACL      ELTMPAYSAIGYRSYSSAISNYIPHVSRKFYECLLAGDDAMLQQIYREIILPIHRIRQQR
                      *         *   ****     *  :                     .  *   :*   

KDGD_AGRFC            KGYAVSAVKAGVRLQ----GFNA--GPVRAPLKDLTNEEIGMLEALIGTHKRKA------
KDGD_RHIME            AGYPVSIIKAGVELA----GFAP--GPVRPPLVDLTGEEREILQGLIEASRR--------
S6HCC2_9GAMM          NGYPVSIVKAGLRAV----GRDP--GPVRTPLTDLTEEEQLMLTSVVKNYR---------
X6KWA9_9RHOB          TGYAVSAIKAGVALR----GFET--GPVRSPLTDLTEEERGMMQALIADRT---------
KDGD_XANCP            AGYAVSIVKAGMRAV----GRPA--GPVRTPLADLTEDEFAQLTQLIGGRR---------
KDGD_XANC8            AGYAVSIVKAGMRAV----GRPA--GPVRTPLADLTEDEFAQPTQLIGGRR---------
KDGD_RALSO            RGYAVSIVKAGMKVI----GRSA--GPVRAPLTDLTEAELAELSALVARIADVQKLAA--
KDGD_BRADU            KGYAVSIIKAGMKVI----GRDS--GPVRPPLTDLTEQEIAELTALVKKLPAIRSSQQAA
KDGD_RHOJR            QGYAVSIIKAGMTVI----DRPA--GPVRAPLTDLDAVELAELADLIKKVS---------
KDGD_PSECP            KGYSVSIVKGGLDAI----GRSA--GPVRTPLQNLAPQDLADLKALIATVS---------
KDGD_ARTS2            KGYSVSIVKGGLDAI----GRSA--GGVRPPLQNLAPQDLADLKALIATVS---------
KDGD_CORGL            QGYGVSIVKGGLKAV----GRNA--GGVRPPLRNLSEQDIADLSDLLATSGAGSYRLPVE
KDGD_PSEPK            AGYAVSIVKAGARIA----GYDA--GPVRTPLTDLTAEEYEMLAALMDKMGPQ-------
KDGD_PSESM            AGYAVSIVKAGAKIA----GYDA--GPVRAPLTDLTPDECDMLAALMDKQGKQ-------
KDGD_PSEPU            EGYGVSIVKAGARLV----GHDA--GPVRAPLTDLLPNEMEQLDALIKKLGAQ-------
KDGD_LEPCP            HGYAVSIVKAGATLI----GHGA--GPVRPPLSDLKPAEVAELAALMAKLGPQ-------
KDGD_ACIBT            SGYAVSMIKAGAKIV----GHDA--GPVRPPLSDLTQADYEDLAALIATLGPQ-------
KDGD_ACIBS            SGYAVSMIKAGAKIV----GHDA--GPVRPPLSDLTQADYEDLAALIATLGPQ-------
A0A370KXJ7_9BRAD      PGYAVSIVKAGVDIV----GRSA--GKVRPPLSDLTRAEYEELAPLIDALIRFSEDAHAL
F2JVA7_MARM1          KGYAVSLIKAGAELI----DRSA--GDVRAPLTRPTEADFAALKDIMDRQ----------
F6D0P7_MARPP          KGYAVSLIKSGAKLI----DRPA--GDVRAPLTMPNAQQEARLKALIEANS---------
D2AQE7_STRRD          PGYAVSLVKAGVRHR----GLDV--GGVRPPLVEPSAEHLDELVRLIKSGLALVGAQ---
A0A239M664_9ACTN      PGYAVSLVKAGVRHR----GLDV--GGVRPPLVDPSPEHVEELVRLIKSGLTLVEG----
Q47P66_THEFY          PGYAVSLIKAGARLR----GADV--GGVRPPFVDPSEEHLAELRTIIDTGLALLKEQ---
A1R9V3_PAEAT          PGFGVSLIKAGLRLA----GLPV--GSVRPPLVDPTEEQLLELKSILAKGHELAGS----
B0RGN4_CLAMS          PGFAVSLIKAGLRLG----GVPV--GSVRAPLVDPSPRQLAELERILAHGEDVVA-----
C5BYU1_BEUC1          PGYAVALVKAGVGLG----GIEV--GGVRPPLVAPTPEHRDALAALLEHGRAVAAQVRHP
D0L597_GORB4          PGYAVSLVKEGVRME----GIAA--GPVRAPLVDLTDEHRAELARITAAGRAVLTDSLAT
A0R5B6_MYCS2          PGYAVSLIKAGVTLG----GLQA--GPVRPPLIDAAPDDVDELQRILSAGRAVLADALVH
D3Q7W2_STANL          PGYAVSLVKAGARLA----GLPM--GPVRPPLVEPTPEHLRRLRDIIDAGREALASHPAK
G0FWA7_AMYMS          PGFAVSLVKAAARLR----GDKV--GPVRPPLVEPTPEQVRRLEKVVEDGFVTLKGLG--
KDGD1_STRAW           RGYAVSLVKAGVRLR----GLDV--GEVRPPLHEPTEDHVKQLAQLVDRGYALLQEGM--
KDGD1_STRCO           RGYAVALVKAGVRLR----GLDV--GEVRTPLQEPAEEHVKQLVQIIERGQVLVEEGAGR
A0A1N7GPX9_9ACTN      PGYAVSLVKAGVRLR----GLDV--GPVRRPLSDPSPEHLDRLAALIDRGLALLEELERS
C7QB47_CATAD          PGYAVALVKAGVRLD----GLDA--GPVRPPLTEAAPEHVARLQELIDEGRRVLTGHGID
KDGD2_STRAW           PGYGVSLVKAAARLR----GRPV--GPVRAPLTDPSAADLADLTSLLSTGLDLVGAAL--
KDGD2_STRCO           PGYAVSLVKAAARLR----GCPV--GPVRAPLTDPSPADLAALTTLLTTGLDLVGAAL--
V6KLQ2_STRNV          PGYAVALVKAAARLR----GLAV--GPVRAPLTDPGPADLAELAKILDDGVNLVGAVRQR
D7B7P1_NOCDD          PGYSVSLVKAVARTRAAAIGADV--GPVRAPLSAPGPAHLEEAERLLDAGLDLAARLARR
A0A4R2CP45_9ACTN      AGYAVSLVKAAVRKR----WTDV--GSVRSPLTDPLPEHLEELDQILENGLTLVRKETA-
A0A1H6E4W8_9ACTN      PGYAVSLIKAGLEIR----GRSA--GPVRSPLGHVTPEHRERLARIIDRGLAALTATPVA
KDGD_BACSU            KGYAVSLIKAGMEIM----GLNV-RNTARPPVGPVEKDHYQQLEAILKQAADRFPKKAAT
KDGD_BACLD            KGYAVSLIKAGMEIM----GLHV-KNTARPPIVPVEKEHCRQLENILKNAMARYPKTTAA
D5DPJ8_BACMQ          KGYAVSLIKAGMEII----GLPV-TDRVRPPIVSVDKEHYAQLEKILTQAFDQYPKSSKQ
KDGD_OCEIH            KGYAISLIKAGMEIV----GLPINSNNVRPPVTPVKKEHYEQLEEILKKALIKYPSNLTK
A0A3A9K5S7_9BACI      KGYNVSLIKAGMEII----GLPI-GSTVRPPLIPVEKEHFLQLETILKEALEKYPVHICK
A0A2N6RDB2_9BACI      KGYAVSLIKAGMNIM----GFPV-ENSVRPPCVPVEQEHYQQLKNIIEETLEKYPAQQRE
Q5WKU3_BACSK          KGYAVSLIKAGMEIV----GLPV-QEHVRAPLVPVEKSHYKQLAQILENAHKKYPRNHIS
A0A2T4Z7Z5_9BACL      NGYAVALIKAGMEIV----GLPV-GKTVRPPLTVVEPEHYAELETIIQHALENFPKEEAL
M7NIL6_9BACL          EGYAVSLIKAGMNIV----GLPV-GTTVRPPIAPVEPEHYEELKGILEKALENYPVPEKT
A0A3S0C5N3_9BACL      KGYAVSLIKAGMEIV----GLPV-GLTVRTPLIPVERAHYTQLEAIIQRSHELIANTHA-
                       *: :: :*                  .* *       .      :              

KDGD_AGRFC            ----
KDGD_RHIME            ----
S6HCC2_9GAMM          ----
X6KWA9_9RHOB          ----
KDGD_XANCP            ----
KDGD_XANC8            ----
KDGD_RALSO            ----
KDGD_BRADU            E---
KDGD_RHOJR            ----
KDGD_PSECP            ----
KDGD_ARTS2            ----
KDGD_CORGL            VKA-
KDGD_PSEPK            ----
KDGD_PSESM            ----
KDGD_PSEPU            ----
KDGD_LEPCP            ----
KDGD_ACIBT            ----
KDGD_ACIBS            ----
A0A370KXJ7_9BRAD      AR--
F2JVA7_MARM1          ----
F6D0P7_MARPP          ----
D2AQE7_STRRD          ----
A0A239M664_9ACTN      ----
Q47P66_THEFY          ----
A1R9V3_PAEAT          ----
B0RGN4_CLAMS          ----
C5BYU1_BEUC1          DARA
D0L597_GORB4          V---
A0R5B6_MYCS2          ----
D3Q7W2_STANL          DAS-
G0FWA7_AMYMS          ----
KDGD1_STRAW           ----
KDGD1_STRCO           ----
A0A1N7GPX9_9ACTN      PDPA
C7QB47_CATAD          TLA-
KDGD2_STRAW           ----
KDGD2_STRCO           ----
V6KLQ2_STRNV          V---
D7B7P1_NOCDD          ----
A0A4R2CP45_9ACTN      ----
A0A1H6E4W8_9ACTN      ----
KDGD_BACSU            V---
KDGD_BACLD            L---
D5DPJ8_BACMQ          VLS-
KDGD_OCEIH            SL--
A0A3A9K5S7_9BACI      ----
A0A2N6RDB2_9BACI      VSK-
Q5WKU3_BACSK          L---
A0A2T4Z7Z5_9BACL      TE--
M7NIL6_9BACL          VEVS
A0A3S0C5N3_9BACL      ----