CLUSTAL format seed alignment for MF_00703

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TYPH1_ACISJ      -------------MSDHAMNEQRDHDTRLRAWRTG------IDTYQEPIVYMRSDCVVCR
TYPH2_ACISJ      -----------MTAQMHEAGRTKEAGNRLQAWRTG------IDTYQEPVVYMRRDCPVCR
TYPH_POLSJ       -------------MQTPPTPLSSLTPHKLRLRRLG------IDTYQEPVLYMHRDCRVCH
TYPH_PARL1       --------------MSARITPQ---TPALQALRMR------LHAQHQPVVLMRTDCHVCR
TYPH_TOLAT       --------------MSARITPQ---TPALQALRMR------LHAQHQPVVLMRTDCHVCR
TYPH_CHESB       --------------MTALVSPAGPEQPSLRVRRLL------LHTQHQPVVVMHTDCHVCR
TYPH_SPHAL       --------------MTHPVPDTGPASENMAPHRLRARPLGLFLPQQQPAVVMRTDCYICR
TYPH_HAHCH       --------------------MQQRELNYLFLKRIG------INTHQEPVVYMRQDCHVCR
TYPH_MARMM       ---------MTKMIDISAMPAELSEKNTLTARRLG------IDTHEHAVIYMRADCHICR
TYPH_LEGPN       -------MHDSFLSANGGFVVSKKTPHGLRLKHLG------IKTYHEAIIYMREDCHVCH
TYPH_LEGPH       -------MHDSFLSANGGFVVSKKTPHGLRLKHLG------IKTYHEAIIYMREDCHVCH
TYPH_LEGPC       -------MHHSFLSANGGVVMSKKTAHGLRLKHLG------IKTYHEAIIYMREDCHVCH
TYPH_LEGPA       -------MHHSFLSANGGIVVSKQTSHGLRLKHLG------IKTYHEAIIYMREDCHVCH
TYPH1_CUPNH      MNDASSDPGIPGRPGDVVAAAAPREVGALVFRPLE------IDTWQEHVIYMHPDCPVCR
TYPH2_CUPPJ      MQANELK----------LAAGEGQGSEPLIFKPLG------IDTWQEHVIYLHPDCPVCR
TYPH_RALSO       ---------------MLAPPEVAALPDRLTFKPLG------IDTWQEHVIYMHPDCAICR
TYPH_BRASB       -------------MSTIDSA-----RPQLKIRSVA------LDTGRENVVVISRRSRALR
TYPH_BRASO       -------------MSPADTA-----RPQLKIRSVA------LDTGRENVVVISRRSRALR
TYPH_BRADU       --------------MHPDLP-----HSQLKIRRVR------LDTGRENVVVISRQSKALR
TYPH_RHOP5       -------------MSPVDAA-----RPQLKIRQIH------LDTGRENVAVISRHSKALR
TYPH_RHOPB       -------------MTSADAP-----RPQLKIRLIH------LDTGRENVAVMSRRSKALR
TYPH_NITHX       -------------MNGTDLP-----RLQPKIRRVN------LDTGRENVVVISRHSAALR
TYPH_RHOPA       -------------MNAPDLT-----RPPLTIRRIS------LDTGRENVAVISRRSRALR
TYPH_RHOPT       -------------MNAPDLT-----RPPLTIRRIS------LDTGRENVAVISRRSRALR
TYPH_RHOPS       -------------MNASHLS-----RPPLTIRRIS------LDTGRENVAVISRRSRALR
TYPH_PSEU5       -----------MTSISSDTPLNGKAPVHLALRRVA------IDTYRENVAYLHRDCAACR
TYPH_RHOFT       ------------MRKHTDKP---QLASKLVLRRVA------IDTYRENVAYLHRDCAVYR
TYPH_METCA       ---------------MSDEE---SIKTRLKLRPVA------IDTYRENVAYLHRECSVYR
RBKTP_CUPNH      ------------------------------------------------------------
RBKTP_CUPPJ      ------------------------------------------------------------
RBKTP_AZOC5      -------------------------------->MA------IETGRRNVAFLARGNTVVA
RBKTP_ROSDO      ----------------------------->ITRFP------VTIGSKQVCLVHKGNQIAS
                                                                             

TYPH1_ACISJ      SEGFTTQTRVLLTAG-TRSAVATLNVVEGN-WLAPGVAGLSEAAWHALDPAADAWINVSY
TYPH2_ACISJ      SEGFTTQARVQLTAG-GRSIVATLSVVDGD-WLAENVAGLSESAWASLGAQPGEPVAVTH
TYPH_POLSJ       SEGFEAQSRVELALG-DRTIVATLNVVSGD-FLAPDEAGLSEAAWRLLGAQEGDMVSPRH
TYPH_PARL1       AEGLAPRSQVLIIAG-DRTVQALLYQIDSD-LLKTGQIALSEAAWDALDIHEGDLVQVRH
TYPH_TOLAT       AEGLAPRSQVLIIAG-DRTVQALLYQIDSD-LLKTGQIALSEAAWDALDIHEGDLVQVRH
TYPH_CHESB       SEGLAARSQVLLTNG-ARQVHATLFQVDGDAVLSHDEVGLSETAWDLLGVAEGDEVRVSH
TYPH_SPHAL       SEGLAARSQVLIQAG-GREILASLLHSSGE-MIAPGEIGLSESAAAALGVAPGDAVSVRH
TYPH_HAHCH       SEGFNAHSRVRVTTN-KRSIIATVHQVTDG-WLSHQEAGLSDAAWRLLEAEDGEVAYFSH
TYPH_MARMM       AEGFNNHARIKVSGPSNKAIIATLNLVVTD-LLSPGQIGLSETAWLRLQLNEGDPVRLIH
TYPH_LEGPN       SEGFEVQTRIQVTLG-SRSIIATLNVVTSE-LLQPGEAGLSDYAWESLHAKEGDEIQVSH
TYPH_LEGPH       SEGFEVQTRIQVTLG-SRSIIATLNVVTSE-LLQPGEAGLSDYAWESLHAKEGDEIQVSH
TYPH_LEGPC       SEGFEVQTRIQVTLG-QHSIIATLNVVTSE-LLAPGEAGLSDYAWDALHAKEGDEIQVSH
TYPH_LEGPA       SEGFEVQTRIQVTLG-QRSIIATLNVVTSE-LLQPGEAGLSDYAWESLHAKEGDEIQVSH
TYPH1_CUPNH      AEGFSAQARVRVQIG-DRSLIATLTLLGAP-LLNTGEASLSLSAARTLSARAGDVVHVTH
TYPH2_CUPPJ      AEGFTAQARVQVRIG-EASLIATLNLVGAP-LLDTGEASLSASAAQALEARAGDVVAISH
TYPH_RALSO       AEGFTAQARVEVRIG-LRSLIATLNLVGSG-LLEMCEVSLSVSAVETLMARPGDIVTVSH
TYPH_BRASB       PEVFSGFSRVELRCN-SRTLLATLLITDDDALVGPDEIGLSQPALRRFAEPAGTFATVSP
TYPH_BRASO       PEVFSGFSRVELRCN-SRTLLATLLITDDDALVGPDEIGLSEPALRRFAEPAGMLATVSP
TYPH_BRADU       AEIFRGFSRVELRLN-GKVLLATLLITDDDTLAAQDEIGLSEPAFRRFAEPVGTLVAVTP
TYPH_RHOP5       PEVFSGFSRVEIRRG-NQSMLATLLITDDNAMVGPDDLGLAEPAFRRFGEAAGSLVSVTP
TYPH_RHOPB       PEVFSGFSRVEIRRN-AKSVLATLLITDDDALVGPDELGLAEPAFRRFGEPAGTFVTVSP
TYPH_NITHX       PEIFRGFSRVELRRN-AKIMLATLIITDDDSLVGPDDLGLSEPAFRRFAEPVGSAVTIAP
TYPH_RHOPA       PEVFRGFSRVELRIN-SKVLLATLMITDDDAMIGPDEVGLSEPAFRRFNEPVGSAVSVTP
TYPH_RHOPT       PEVFRGFSRVELRIN-SKVLLATLMITDDDAMIGPDEVGLSEPAFRRFNEPVGSAVSVTP
TYPH_RHOPS       ADVFRGFSRVALRIN-TKVLLATLMITDDDAMIGPDELGLSEPAFRRFNEPVGSAVSVSP
TYPH_PSEU5       AEGFQALAKVEIRVN-GRRILASLNLVDDPSIVGCDELGLSEDAFAQLGAEAGVPAAIAQ
TYPH_RHOFT       AEGFQALSKVEVRAN-GRHILATLNVVDDPNIVACNELGLSEDAFAQMAVIDGQPASVSQ
TYPH_METCA       AEGFQALAKIRVGCN-GKQIEAVLNVVDDVCIVAPDELGLSEQAFQRFGEPAGQLVNVAQ
RBKTP_CUPNH      -------------------------------------------------->LRTGTRTSA
RBKTP_CUPPJ      ----------------------------------------------------------->
RBKTP_AZOC5      APDYLGPGRVDLIGE--GRSIRAEVALVGDALLPSDAVGLSSEAFGALGLPEGAELVLTR
RBKTP_ROSDO      RVLAGSSRVTLSLRG--KSVSAELGETWSDEIVSQDLCALSEGAMAALDAVEGDVVSIER
                                                                             

TYPH1_ACISJ      APTLDSLSHVRAKVYGHRLDAGAFNAVIGDVAAGRYSDLYLAAFVTACAGDRLDLSETVA
TYPH2_ACISJ      APPLDSLSHVRAKVYGNSLGDAQFGAIISDVAAGRYSDLHLATFITACAGDRLDLAETLS
TYPH_POLSJ       PAPIESLGHVRAKVYGRHLTQAAITAVIEDVTAGRYSDLQLAAFVTACAGDRLDQEETVS
TYPH_PARL1       PPLLESLSAVRARIHGHRLQTTELQAIVRDVVDGRYTDVALSAFLTATAVLPLDMQETIH
TYPH_TOLAT       PPLLESLSAVRARIHGHRLQTTELQAIVRDVVDGRYTDVALSAFLTATAVLPLDMQETIH
TYPH_CHESB       PPALESLASVRRRIYGHRLDAQALSEIVRDVAAGRYTDVHLAAFLTASAALPLDENETAD
TYPH_SPHAL       APPIDSFGALRGRVYGNRLDGAAFRSIVDDIVAGRYSDVHLSAFVTACSAFPLDHAETVA
TYPH_HAHCH       TKAVDSMSHVRGKLYGASLTQESADEVVKDVAGGLYSDVQLAAFVTACAGSRLNQDEVAA
TYPH_MARMM       PAPLLSLSAVRAKIFGEPLDQNNLDAIVGDIAAGRFSDIHLSAFLTASAAHEQSFEEIRD
TYPH_LEGPN       PKPLESLSYVHAKIYGNELSFEQMKVIIDDVLSGRLSDVQISAFLAASGAGRLTRTEVMK
TYPH_LEGPH       PKPLESLSYVHAKIYGNELSFEQMKVIIDDVLSGRLSDVQISAFLAASGAGRLTRTEVMK
TYPH_LEGPC       PKPLESLSYVHTKIYGNELSYEQMKVIIDDVLSGRLSDVQISAFLAASSAGRLTRTEIMK
TYPH_LEGPA       PKPLESLSYVHTKIYGKELSYEQMKVIIDDVLSGRLSDVQISAFLAASSAGRLTRTEIMK
TYPH1_CUPNH      APALESVRALRAKIYGCHLDSVQLDGIIGDISAGRYADVHIAAFLTACADGRMSLRETVD
TYPH2_CUPPJ      APALESVRALRAKIYGRRLDGAQIDSIISDISAGRYPDVYISAFLAACADGRMNRRETVD
TYPH_RALSO       APALESLRAVRAKIYGAHLDTHQLASVVGDIAKERYADVHIAAFLSACAGGRMSVKETID
TYPH_BRASB       ATPPDSLEAVRAKIRGETLSDQAISAVIDDLAHYRYSDMEIAAFLIGSASF-MTSGELLA
TYPH_BRASO       ATPPESLEAVRAKIRGETLSDEAIAAVIEDLAHYRYSDMEIAAFLIGSASF-MTSGELLA
TYPH_BRADU       ATPPESLEAVRAKIRGRTLSQAEIGAIINDLAHYRYSDMEIAAFLIGSASF-ITSDELLA
TYPH_RHOP5       ASPPASLDAVRGKIQGRTLTAPEIEAIVNDLARYRYSDMEIAAFLIGAARF-MTSDELLA
TYPH_RHOPB       ATPPDSLDAVRGKIQGRTLSAAEITAIVNDLTRYRYSDMEIAAFLIGAARF-MTSDELLA
TYPH_NITHX       AASPASLDAVRAKIMGQTFSAVDISAIIDDLTHYRYSDMEIAAFLISSASF-MTNGELIA
TYPH_RHOPA       ARSPASLDAVRAKIQGHTLSAAEITAIVDDLAHFRYSDMEIAAFLISAARF-TTTDELLA
TYPH_RHOPT       ARSPASLDAVRAKIQGHTLSAAEITAIVDDLAHFRYSDMEIAAFLISAARF-TTTDELLA
TYPH_RHOPS       AQPPASLDAVRAKIQGHTLTPAEITAVIDDVAHFRYSDMEIAAFLISAARF-TSTDELLA
TYPH_PSEU5       AEPAASIPALHRKIAGERLNRDDFLAIMRDIAEHRYSKIELTAFVVACNQGELDREEVFF
TYPH_RHOFT       AEPPQSIGALRRKLAGERLGREDFLGIVRDIAELHYSKIELSAFVVATNRDELDREEVYF
TYPH_METCA       AEPPLSMDGVRRKIGGERLDYGDYQAITSDIAKGRYSKMEMAAFLVATGQNGLDRDEVLS
RBKTP_CUPNH      AERPASRTNLMAKLRGEPLDEAAYVAVLQDAIAGRYTEAELTEFLVAATRT-LTDEEVVA
RBKTP_CUPPJ      VPQPASRRHLAAKLDGQPLDEGAYEAILRDAIAGRYTAQELTAFLTAATRS-LDDREVVA
RBKTP_AZOC5      TPVPESRAALRRKIQGATLDEGAYAQVVGDIVEGRYPDSEVAGFLVAADRS-LSDDEVLA
RBKTP_ROSDO      SPTPKSRSILQKKVRGGELSHAEMEAFIHDLVNGRFSTSEIAGFLVAASNN-LTMDEVIS
                      *   :  :: *  :       .  *      .   :: *: .         *   

TYPH1_ACISJ      LTRAMVAVGHRLDWGRETVVDKHCVGGLPGNRTTLLVVPIVAACGLTMPKTSSRAITSPA
TYPH2_ACISJ      LTKAMIAVGDRIDWGRPLVVDKHCVGGLPGNRTTLLVVPIVTACGLMMPKTSSRAITSPA
TYPH_POLSJ       LTRAMVAAGERIDWGEGLVMDKHCVGGLPGNRTTMVIVPIVAACGLRMPKTSSRAITSPA
TYPH_PARL1       LTRAMVDVGDHLQWQAPIVVDKHCVGGLPGNRTTPLVVAIAAANGLVMPKTSSRAITSPA
TYPH_TOLAT       LTRAMVDVGDHLQWQAPIVVDKHCVGGLPGNRTTPLVVAIAAANGLVMPKTSSRAITSPA
TYPH_CHESB       LTGAMIAVGDRMEWDAPTVVDKHCVGGLPGNRTTPIVVAIVAANGLVMPKTSSRAITSPA
TYPH_SPHAL       LTGAMVASGERLAWGSDVVVDKHSVGGLPGNRTTPIVVAIVAALGLIMPKTSSRAITSPA
TYPH_HAHCH       LTSAMVKVGQRIDWGTSPIMDKHCVGGLPGNRTTPIVVAIVTACGLRMPKTSSRAITSPA
TYPH_MARMM       LTLSMVNVGQRLDWGRAPIVDKHCVGGLPGNRTTPIVVAICVAAGLTMPKTSSRAITSPA
TYPH_LEGPN       LTKAMIDSGDRLSWPSPLVVDKHCVGGLPGNRTTLIVVPIVASFGLMIPKTSSRAITSPA
TYPH_LEGPH       LTKAMIDSGDRLSWPSPLVVDKHCVGGLPGNRTTLIVVPIVASFGLMIPKTSSRAITSPA
TYPH_LEGPC       LTKAMIDSGDRLSWSSPLVVDKHCVGGLPGNRTTLIVVPIVAAFGLMIPKTSSRAITSPA
TYPH_LEGPA       LTKAMIDSGDRLSWSSPLVVDKHCVGGLPGNRTTLIVVPIVAAFGLMIPKTSSRAITSPA
TYPH1_CUPNH      LTRAMVRSGQRLNWDREVVADKHCVGGLPGNRTTPVVVAIAAAAGLLLPKTSSRAITSPA
TYPH2_CUPPJ      LTRAMVHSGERLSWSHAVVADKHCVGGLPGNRTTPIVVAIAAAGGLVLPKTSSRAITSPA
TYPH_RALSO       LTQAMVDSGECLEWDREIVADKHCVGGLPGNRTSPIVVAIAAAAGLLLPKTSSRAITSPA
TYPH_BRASB       LTRAMANAGTQLKWPEPVVVDKHCIGGIPGNRTSMVVVPIVAAHGLTIPKTSSRAITSPA
TYPH_BRASO       LTHAMANAGTQLTWPEPVVVDKHCIGGIPGNRTSMVVVPIVAAHGLTIPKTSSRAITSPA
TYPH_BRADU       LTGAMAQAGTQLVWPDPVVVDKHCIGGIPGNRTSMVVVPIVAAHGLPIPKTSSRAITSPA
TYPH_RHOP5       LVSAMASVGTQLRWDRPVVVDKHCIGGIPGNRTSMVLVPIVAAHGLTIPKTSSRAITSPA
TYPH_RHOPB       LVSAMASVGTQLRWDRPIVVDKHCIGGIPGNRTSMILVPIVAAHGLTIPKTSSRAITSPA
TYPH_NITHX       LVDSMARAGTQLKWRNPIIVDKHCIGGIPGNRTSMIVVPIVAAHGLTIPKTSSRAITSPA
TYPH_RHOPA       LVGAMASVGTKLTWDTPIVVDKHCIGGIPGNRTTMIVVPIVAAHGLMIPKTSSRAITSPA
TYPH_RHOPT       LVGAMASVGTKLTWDTPIVVDKHCIGGIPGNRTTMIVVPIVAAHGLMIPKTSSRAITSPA
TYPH_RHOPS       LVDAMASVGTRLKWQNPIVVDKHCIGGIPGNRTTMIVVPIVAAQGLMIPKTSSRAITSPA
TYPH_PSEU5       LTDAMIRVGRRLDWREHPVVDKHCIGGIPGNRTSMLVVPIVAAHGMLCPKTSSRAITSPA
TYPH_RHOFT       LTEAMVASGRTLNWHEPLVVDKHCIGGIPGNRSSMLVVPIVAAHGLLCPKTSSRAITSPA
TYPH_METCA       LTRAMLETGVRLSWNEPLVADKHCIGGIPGNRTSLLIVPIVAAHGMLIPKTSSRAITSPA
RBKTP_CUPNH      LARARTAFTPRIDWDEPVVVDKHSMGGVPGSRITLIVVPIVAAYGLAMPKTSSRAITSAA
RBKTP_CUPPJ      LARARTRFTARIEWDEPIVVDKHSMGGIPGSRITLIVVPIVAAYGLAMPKTSSRAITSAA
RBKTP_AZOC5      LAKVRAKFASRITWDEPMVVDKHSMGGIPGSRITMIVVPIVAAHGLAIPKTSSRAITSAA
RBKTP_ROSDO      LTQVRAAFAHRHDWGKAIVVDKHSMGGVPGNRITPIIIPILAAFGLTVPKTSSRAITSAA
                 *.           *    : ***.:**:**.* : :::.* .: *:  **********.*

TYPH1_ACISJ      GTADTMEVLAPVNLDIAAMRRTVERTGGCIVWGGSVRLSPADDVLIRVERPLDLDSEGQL
TYPH2_ACISJ      GTADTMEVLAPVNLDVPSMRRVVERTGGCIVWGGSVRLSPADDILIRVERPLDLDSEGQL
TYPH_POLSJ       GTADTMETLAPVDLDVAQIRRVVERTGGCVVWGGAVRLSPADDILIRVERPLDLDSQGQL
TYPH_PARL1       GTADTMETLAPVDLDLDTLRKVVEKEGGCVAWGGAMHLSPADDIFVRIERELDIDTQGQL
TYPH_TOLAT       GTADTMETLAPVDLDLDTLRKVVEKEGGCVAWGGAMHLSPADDIFVRIERELDIDTQGQL
TYPH_CHESB       GTADTMETLAPVDLDLATLRRVVEAEGGCIAWGGAVHLSPADDIFVRVERELDVDTEGQL
TYPH_SPHAL       GTADTMETLAPVNLDVGAIRRVVDHEGGCIVWGGAVSLSPADDIIIGVERVLDLDAAGQL
TYPH_HAHCH       GTADTMETMAPVNLTLAQMKKVVEQEGGCIAWGGSVSLSPADDVLIRIERALDLDSEGQL
TYPH_MARMM       GTADTMETLAPVELDVSAMRRVVETVGGCIVWGGAVALSPVDDTLIRIERALDIDSDGQL
TYPH_LEGPN       GTADTMETLAPVHLSPQKMRQVVEQENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQL
TYPH_LEGPH       GTADTMETLAPVHLSPQKMRQVVEQENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQL
TYPH_LEGPC       GTADTMETLAPVHLSPQKMRQVVEQENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQL
TYPH_LEGPA       GTADTMETLAPVHLSPQKMRQVVEQENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQL
TYPH1_CUPNH      GTADTMEALTRVTLDSTELRRVVEQVGAALVWGGALSLSPADDVLIRVERALDIDSDAQL
TYPH2_CUPPJ      GTADTMETLTRVALSAAELRHVVERVGASLVWGGALNLSPADDILIRVERALDIDSDAQL
TYPH_RALSO       GTADTMETLTRVALSATELRRVVDRVGASLAWGGALSLSPADDVLIRVERALDVDSDAQL
TYPH_BRASB       GTADTMEVLARVNVGAEEMKSIVAACNGCVIWGGHVNLSPADDILISVERPLSLDTREQM
TYPH_BRASO       GTADTMEVLARVNVGAEEMKSIVAACNGCVIWGGHVNLSPADDILISVERPLSLDTREQM
TYPH_BRADU       GTADTMEVLARVNVGVEEMKAIVSSCNGCLIWGGHVNLSPADDVLISVERPLSLDTREQM
TYPH_RHOP5       GTADTMEVLARVDVGVPEMKEIVAACNGCLIWGGHVNLSPADDILISVERPLCLDTREQM
TYPH_RHOPB       GTADTMEVLARVDVSVAEMKEIVAACNGCLIWGGHVNLSPADDILISVERPLCLDTREQM
TYPH_NITHX       GTADTMEMLARVDVGVEEMKDIVAACRGCLVWGGHVNLSPADDILISVERPLGLDTREQM
TYPH_RHOPA       GTADTMELLARVDLDVEQMKQVVHACGGCLVWGGHVNLSPADDILISVERPLSLDTPEQM
TYPH_RHOPT       GTADTMELLARVDLDVEQMKQVVHACGGCLVWGGHVNLSPADDILISVERPLSLDTPEQM
TYPH_RHOPS       GTADTMEVLARVDLDVEQMKRVVTTCGGCLIWGGHVNLSPADDILISVERPLSLDTPEQM
TYPH_PSEU5       GTADTMEVLANVELPFERLCEMVREERGCLAWGGSSDLSPADDVLIAVERPLSIDSPGQM
TYPH_RHOFT       GTADTMEVLAKVELPVDQLADIVRTHRGCLAWGGAAHLSPADDVLISVERPLAIDSPGQM
TYPH_METCA       GTADTMEVLARTDLAPESLDRLVRMERGCLAWGGTTRLAPVDDMLISVERPLGIDSQGQM
RBKTP_CUPNH      GTADAMETIARVDLAHEDVRRCVAQARACIAWNGRLNHSVVDDVMNAITRPLRLDSRRWS
RBKTP_CUPPJ      GTADAMETVARVDLTHDDVRRCVAQARACIAWNGRLNHSVIDDVMNAITRPLGLDSRRWA
RBKTP_AZOC5      GTADAMETLARVDLDSAEVRRTVERARGCIAWNGRLSHSALDDVMNAITRPLGLDSTRWS
RBKTP_ROSDO      GTADMMEVLSRVDLSPDEMKSVVEQTNGCIAWNGNLTHSPVDDVMNAINRPLGLQSTLLD
                 **** ** :: . :    :   *    ..: *.*    :  ** :  : * : :::    

TYPH1_ACISJ      VASVLSKKAAAGSTHVLIDLPVGPTAKVRSTEAAQSLGRRLVEVGRAIGLQVTLRITDGL
TYPH2_ACISJ      VASVLSKKAAAGSTHVLIDLPVGATAKVRSAHAAASLGRRLQEVGGAIGLQVFLRVTDGE
TYPH_POLSJ       VASILSKKVAAGSTHVLIDMPVGPTAKVRSAEAADLLGRLLGQVGQTLGLRMRVVQTDGL
TYPH_PARL1       IASVLSKKIAAGATHIVIDIPVGPTAKVRSRETAEHLAHHLSEVAASFGLVLRCLFTDGN
TYPH_TOLAT       IASVLSKKIAAGATHIVIDIPVGPTAKVRSRETAEHLAHHLSEVAASFGLVLRCLFTDGN
TYPH_CHESB       IASVLSKKISAGSTHVVIDIPVGPTAKVRGEDAASHLASRITAVASRFGLAATCVQTDGS
TYPH_SPHAL       VASVLSKKLAAGATHLVVDMPIGPTAKVRSPADAAALSGALQKVAAEFGLILKVMQGDGR
TYPH_HAHCH       VASVISKKVAAGSTHVLIDIPIGMTAKVRSPEYAERLASHMRYTGVKLGIQVEAMFTDGA
TYPH_MARMM       VASVLSKKIAAGATHLVIDMPVGPTAKVRTEEAAARLEGLFARVGSNLGLNLKIMRTDGS
TYPH_LEGPN       VASILSKKIATGATHAVIDIPVGPTAKVRNQSMALLLKQSLEEVGNELGLVVRALFTDGS
TYPH_LEGPH       VASILSKKIATGATHAVIDIPVGPTAKVRNQSMALLLKQSLEEVGNELGLVVRALFTDGS
TYPH_LEGPC       VASILSKKIATGATHAVIDIPVGPTAKVRNQSMALLLKQSLEEVGNELGLVVHTILTDGS
TYPH_LEGPA       VASILSKKIATGATHAVIDIPVGPTAKVRNQSMALLLKQLLEEVGNELGLVVRTLLTDGS
TYPH1_CUPNH      VASILSKKIAAGSTHVLIDVPVGPTAKIREDSDLARLDLAMTKVADAFGLKLRILRTDGS
TYPH2_CUPPJ      VASILSKKVAAGSTHILIDVPVGPTAKVREDRDLERLEAAMRHVAGAFGLHILMVRTDGT
TYPH_RALSO       AASILSKKIAAGSTHVLIDVPVGPTAKVRSLQDLERLRMLLERVARSFGVRVTIVRTDGS
TYPH_BRASB       VASILSKKLAAGSTHLLLDLPVGPTAKLSSGAEAMRLRKLFEFVGDRFGLNVEVITTDGR
TYPH_BRASO       VASILSKKLAAGSTHLLLDLPVGPTAKLTSGAEAMRLRKLFEFVGDRFGLKVEVITTDGR
TYPH_BRADU       VASIMSKKIAAGSTHLLIDIPVGPTAKVTGAVEAMRLRKLFEFVGDRFGRTVEVITTDGR
TYPH_RHOP5       VASIMSKKLAAGSTHLLVDLPLGPSAKVISPIDAMRLRKLFEFVGDHFGIAVETITTDGR
TYPH_RHOPB       VASIMSKKLAAGSTHLLVDLPVGPTAKVASALDAMRLRKLFEFVGDHFGIAVETITTDGR
TYPH_NITHX       VASILSKKLAAGSTHLLIDLPVGPTAKLVNEMEAMRLRKLFEFVGDHYGISVEVVVTDGR
TYPH_RHOPA       VASIMSKKLAAGSTRLLIDFPVGPSAKVTNANEAMRLRKLFEFVGDHFGISVEVVTTDGR
TYPH_RHOPT       VASIMSKKLAAGSTRLLIDFPVGPSAKVTSANEAMRLRKLFEFVGDHFGISVEVVTTDGR
TYPH_RHOPS       VASIMSKKLAAGSTRLLIDFPVGPSAKIASASEAMRLRKLFEFVGDHFGIAVEVVTTDGR
TYPH_PSEU5       VASILSKKIAAGSTHLLLDIPIGPTAKVRSMAEAQRLRKLFEFVATRLGLTLDVVITDGR
TYPH_RHOFT       VASILSKKIAAGSTHLVLDIPIGPSAKVRSMPEAQRLRRLFEYVAGRMHLSLDVVVTDGR
TYPH_METCA       VASILSKKLAAGATHLLLDIPVGPTAKVRQMRDAMSLRKLFEYVGDRVGLHLEAVITDGA
RBKTP_CUPNH      VASILSKKYTAGATHVIVDLPYGPQTKLATRADAEALGALFEHVGKGLGLHVRALVTDGS
RBKTP_CUPPJ      VASILSKKATAGATHVIVDIPYGPQTKLSARADADALAGLFEEVGKGLGLHVRALVTDGS
RBKTP_AZOC5      VASILSKKLAAGSTHVVIDLPFGARARVKGAGEAHEMARLFEQVGAGLGLTVEAIPTDGS
RBKTP_ROSDO      VSSIMSKKLAAGSTHVLIDMPVGPKAKTRTQGEAGALKNLFESVGQGIGLNTKVQISDGT
                  :*::*** ::*:*: ::*.* *  ::         :   :  ..            ** 

TYPH1_ACISJ      QPVGRGVGPALEARDVLAVLRGQADAPDDLRQRALRLAGDILELGGAAP-NGSGLQLAAE
TYPH2_ACISJ      QPVGRGIGPALEARDVLAVLQGTREAPADLRERALRLAADILEMGGAAP-AGGGLKLATE
TYPH_POLSJ       APVGRGIGPALEARDVLAVLRNLATAPADLAQRSLLLAGEVLEFGGAAP-AGGGLALASA
TYPH_PARL1       QPVGRGIGPALEARDVLAVLRNEADAPQDLCDRVALVAGAVLELGGVAK-EGDGIRLAHE
TYPH_TOLAT       QPVGRGIGPALEARDVLAVLRNEADAPQDLCDRVALVAGAVLELGGVAK-EGDGIRLAHE
TYPH_CHESB       QPVGRGIGPALEAFDVLAVLQNASDAPDDLRRRAATLAGAALEIGRKAG-KGEGTALALE
TYPH_SPHAL       EPIGRGIGPALEARDILAVLEGR-DPPPDLARRACELAGALIELAGRAS-PGTGAALAAQ
TYPH_HAHCH       QPVGRGIGPALEARDILAVLRNQAEAPADLRVRALTLAGRLLEIGGVAS-HGAGVARARE
TYPH_MARMM       QPVGRGIGPALEAWDVLAVLNNEGHNVPDLTVQATLLAGELLEMGQAAP-AGRGAELATE
TYPH_LEGPN       QPVGHGIGPSLEARDVLAVLQGLPDAPNDLRERALTLAGAALECSSKVP-PGLGKSIATQ
TYPH_LEGPH       QPVGHGIGPSLEARDVLAVLQGLPDAPNDLRERALTLAGAALECSSKVP-PGLGKSIATQ
TYPH_LEGPC       QPVGHGIGPSLEARDVMSVLQGLPDAPNDLRERALTLAGAALECSSKVQ-PGLGKSIAKQ
TYPH_LEGPA       QPVGHGIGPSLEARDVMAVLQGLPDAPNDLRERALTLAGAALECSSKVP-PGLGKSIATQ
TYPH1_CUPNH      QPVGRGVGPALEALDVLAVLQCQPTAPADLRERSLLLAGELLEFCGAIP-PGQGRLLAGS
TYPH2_CUPPJ      QPLGRGIGPALEARDILAVLQRTVAAPPDLRERSVMLAGALLEFCGAAP-RGAGEKAAGQ
TYPH_RALSO       QPVGRGIGPALEARDVLAVLQRSPAAPFDLRERSLLLAATLLEFCGAVE-QGAGLEMATG
TYPH_BRASB       QPIGNGIGPVLEARDVMAVLGNEPGAPADLREKSLRLAAHLLEYDPKLR-GGAGYQRARE
TYPH_BRASO       QPIGHGIGPVLEARDVMAVLGNEPQAPADLREKSLRLAAHLLEYDPKLR-GGAGYSRARE
TYPH_BRADU       QPIGNGIGPVLEANDVMAVLGNDKDAPRDLREKSLRLAAHLLEYDPKLR-GGAGYARARE
TYPH_RHOP5       QPIGNGIGPVLEAQDVMAVLGNDPKAPADLREKSLRLAGHLLEYDPNLR-GGSGYARARE
TYPH_RHOPB       QPIGNGIGPVLEAQDVMAVLGNDPKAPADLREKSLRLAAHLLEYDPHLR-GGAGYARARE
TYPH_NITHX       QPIGNGIGPVLEAQDVMAVLANDPEAPADLREKSLRLAAHLLEYDPKLR-GGSGYARARE
TYPH_RHOPA       QPIGRGIGPVLEARDVMAVLGNEPGAPADLREKSLRLAAHLLEYDPKLR-GGTGYARAKE
TYPH_RHOPT       QPIGRGIGPVLEARDVMAVLGNKPGAPADLREKSLRLAAHLLEYDPKLR-GGTGYARAKE
TYPH_RHOPS       QPIGRGIGPVLEARDVMAVLGNEPNAPADLREKSLRLAAHLLEYDPLLR-GGAGYARAKE
TYPH_PSEU5       QPIGNGIGPVLEARDVIQVLQNDPAAPIDLRQKALRLAGRMLEFDPDVR-GGDGYAIARD
TYPH_RHOFT       QPIGNGIGPVLEARDVMRVLENDPRAPNDLRQKSLRLAGRLIEFDPDVR-GGDGFAIARD
TYPH_METCA       QPVGRGIGPVLEVRDVMQVLENDPEAPVDLREKSLRLAGRILEFDPDVR-GGFGYSIARD
RBKTP_CUPNH      GPIGRGIGPALEVRDVRLVLDNAPDAPADLRDKALRFAGEIIAFDPRVDSPEHGMQIAAA
RBKTP_CUPPJ      RPIGRGVGPALEVRDVRQVLENHPDAPMDLREKALRFAGEIIAFDPRVASAAQGMRIATA
RBKTP_AZOC5      APIGRGIGPALEVRDVLWVLEDHSEAPPDLKEKALFFASRILAWDPAVG-PDRARARAEE
RBKTP_ROSDO      KPIGRGVGPVLEALDVLSVLRGEAGAPTDLLDKSIGYAATILEWSGAVS-QGQGAQVTRD
                  *:*.*:** **. *:  **        **  :    *.  :           .   :  

TYPH1_ACISJ      VLADGRAWAKFQAICEAQGGLR----EVPVTPYRQVITAAVAGRVAAIDNRVLARAAKLA
TYPH2_ACISJ      VLADGRAWAKFQAICSEQGGLR----SLPMAAHLHTVESPGTGRVTRIDNRLLARAAKLA
TYPH_POLSJ       VLADGRAWRKFQDICAAQGGLR----EPPVAAHQQAVHALRSGSVLAIDNRRLARIAKLA
TYPH_PARL1       TISSGRAWEKFQRICAAQGGFR----EPPQALYVEPLLATTSGRAVHIDNRKLSRLAKLA
TYPH_TOLAT       TISSGRAWEKFQRICAAQGGFR----EPPQALYVEPLLATTTGRAVHIDNRKLSRLAKLA
TYPH_CHESB       TLADGRAWKKFEAICEAQGGLR----APPRAAHVHPLVAPRAGRVVHINNRKLSRLAKLA
TYPH_SPHAL       VLADGSAWSKFQRICEAQGGMR----TPPLSNHRHVMTAQRPGRVSAIDNRRLAKLAKLA
TYPH_HAHCH       TLESGAALHKFMAICEAQGGFR----EPALAPHCYEATADRVGVVSFVNNRFVAKLAKLA
TYPH_MARMM       LLVNGRAWRAFEAICEAQGGFR----EPPTAPHYQVIQSPRDGVVGRIDNRRLAKAAKLA
TYPH_LEGPN       LLESGQAFKKFQAICEAQGGMR----ELTKARFTYPVVAAKEGKVSLIDNRKLAKIAKLA
TYPH_LEGPH       LLESGQAFKKFQAICEAQGGMR----ELTKARFTYPVVAAKEGKVSLIDNRKLAKIAKLA
TYPH_LEGPC       ILESGKAFKKFQAICEAQGGMR----ELTKARFTHPVVAAKEGKVSLIDNRKLAKIAKLA
TYPH_LEGPA       LLDSGQAFKKFQAICEAQGGMR----ELTKARFTYPVVAAKAGKVSLIDNRKLAKIAKLA
TYPH1_CUPNH      LLDSGAAWARFQAICEAQGGLR----TPGQAVFRRDVVAARSGIVTSVDNRHVARTAKLA
TYPH2_CUPPJ      LLDSGAAWRKFQAICEAQGGLR----VPGEAIFRRDIVAPHAGKVIAIDNRHIARTAKLA
TYPH_RALSO       VLDSGAAWRKFEEICEAQGGLR----VPGEAIFRRDVVAEQDGIVTEIDNRHLARIAKLA
TYPH_BRASB       LLDSGAALKQMQKIIDAQGPT---TSRNELGDLAFDVKAGRDGIVSAIDCLRLNRLARTA
TYPH_BRASO       LLDSGAALKQMQKIIDAQGPS---AGRSELGDLAFDVGAASDGVVSAIDCLRLNRLARTA
TYPH_BRADU       LLDSGAALKQMQKIIDAQGPS---TCSTELGSLSFDIKAAHDGTVSAIDCLRLNRLARTA
TYPH_RHOP5       LLESGAALKQMQKIIDNQGPT---NCRKDLGTLTTDIVAPRDGVVTGIDNLQLNRLARTA
TYPH_RHOPB       LLESGAALKQMQKIIDNQGPS---TCHKDLGTLTAEVTAERDGVVSAIDCLQLNRLARTA
TYPH_NITHX       LLDSGAALKQMQKIIDAQGPP---TCCTDLGNLTFDVTASRDGFVSGINCLQLNRLARIA
TYPH_RHOPA       LLDSGAALKKMQQIIDAQGPS---PCPAELGSYAADVLAAADGVVNGIDCLRINRLARSA
TYPH_RHOPT       LLDSGAALKKMQQIIDAQGPS---PCPAELGSYAADVLAAADGVVNGIDCLRINRLARSA
TYPH_RHOPS       LLDSGAALKKMQQIIDAQGPS---VCNSELGSHAADVLAPADGVVNGIDCLRINRLARTA
TYPH_PSEU5       ILDSGRALKKMRSIIAAQGGKPFDHNHPPLARLSFDVLADCDAVVTGIDNLQLARIARLA
TYPH_RHOFT       ILDSGRALAKMNAIIAAQGAKPFDHNHPQLGALTFDICASESGVVTGIDNLQVARIARLA
TYPH_METCA       ILESGRALAKMHRIIDAQGRQ---ERRLEPGRLVFEVRAERAGVVVGIDNFFLAQTARLA
RBKTP_CUPNH      LLHEGKARAAFDRIAAAQGVRC---DPVAPGTHTLVVPATTRGRVAGVDGLQISGVARAA
RBKTP_CUPPJ      LLDEGSARAAFDRIVATQGIRP---DPVAPGAHTHVIVAPAEGRVAAINGWQISGIARAA
RBKTP_AZOC5      LLASGAARAALERIVEAQGRWS---EPVRPARLTHTVTAQNDGQVSDIDGFAVAGIARLA
RBKTP_ROSDO      LVSSGKAFEKLFEIRDAQGRQH---DPLQPGQFTEDICADRSGRVEAIDIQGISEVARLS
                  : .* *   :  *   **                   :   . .  ::   :   *: :

TYPH1_ACISJ      GAPKAPAAGVDVHARIGDPVQAGQPLFTLHAQTAGELDYAGHFVDTRPPIFQISEEA---
TYPH2_ACISJ      GAPTAPAAGIDVHARLGDRVEAGQPLFTLHAQAPGELAYALEFVRARPPIFQISENV---
TYPH_POLSJ       GAPGAACAGIDLHVRPGEFVERGQPLFTLHAATPGELAYALEYAASQAETVHVLEDA---
TYPH_PARL1       GAPESPAAGIQLQVRLGDEVTRGQSLMFLHAQTSGEMAYALAYVHDIGDIVKIEP-----
TYPH_TOLAT       GAPESSAAGIQLQVRLGDEVTSGQPLMFLHAQTSGEMAYALAYVHDIGDIVNIEP-----
TYPH_CHESB       GAPESKAGGVHMDVRLGDEIDRGQPLLHVHAETTGELAYALDYAARAGDIVEIEA-----
TYPH_SPHAL       GAPAAKSAGLEMHVRLGSAVETGTPLLTVHAESQGELAYALAYAEAVGPILELSDR----
TYPH_HAHCH       GAPSNSSAGVDFHVKLGQKVRVGEPLFSIYAEAPGELAYALDFLRDHPNEIRIEEESL--
TYPH_MARMM       GAPASKAAGIVLHAKLGSQMVKGQPLYSLHSQSLGELSYAHDYLASQPEIIEIEEEQCPR
TYPH_LEGPN       GAPKSKSAGIDLHAHVGESVEQGEPLFTIHSESLGELHYACDLLRDKQDIIILGENP---
TYPH_LEGPH       GAPKSKSAGIDLHAHVGESVEQGEPLFTIHSESLGELHYACDLLRDKQDIIILGENP---
TYPH_LEGPC       GAPKSKSAGIDLHAHVGESVEQGEPLFTIHSESSGELNYACDLLRDKQDIIILGENS---
TYPH_LEGPA       GAPKSKSAGIDLHSHVGESVEKGEPLFTIHSESSGELHYACDLLRDKQDIIILGENS---
TYPH1_CUPNH      GAPRRQVAGLELHVRAGDEVVAGAPLCTLHAQASGELEYAFSYALAHDPFRIE-------
TYPH2_CUPPJ      GAPMRQVAGLEMRVRVNDEVRAGQPLFTVHAQASGELDYSCSYALAHPAVSIEPH-----
TYPH_RALSO       GAPMRQVAGVEMHVRLHDQVKAGRPLFTIHAQASGELEYSVAYALMHPAVSIAPT-----
TYPH_BRASB       GAPINKGAGIRLFKKIGDRVDQGEPLYRVFTCDPSEHDLAVAAAAADHGYGFADEPNGHQ
TYPH_BRASO       GAPVNKGAGIRLYKKIGDRVDQGEPLYRVFTCDPSEHDLAAAAASANNGYVLDG-PNGPH
TYPH_BRADU       GAPLDKGAGIRLFKKIGDHVEQGEPLYRVYAFDQPEHDLAASAAAAGNGYAVDGHDALPS
TYPH_RHOP5       GAPIDKGAGIKLFKKVGDRVEQGEPLYRIYAFDPSEQELAVSAAEESSGYTVDGVHAFRE
TYPH_RHOPB       GAPIDKGAGIRLFKKVGDRVEAGEPLYRIYAFDPAERELAVAAAKLACGYTVDDAQTFRE
TYPH_NITHX       GAPIDKGAGIRLFKKIGDRVQQGEPLYRIHAFERSGRDLAAAGT---TAYTIDSEESNLE
TYPH_RHOPA       GAPVAKGAGIDLFKKIGDRVEKGEPLYRVYASDRSEFDLALAAAQAESGFAINHHTPADV
TYPH_RHOPT       GAPVAKGAGIDLFKKIGDRVEKGEPLYRVYASDRSEFDLALAAAQAESGFAINHHTPADV
TYPH_RHOPS       GAPIVKGAGIDLFKKIGDRVDQGEPIYRIYASDRSELDLAIAAAEAESGFSVNHHSPAAV
TYPH_PSEU5       GAPKVQGAGVDILRKLGEPVRAGDCLYRVYADFPADLAFARQATERASGVSLGSPEQVPT
TYPH_RHOFT       GAPKVIGAGIDLFHKLGEAVTSGEVLYRVHAGFQSDLDFARQACAKSTGYTLGRAEDVPH
TYPH_METCA       GAPMSRGAGVDLLNKLGDTVEEGQPLYRVYAEFPANFEFAREFTRTRSGYNIGDAAFLTK
RBKTP_CUPNH      GAPRDGGAGVDMLCAIGAKVAPGQPLYRIHSDSAEALEAAAALVRAGG------ECCQAV
RBKTP_CUPPJ      GAPRSAGAGIDLLCTIGERVAAGEPLYRIHAESAADLATAVAMTGPAG------EASTAV
RBKTP_AZOC5      GAPLDKGAGIDLKARVGDVVRAGDPLFVIHASTAADLEAAAGAALAFDGYGIMMDGKAFR
RBKTP_ROSDO      GAPKDKAAGVVLNVQVGDQIAEKQPLLRVHSSSLRGIEEAVCAAQAQS----------AF
                 ***    .*: .       :     :  :.:        :                    

TYPH1_ACISJ      ------
TYPH2_ACISJ      ------
TYPH_POLSJ       ------
TYPH_PARL1       ------
TYPH_TOLAT       ------
TYPH_CHESB       ------
TYPH_SPHAL       ------
TYPH_HAHCH       ------
TYPH_MARMM       ------
TYPH_LEGPN       ------
TYPH_LEGPH       ------
TYPH_LEGPC       ------
TYPH_LEGPA       ------
TYPH1_CUPNH      ------
TYPH2_CUPPJ      ------
TYPH_RALSO       ------
TYPH_BRASB       R-----
TYPH_BRASO       ------
TYPH_BRADU       KTAS--
TYPH_RHOP5       QVL---
TYPH_RHOPB       QVM---
TYPH_NITHX       ATP---
TYPH_RHOPA       DLVS--
TYPH_RHOPT       DLVS--
TYPH_RHOPS       EPVS--
TYPH_PSEU5       VFVEF-
TYPH_RHOFT       VFTEF-
TYPH_METCA       THMEF-
RBKTP_CUPNH      RIDPD-
RBKTP_CUPPJ      RVDPD-
RBKTP_AZOC5      RINPER
RBKTP_ROSDO      KIL---