CLUSTAL format seed alignment for MF_00707

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YSZB_BACSU       ----------MKEETFYLVREDVLPDAMRKTLEVKKLLDRKKADSVADAVQKVDLSRSAF
Y2496_BACVZ      ----------MKEETFYLVREDVLPDAMRKTLEVKKLLDRKKAESVADAVQKVDLSRSAF
Y2431_BACP2      ----------MKEETFYLVREDVLPDAMRKTLEVKKLLDRKKADSVADAVQQADLSRSAF
Y2918_BACLD      ----------MKEETFYLVREDVLPEAMRKTLEVKKLIERKKAESVAEAVQKVDLSRSAF
Y2605_GEOKA      -----------MEKKFYLVREDVLPEAMKKVVLAKQLLERKKAASVAEAAQLANISRGVF
Y2535_GEOTN      -----------MEKKFYLVREDILPEAMKKVVLAKQLLERKKAASVAEAAQLANISRGVF
Y1543_BACSK      ----------MSKKQFYLVREDMLTDAMQRTLEAKALLSAGKVRKINEAVHRVGLSRSAF
Y1214_ALKHC      ----------MTRKKFYLVREDMLTEAMQKTLEAKALLESGKKRKINEAVHEVGLSRSAF
Y3944_LYSSC      MSFRGKRMKNVANQRYYLVREDVLTDAMQKTLEAKHLLSSGSVSSIWDAVKQVDLSRSAF
Y1469_STAAN      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1545_STAAE      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1593_STAAW      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1643_STAAM      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1630_STAA1      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1579_STAAS      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1723_STAAR      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1700_STAA9      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1733_STAA2      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1698_STAAC      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1512_STAAB      ------MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1642_STAAT      -------MDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1752_STAA8      -------MDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1599_STAA3      -------MDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAF
Y1278_STAHJ      -------MDNNDYKKFYLIREDVLPESVVKTLKIKDALKNNPELSIYEAVKLFDLSRSAF
Y1326_STAES      -------MDNKDNRKFYLIREDVLPESVIKTLKVKDALKNNSNLSIYDAVKQFNLSRSAF
Y1207_STAEQ      -------MDNKDNRKFYLIREDVLPESVIKTLKVKDALKNNSNLSIYDAVKQFNLSRSAF
Y1116_STAS1      -------MDKKDYKKFYLIREDVLPESVVKTLKIKEVLKNDPSLSIFEAVKQFDLSRSAF
Y1913_CARHZ      ----------MKKTKFLLVAVDILPEAIRKTAEVKELLSKRPELTVNEAVEKVGISRSAF
Y2247_DESHY      ------MAGQNRNKDFLIVSKDILPEAILKTAQAKELLVKGDANTINEAVDRVQLSRSAF
Y1164_DESRM      --------MAKREPKYFLVQEDILPEAILKTVMAKDLLLKGAANTVNEAVEKVDLSRSAF
Y1602_PELTS      --------MAKKERKFYLVQEDLLPEAILKTVLAKELLLRGDAATVNEAVEKVDLSRSAF
Y1868_HELMI      --------MNDGGKRFYLVDGDILPEAILKTALVNEMLAKGEVTKVSEAVEKVGLSRSAY
Y3034_CLOB1      -----------MPNKFLIIDNSILPDIFEKVVKVKELLANGKVKDITEGVKTVGISRSTY
Y3010_CLOBH      -----------MPNKFLIIDNSILPDIFEKVVKVKELLANGKVKDITEGVKTVGISRSTY
Y1535_CLOBK      -----------MPNKFLIIDNSILPDIFEKVVKVKELLANGKVKDITEGVKTVGISRSTY
Y3063_CLOBL      -----------MPNKFLIIDNSILPDIFEKVVKVKELLANGKVKDITEGVKTVGISRSTY
Y2394_CLOBM      -----------MPNKFLIIDNSILPDIFEKVVKVKELLANGKVKDITEGVKTVGISRSTY
Y858_CLOK5       -----------MKNKFLIIDTSILPDVFDKVVKVKELLRTGHVKDISEGVKQVGISRSTY
Y116_CLOTE       ----MYIGSDFMKDKYLMINTSVLPDVFEKVIEAKELMKAGKIKEITEAVKVVGISRSTY
Y1681_CLONN      ------------MDKYLIINTKILPEVFGKVLQAKELLRTGKAKDITEASKIVGISRSSY
Y1234_CLOAB      -MEVVIKISTTEAKKYLLIDTSVLPDVFEEVIQVKELLRSAKVKDITEAVKKVGISRSTY
Y1956_ALKOO      ----------MNNSRFLVIDKEILPDIFEKVIEAKELLRTNQVKGVTEATKAVGISRSAF
Y1414_CLOPE      -----------MEGNLLVIDKRVLPEVFEKVINAKRLLKEGKVKEITEAAKQAGISRSVY
Y1668_CLOP1      -----------MEGNLLVIDKRVLPEVFEKVINAKRLLKEGKVKEITEAAKQAGISRSVY
Y1404_CLOPS      -----------MEGNLLVIDKRVLPEVFEKVINAKRLLKEGKVKEITEATKQAGISRSVY
Y2637_CLOBA      -----------MKGNYLVIDKRVLPDVYEKVVFAQKLLKDGKVKEITEATKIAGISRSVY
Y2896_CLOBB      -----------MKGNYLVIDKRVLPDVYEKVVFAQKLLKDGKVKEITEATKIAGISRSVY
Y1295_CLOB8      ----------MMSGDYLVIDKRVLPDVYEKVLFAKKLLKDGKVKEITEAVKIAGISRSVY
Y1046_LACP3      ------------MKQFYIVDSSMLPEVVGKVIAARALLQNGEVKQVSEAVKQVGISRGTY
Y1210_LACCB      ------------MKQFYIVDSSMLPEVVGKVIAARALLQNGEVKQVSEAVKQVGISRGTY
Y1351_LACDA      ------------MADYFYVHKKILPDYLEKVLEAREMLDSREAATVTEATERVGISRNTY
Y1260_LACDB      ------------MADYFYVHKKILPDYLEKVLEAREMLDSREAATVTEATERVGISRNTY
Y565_ALKMQ       -------MMERDGGTHYIVNEKALPIVLLKTVEAKELLKKGEVVTIHEAVDRVGMSRSAY
Y3604_LACP7      --------MDDE--KYYIVKKKALPEVLLKVVEAKRLLDSERVMTIQEATDAVDISRSSF
Y995_CALS8       --------MLKKDATYYIVEESVLPEVFLKVIKAKELLEKGEVKAVNEAVRLVGISRSAF
Y1377_ACET2      ---------MRNTSKYYLVDASVLPKVFIKVVEAKRILASGAIKNVNEAVRKVGISRSAY
Y139_THEP3       ---------MGEDGKLYIIREEILSDSLKKTLKVKELLESGKVKTINEAVKQVGISRSAF
Y2312_THEPX      ---------MGEDGKLYIIREEILSDSLKKTLKVKELLESGKVKTINEAVKQVGISRSAF
Y2621_CALS4      ---------MGEDGKLYIVREEILSDSIKKTIKVKELLESGKAKTINEAVKQVGISRSAF
Y1487_FUSNN      ---MAFKKKDTENKEFYIVDKRILPKSIQNVIKVNDLILKTK-MSKYSAIKKVGISRSTY
                                   :    *.    ..   .  :         ..     :**. :

YSZB_BACSU       YKYRDAVFPFYTMVKE-QIITLFFHLEDRSGALSQLLQAVADSGSNVLSIHQTIPLQGRA
Y2496_BACVZ      YKYRDAVFPFYTMVKE-QIITLFFHLEDRSGALSQLLQAVADSGSNVLSIHQTIPLQGRA
Y2431_BACP2      YKYRDAVFPFYTMVKE-QIITLFFHLEDRSGALSRLLQIVADSGCNVLSIHQTIPLQGRA
Y2918_BACLD      YKYRDAVFPFYTMVKE-QIITLFFHLEDRSGTLSHLLQVVAESGCNVLSIHQTIPLQGRA
Y2605_GEOKA      YKYRDAIFPFQAVTKE-NIVTLFFHLEDRSGTLSQLLGVVAAAGCNVLTIHQTIPLQGRA
Y2535_GEOTN      YKYRDAIFPFQAVTKE-NIVTLFFHLEDRSGTLSQLLSVVAAAGCNVLTIHQTIPLQGRA
Y1543_BACSK      YKYKDGIFPFHAIAKE-RIMTFSINLADRSGTLSQLLNIVADTGANILTINQTIPLQGRA
Y1214_ALKHC      YKYKDGVFPFHTMTKE-KIITLSINLEDRSGSLSAMLATVAEAEANVLTINQTIPLQGRA
Y3944_LYSSC      YKYRDAVFPFHSIVQE-RILTVFLQLQDRKGTLAKLLETVTITHCNVLTIHQTIPIQGRA
Y1469_STAAN      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1545_STAAE      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1593_STAAW      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1643_STAAM      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1630_STAA1      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1579_STAAS      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1723_STAAR      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1700_STAA9      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1733_STAA2      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1698_STAAC      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1512_STAAB      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1642_STAAT      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1752_STAA8      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1599_STAA3      YKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKA
Y1278_STAHJ      YKYRETIFPVDEKMLDHREFTLILYVNDIVGMLAQVLNTVSKLQLSVLTIHQSVPMEEKA
Y1326_STAES      YKYRETIFPVDEKILDQREFTLILYVNDIVGMLAQVLNAISQLQLSVLTIHQSVPIEDKA
Y1207_STAEQ      YKYRETIFPVDEKILDQREFTLILYVNDIVGMLAQVLNAISQLQLSVLTIHQSVPIEDKA
Y1116_STAS1      YKYRDTIFPIDEKIESTREFTLILYVNDIVGMLAEVLNTLSNLDLSILTIHQSIPMEGRA
Y1913_CARHZ      YKYKDGVFPFYHKASG-KIITLALNLEHRAGVLSKVLNFIAQYQGNVLTINQNLPLGGIA
Y2247_DESHY      YKYKDGVFPFYEASRE-KIITFSLTLENTAGVLSNVLNTIARFKANVLTINQGIPLQGIA
Y1164_DESRM      YKYKDKVFPFHQWSRG-KIVTLALLMEHQPGVLSTVLNIIASVKGSILTINQNLPLQDMA
Y1602_PELTS      YKYKDGVFPFHQWSPG-VTVTLAMVLEHRSGILSKVLGILAAARANILTINQNVPVHGLA
Y1868_HELMI      YKYKDGVLPFREPGRS-NIVSVSLLLEHHPGILSRVLNTVAAMEGNILTINQSVPEKGLA
Y3034_CLOB1      YKYKDFVFSVSEGVKS-QKATIGLLLGHERGTLSKILDRIAEYQGNILTINQDIPINNTA
Y3010_CLOBH      YKYKDFVFSVSEGVKS-QKATIGLLLGHERGTLSKILDRIAEYQGNILTINQDIPINNTA
Y1535_CLOBK      YKYKDFVFSVSEGVKS-QKATIGLLLGHERGTLSKILDRIAEYQGNILTINQDIPINNTA
Y3063_CLOBL      YKYKDFVFSVSEGVKS-QKATIGLLLGHERGTLSKILDRIAEYQGNILTINQDIPINNTA
Y2394_CLOBM      YKYKDFVFSVSEGVKS-QKATIGLLLGHERGTLSKILDRIAEYQGNILTINQDIPINNTA
Y858_CLOK5       YKYRDSVFTLSESVAG-HKITLGLTLAHKAGTLSKILDNIAQKKGNILTINQDIPINNAA
Y116_CLOTE       YKYKDYVFNVSELSSN-QKVIISVTLNHRPGTLSKILDKIALYKGNILTINQEIPIHNTA
Y1681_CLONN      YKYKDFVFSVLEGTHV-QKATIGFLLSHKAGTLSRILDRIAQINGNILTINQDIPVNNAA
Y1234_CLOAB      YKYKDYVFNVSDGLKS-QKVTISILIEHRRGTLSEVLDKLAQRCCNILTINQDIPINNTA
Y1956_ALKOO      YKYKDYVYTLSDSNVG-KKVTLSFLLSHQAGVLSNVLHIISVNNGNILTINQDSPINNFA
Y1414_CLOPE      YKYKDYIFEFAETLQG-RKVIFNMVVTHEKGVLSSVLNILSDVGGNILTIDQGLPIHGLA
Y1668_CLOP1      YKYKDYIFEFAETLQG-RKVIFNMVVTHEKGVLSSVLNILSDVGGNILTIDQGLPIHGLA
Y1404_CLOPS      YKYKDYIFEFAETLQG-RKVIFNMVVTHEKGVLSSVLNILSDVGGNILTIDQGLPIHGLA
Y2637_CLOBA      YKYKDYIFDFAETSQG-KKVTFNLIVKDQTGVLSGVINYISEQGGNILTINQGIPINGVA
Y2896_CLOBB      YKYKDYIFDFAETSQG-KKVTFNLIVKDQTGVLSGIINYISEQGGNILTINQGIPLNGVA
Y1295_CLOB8      YKYRDFVFDFAETSEG-RKVTYNIIFKNEKGLLSNISNYITEKGGDILTINQGIPLNGYA
Y1046_LACP3      YKYKDYVFLRDPEMAS-RKAVISLMLHHDRGILSEVLTTMSQVQASIVTINQNIPIHNWA
Y1210_LACCB      YKYKDYVFLPDPEMAS-RKAVISLMLHHDRGILSEVLTTMSQAQASIVTINQNIPIHNWA
Y1351_LACDA      YRYKDYVFRAKDPARG-QQAVLSLLLADLPGALSAVLTCVTDHRASVLTISQAIPLASHA
Y1260_LACDB      YRYKDYVFRAKDPARG-QQAVLSLLLADLPGALSAVLTCVTDHRASVLTISQAIPLASHA
Y565_ALKMQ       YKYKDYIFPLYEMNKG-KIITMHLILKHLPGILSEVLNQIAESEASVLTINQSIPAHGIA
Y3604_LACP7      YKYKDDIFPFHENNRG-KTITFMLQMDDIPGLLSMVLNQIAKSNANVLTIHQTIPIGGIA
Y995_CALS8       YKYKDCIFPFFESSRG-KIITLALVLQDVPGILSKILNIISDTNANILTINQNIPLGGIA
Y1377_ACET2      YKYKDHIFPFYETSQG-KVITLFFTVEDYAGILSSIINRIADSKANIITINQNIPINGLA
Y139_THEP3       YKYRDYVFPFSKFSKG-KIITLSMVLDHMPGVLSSILDVVANARGNVVTINQSMPSMGVA
Y2312_THEPX      YKYRDYVFPFSKFSKG-KIITLSMVLDHMPGVLSSILDVVANARGNVVTINQSMPSMGVA
Y2621_CALS4      YKYRDYVFPFSKFSKG-KIITFSMVLEHMPGVLSSILDVVAKERGNVVTINQSIPSMGVA
Y1487_FUSNN      YKYKDFIKPFYEGGED-RIYSLHLSLKDRVGILSDVLDVIAREKISILTVVQNMAVDGVA
                 *:*:: :                . . .  * *: :   ::    .:::: *  .    *

YSZB_BACSU       NVTLSISTSA-MEEDIHTLMNKLRKFDFVEKVEILGSGA-
Y2496_BACVZ      NVTLSISTSA-MEENIHTLMNKLRKFDFIEKVEILGSGA-
Y2431_BACP2      NVTLSISTAG-MADDINTVMNQLRKLEFVEKVEILGSGA-
Y2918_BACLD      NVTLSVSTRG-MDENIDLLMNKLRKLEFVEKVEILGSGA-
Y2605_GEOKA      NVTLSVSTND-MNEEIDELLAKLKQLEFVEKVEIVGSGVY
Y2535_GEOTN      NVTLSVSTND-MHEDIDELLAKLRGLEFVEKVEIVGSGVY
Y1543_BACSK      NITLSVDTAP-IEIDINELFERMEALESVERVELVGSGS-
Y1214_ALKHC      NITLSIDTAT-MSLEIDELVEKIESMEAVEKVELVGSGS-
Y3944_LYSSC      NVTLSLDVTS-MTCDLDDLIQQLKRLDFVESAEVISSGAL
Y1469_STAAN      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1545_STAAE      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1593_STAAW      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1643_STAAM      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1630_STAA1      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1579_STAAS      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1723_STAAR      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1700_STAA9      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1733_STAA2      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1698_STAAC      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1512_STAAB      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1642_STAAT      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1752_STAA8      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1599_STAA3      TITLSLNAKS-KETSVEDVIGALRNLDYVSKVELISMSM-
Y1278_STAHJ      TITLSLSAKD-TTISIDEIIKALRNIEHVSKVELISMSM-
Y1326_STAES      TITLSLNARN-SNLSIDEVIESLREINHVTKVDLISMTM-
Y1207_STAEQ      TITLSLNARN-SNLSIDEVIESLREINHVTKVDLISMTM-
Y1116_STAS1      TITLSLDATS-TDLEIDDVMEALRIVDHVSKVELISMTI-
Y1913_CARHZ      NVTISIETEE-MKVSIEELLEALSQMDGVSKVELVGQS--
Y2247_DESHY      NVTISVENMG-MVDIPENLLSALGEIDGVRKIEVIGQN--
Y1164_DESRM      NATLSVETAE-MNQDLEELLRIIGEVEGVREVRLVGQN--
Y1602_PELTS      SVTVTFETAG-LEGDLDNITKRIRELDGVREVNPVGHSLV
Y1868_HELMI      PVAFVLDRSR-MSVDLPRLLAELRQLTGVRSAQLVGSEEE
Y3034_CLOB1      NVSITFDISQ-MSIGLKELVEEIKNTKNVIKVDLIAME--
Y3010_CLOBH      NVSITFDISQ-MSIGLKELVEEIKNTKNVIKVDLIAME--
Y1535_CLOBK      NVSITFDISQ-MSIGLKELVEEIKNTKNVIKVDLIAME--
Y3063_CLOBL      NVSITFDISQ-MSIGLKELVEEIKNTKNVIKVDLIAME--
Y2394_CLOBM      NVSITFDISQ-MSIGLKELVEEIKNTKNVIKVDLIAME--
Y858_CLOK5       NVSITFDASQ-LEVEVNELMEDIRTLKSVIKVNLAAVE--
Y116_CLOTE       NVNITFDISQ-LNIEFNRLLEEISAMDNVIKLDLIAMD--
Y1681_CLONN      SVTITFDISN-MVVELNEFLREMQEMDNVVKVSLIAME--
Y1234_CLOAB      NVNITFDISG-ISGDVKNIVEELKKIKNVLKVEIVAME--
Y1956_ALKOO      NVNIIFDITE-ISKKLDDIIQEIESIDGVEKLEILALE--
Y1414_CLOPE      HVSFTIDIST-MKCDIKEMLNEIELVHGVEKVEFVAME--
Y1668_CLOP1      HVSFTIDIST-MKCDIKEMLNEIELVHGVEKVEFVAME--
Y1404_CLOPS      HVSFTIDIST-MKCDIKEMLNEIELVHGVEKVEFVAME--
Y2637_CLOBA      NISVTIDMST-LIGDIKTLLNGLSDIQYVEKIEFVAME--
Y2896_CLOBB      NISVTIDMST-LIGDIKTLLNGLSDIQYVEKIEFVAME--
Y1295_CLOB8      NLSITIDLST-VDGDIKTLTEGLLNIRNVEKVEFIGME--
Y1046_LACP3      SVVMSFDISA-LQGTLDDLVTKLGDIRGVSDVHLVSVE--
Y1210_LACCB      SVVMSFDISA-LQGTLDDLVTKLGNIRGVSDVHLVSVE--
Y1351_LACDA      SVLMSLDLAG-LKGDINTLLADLKSLPFVKNLQLAGLE--
Y1260_LACDB      SVLMSLDLAG-LKGDINTLLADLKSLPFVKNLQLAGLE--
Y565_ALKMQ       NISVALETRQ-MTINIEELILKMEQIKGVQKINILAQE--
Y3604_LACP7      SLTLGIEILP-QTLELSQMLESIEALDGIHYLKILGRE--
Y995_CALS8       TVTISIRTSD-MTKSVKELIQEIERVDGVKKIEILGREEY
Y1377_ACET2      DVTITIETGQ-MTRDIKDLLDDISSIEGVKRQEILARE--
Y139_THEP3       SVTISIDTQY-MEMSLENFLEKLSSQNGVRKIEILGE---
Y2312_THEPX      SVTISIDTQY-MEMSLENFLEKLSSQNGVRKIEILGE---
Y2621_CALS4      SVTISIDTQY-MEISIEDFIEELSKQPGVRKIEVLGE---
Y1487_FUSNN      KSTILIKLSESMQKKVDKIISKIGKVEGIADIRITGSN--
                    . .            .   :     :      .