CLUSTAL format seed alignment for MF_00711

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GCSP_MYCLE       ---------------------MSVPNSSNKQTCFTARHIGPNSEDVATMLAVIGVESLDD
GCSP_MYCTU       ---------------------------MSDHSTFADRHIGLDSQAVATMLAVIGVDSLDD
GCSP_STRAW       -----------------MTAHRIPLSDLEQGIPFEQRHIGPDSEARAKMLAQVGYGSLDE
GCSP_STRCO       -----------------MTAHRTPLSELEQAMPFEQRHIGPDHEARAKMLAQVGYGSLDE
GCSP_BRUME       ---------------------------MTEFLPFVARHIGPRHEDERAMLAALGLPSMET
GCSP_BRUSU       ---------------------------MTEFLPFVARHIGPRHEDERAMLAALGLPSMET
GCSP_RHILO       -------------------------MMTTALTPFSARHIGPGVNDVRAMLAVIGVPSVET
GCSP_AGRFC       ----------------MTTPTEFHFTDYQPYDFANRRHIGPSPSEMAEMLKVVGYKSLDA
GCSP_RHIME       ----------------MSMPKDFTFTDYKPYDFANRRHIGPSPAEMDEMLKVVGYPSLDA
GCSP_BRADU       ------------------MMTAHRKSNGDTTNFA-RRHIGPSARDVAAMLETVGAKSVDA
GCSP1_PSEPK      -----------------------MTINLGTANEFIARHIGPRAADEQAMLTALGFDSLDA
GCSP_PSESM       ---------------------MTDRIELTTANEFIARHIGPRAADELAMLHTLGFDSIEA
GCSP1_PSEAE      ----------------MTDNLNLGAIDLGTDDEFIARHIGPRAADTQAMLQRLGYDSLDT
GCSP_XANAC       -----------------MSQTPSSLRDLEHHSAFVERHIGPNDAEIAQMLDVVGHASLDA
GCSP_XANCP       -----------------MSQTPSSLRDLEHHSAFVERHIGPNDAEIAQMLGVVGHDSLDA
GCSP_XYLFA       ----MFSVSHFCSGSLMMSHTLSSLRDLEYQGAFVERHIGPNDVEIAQMLRVVGYDSLES
GCSP_XYLFT       ----MFSASHFCSGSLMMSHPLSSLRDLEYHGAFVERHIGPNDVEIAQMLRVVGYDSLES
GCSP_RALSO       ----MNAPHPASAALTQTLAARPTLAELEARDAFAERHIGPSPDEQAAMLATLGYASRAA
GCSP_NOSS1       MVSYASIPQSSDEAHSTVGASLQLDERKQDLNNFIQRHIGPSSADIQQMLDVLGFSSLDD
GCSP_SYNY3       -MPNLEPAVVVPTSEAIAVDLTKLEEKLAPADSFLDRHLGPGETEQRQMLQTLGFDTLGD
GCSP_THEEB       ---------------MMVSSPPQLEINLETDAEFVARHIGITPSDLPKMLSLLGYGSLKE
GCSP_LEPIN       ----------MNSTLQNQTKTNLEKVGTDPLDTFPRRHIGPNLQQTAEMLKELGLSSVEE
GCSP_BACTN       ----------------------------MKTDLLASRHIGINEEDTAVMLRKIGVDSLDE
GCSP_VIBPA       --------------------MTELLQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDA
GCSP_VIBVU       --------------------MTELLQSLNTQHEFVGRHNGPNHADQQKMLSTINAESLDA
GCSP_DEIRA       --------------------MTKSLSDLLQTNDFTRRHIGPSEAEQAEMLGVLGVSSLDE
GCSP_ECOLI       --------------------MTQTLSQLENSGAFIERHIGPDAAQQQEMLNAVGAQSLNA
GCSP_ECOL6       --------------------MTQTLSQLENSGAFIERHIGPDAAQQQEMLNAVGAQSLNA
GCSP_ECO57       --------------------MTQTLSQLENSGAFIERHIGPDAAQQQEMLNAVGAQSLNA
GCSP_SALTI       --------------------MTQTLSQLENRGAFIERHIGPDAAQQQEMLNAVGAESLNA
GCSP_SALTY       --------------------MTQTLSQLENRGAFIERHIGPDAAQQQEMLNAVGAESLNA
GCSP_YERPE       --------------------MTQNLSQLEHNDAFIQRHIGSSVEQQQQMLAAVGASSLST
GCSP_SHEON       -------------------MTKQTLTQLEQHDLFLRRHIGPDSSQQQEMLNYVGAESLDD
GCSP2_PSEAE      ------------------MSQTPSLAQLQPADAFLRRHLGPDPAEQQAMLAFLGVSTRAE
GCSP2_PSEPK      ------------------MSQSPSLHQLQELNPFLRRHLGPDATEQQAMLNALGIASRNE
GCSP_NEIMA       ----------------------MKLSELFNPNEFAARHL--SFGDEAALLAAVDEKSMDE
GCSP_TROW8       ---------------------------------MHERHIGPSQEEIDHMLGFLGYKSLDD
GCSP_TROWT       ---------------------------------MHERHIGPSQEEIDHMLGFLGYKSLDD
                                                     **          :*  :.  :   

GCSP_MYCLE       LAAKAVPSDILDNVTDTGVAPGLDR--LPPPATESETLAELGALARANTVAVSMIGQGYY
GCSP_MYCTU       LAVKAVPAGILDTLTDTGAAPGLDS--LPPAASEAEALAELRALADANTVAVSMIGQGYY
GCSP_STRAW       LTATAVPDVIKN-------AEALE---LPGARTEAEVLAELRSLADRNQVLGSMIGLGYY
GCSP_STRCO       LTAAAVPDVIKN-------ADRLD---LPGARSEAEVLAELRSLADRNQVLDSMIGLGYY
GCSP_BRUME       LITQAVPASIRL-------NRALNL---PAALSEADALAELGTIMGRNVVKKSFIGAGYH
GCSP_BRUSU       LITQAVPASIRL-------NRALNL---PAALSEADALAELGTIMGRNVVKKSFIGAGYH
GCSP_RHILO       LISQAVPQSIRL-------DLPLTL---PAPASEAEALAELSAIMAKNTVLKSFIGAGYH
GCSP_AGRFC       LIDATVPSSIRQ-------KVPLTW---GAALTEREALDRLRETANKNQVLTSLIGQGYY
GCSP_RHIME       LIDDTVPPSIRQ-------RTPLAW---GAPMTEREALDKLRETANRNRKLVSLIGQGYY
GCSP_BRADU       LMAETLPASIRQ-------AAPLDL---GKPLSETEAIAHMGELAAQNQVFTSLIGQGYS
GCSP1_PSEPK      MTAAVIPDSIKG-------TSVLGS---HDGQSEADALAALKAIAGKNQLFKSYIGQGYY
GCSP_PSESM       LSDSVIPESIKG-------TSVLNL---PAGQSEADALASIKAIASKNQLFKTYIGQGYY
GCSP1_PSEAE      LIGNVIPDSIKG-------SSVLDL---PAGMGEAEALASLKAIAARNRALRSFIGQGYY
GCSP_XANAC       LTDAIVPGNIKS-------PAPLAL---PEAITEEEALAKIRAIASKNQVQRNFIGQGYY
GCSP_XANCP       MTDAIVPSNIKS-------PAALAL---PDAITEEEALARIRAIASKNQVQRTFIGQGYY
GCSP_XYLFA       LTDAIVPEKIRS-------TVALDL---PKGITEEEALAKIRVIANKNRVFRSFIGQGYY
GCSP_XYLFT       LTDAIVPEKIRS-------TVALDL---PKGITEEEALAKIRVIANKNRVFRSFIGQGYY
GCSP_RALSO       LIDAVIPPAIRR-------QDGMPLGEFTQPLTEEAALAKLRGIAGQNRVVRSLIGQGYY
GCSP_NOSS1       LIEKTVPSAIRL-------HEQLQL---PEAQTEYAALAKLKQIASKNQVFRSYIGMGYY
GCSP_SYNY3       LIDQAVPPAIRF-------PRSLQL---PASQSEYGAIAQLKSIASKNQVFRSYIGMGYY
GCSP_THEEB       LINAVIPPEIRL-------QRPLAL---SEGLSETAALQKLRTLAQQNQVWRSYIGMGYY
GCSP_LEPIN       LIDKAVPVGIRL-------KKSLDL---PKASTEHKILQNLKGIASQNQVFRSYIGAGYH
GCSP_BACTN       LINKTIPANIRL-------KEPLAL---AKPLTEYEFGKHIADLASKNKLYTTYIGLGWY
GCSP_VIBPA       LISETVPANIRL-------EQPMTL---AEAKSEADMLATMKQFAKQNQVKRTFIGQGYY
GCSP_VIBVU       LIAQTVPAQIRL-------EKPMQL---AEAQSEADMLASIKKFADLNQVKRTFIGQGYY
GCSP_DEIRA       LTQTTLPAAIQF-------DGELHT---GPGMTEAQALAELKAVAQKNKVFRSYIGMGYA
GCSP_ECOLI       LTGQIVPKDIQL-------ATPPQV---GAPATEYAALAELKAIASRNKRFTSYIGMGYT
GCSP_ECOL6       LTGQIVPKDIQL-------ATPPQV---GAPATEYAALAELKAIASRNKRFTSYIGMGYT
GCSP_ECO57       LTGQIVPKDIQL-------ATPPQV---GAPATEYAALAELKAIASRNKRFTSYIGMGYT
GCSP_SALTI       LTGQIVPKDIQL-------ATPPQV---GEAATEYAALAELKAIAGRNKRFTSYIGMGYT
GCSP_SALTY       LTGQIVPKDIQL-------ATPPQV---GEAATEYAALAELKAIAGRNKRFTSYIGMGYT
GCSP_YERPE       LIQQIVPADIQL-------PGPPPV---GEAATEHQALAELKGIASQNQCYKSYIGMGYS
GCSP_SHEON       LTAQIVPESIRL-------SQELSI---GDSCGEAEGIAYIRGLAKQNQVFKSYIGMGYY
GCSP2_PSEAE      LIVQTVPPAIRL-------NRPLEL---PAALDEQAALARLRGYAGLNQRWTSLIGMGYY
GCSP2_PSEPK      LIEQTVPPDIRL-------NRPLDL---PAALDEQAALAKLAGYAEQNQVWTSLIGMGYH
GCSP_NEIMA       FVGNTVPQSIRM-------PSELDL---PEALTEADALAKLKGIASKNMINKSYIGLGYY
GCSP_TROW8       LMHAALPNGVQS-------PPDIKI----PSHDELTCLTQLAAFAKMNRIKTSMLGQGFY
GCSP_TROWT       LMNAALPNGVQS-------PPDIKI----PSHDELTCLTQLAAYAKMNRIKTSMLGQGFY
                 :    :*  :                       *      :      *    . :* *: 

GCSP_MYCLE       DTLTPAVLSRNILENPAWYTPYTPYQPEISQGRLEALLNFQTLVSDLTGLEIANASMLDE
GCSP_MYCTU       DTHTPPVLLRNIIENPAWYTAYTPYQPEISQGRLEALLNFQTLVTDLTGLEIANASMLDE
GCSP_STRAW       GTFTPPVILRNVMENPAWYTAYTPYQPEISQGRLEALLNFQTVVAELTGLPTSGASLLDE
GCSP_STRCO       GTFTPPVILRNVMENPAWYTAYTPYQPEISQGRLEALLNFQTMVAELTGLPTSGASLLDE
GCSP_BRUME       GVHTPPVIQRNLFENPAWYTAYTPYQSEISQGRLELLFHFQTLVAELTGLPVACASLLDE
GCSP_BRUSU       GVHTPPVIQRNLFENPAWYTAYTPYQSEISQGRLELLFHFQTLVAELTGLPVACASLLDE
GCSP_RHILO       GVHVPPVIQRNLFENPAWYTAYTPYQAEISQGRLEMLFNFQTLVTELTGLPVASASLLDE
GCSP_AGRFC       GTITPPVIQRNILENPAWYTAYTPYQPEISQGRLEALLNYQTMVCDLTGLDVANASLLDE
GCSP_RHIME       GTITPPVIQRNILENPAWYTAYTPYQPEISQGRLEALLNYQTMVCDLTGLDVANASLLDE
GCSP_BRADU       GTILPAVIQRNILENPAWYTAYTPYQPEISQGRLEALFNFQTMICDLTGLDVANASLLDE
GCSP1_PSEPK      NTHTPAPILRNLLENPAWYTAYTPYQPEISQGRLEALLNFQTLISDLTGLPIANASLLDE
GCSP_PSESM       NTHTPAPILRNLLENPAWYTAYTPYQPEISQGRLESLLNFQTLISDLTGLPIANASLLDE
GCSP1_PSEAE      NCHTPAPILRNLLENPAWYTAYTPYQPEISQGRLEALLNFQTLVSDLSGLPIANASMLDE
GCSP_XANAC       GTHTPKVILRNILENPAWYTAYTPYQAEISQGRMEALINFQTLCADLTGMQIANASLLDE
GCSP_XANCP       GTHTPKVILRNILENPAWYTAYTPYQAEISQGRMEALINFQTMCADLTGMQIANASLLDE
GCSP_XYLFA       GTHTPKVILRNVLENPAWYTAYTPYQAEISQGRMEALINFQTMCADLTGMEIANASLLDE
GCSP_XYLFT       GTHTPKVILRNILENPAWYTAYTPYQAEISQGRMEALINFQTMCADLTGMEIANASLLDE
GCSP_RALSO       GTHTPGVILRNILENPAWYTAYTPYQPEISQGRLEAMLNFQQMVMDLTAMDIANASMLDE
GCSP_NOSS1       DTITPSVIGRNILENPGWYTAYTPYQPEIAQGRLEALLNFQTMIIDLTGLEIANASLLDE
GCSP_SYNY3       DTITPPVIQRNILENPGWYTAYTPYQAEIAQGRLEALLNFQTMVMDLTGLEIANASLLDE
GCSP_THEEB       NCITPSVIQRNILENPGWYTQYTPYQAEIAQGRLEALLNFQTLVSDLTGLAIANASLLDE
GCSP_LEPIN       SCIIPGVIQRNILENPGWYTAYTPYQAEISQGRLEALLNFQTMIIDLTGLEISNASLLDE
GCSP_BACTN       NTITPAVIQRNVFENPVWYTSYTPYQTEVSQGRLEALMNFQTAVCDLTAMPLANCSLLDE
GCSP_VIBPA       NTFTPNVILRNVLENPGWYTAYTPYQPEISQGRLESLLNFQQMVIDLTGMEIANASLLDE
GCSP_VIBVU       NTFTPNVILRNVLENPGWYTAYTPYQPEISQGRLESLLNYQQMVMDLTGMDIANASLLDE
GCSP_DEIRA       GTDVPPVILRNMLENPGWYTAYTPYQAEISQGRLEMLLNFQQTVQDMTGMPVSNASLLDE
GCSP_ECOLI       AVQLPPVILRNMLENPGWYTAYTPYQPEVSQGRLEALLNFQQVTLDLTGLDMASASLLDE
GCSP_ECOL6       AVQLPPVILRNMLENPGWYTAYTPYQPEVSQGRLEALLNFQQVTLDLTGLDMASASLLDE
GCSP_ECO57       AVQLPPVILRNMLENPGWYTAYTPYQPEVSQGRLEALLNFQQVTLDLTGLDMASASLLDE
GCSP_SALTI       AVQLPPVILRNMLENPGWYTAYTPYQPEVSQGRLEALLNFQQVTLDLTGLDMASASLLDE
GCSP_SALTY       AVQLPPVILRNMLENPGWYTAYTPYQPEVSQGRLEALLNFQQVTLDLTGLDMASASLLDE
GCSP_YERPE       PVLTPPVILRNMLENPGWYTAYTPYQPEVSQGRLEALLNFQQLTQDLTGLDLASASLLDE
GCSP_SHEON       GTQVPNVILRNVLENPGWYTAYTPYQPEIAQGRLEAILNFQQVSMDLTGLDLASASLLDE
GCSP2_PSEAE      GTVTPSVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQLTIDLTGLDLASASLLDE
GCSP2_PSEPK      GTITPTVILRNVLENPGWYTAYTPYQPEIAQGRLEALLNFQQMVIDLTGLPLANASLLDE
GCSP_NEIMA       PTRVPNVILRNVLENPGWYTAYTPYQAEIAQGRLEALLNFQQVCIDLTGFPVAGASLLDE
GCSP_TROW8       NCITPAVIRRNILENPSWYTSYTPYQPEISQGRLEMLINFQTMICDLTGLEIANASMLDE
GCSP_TROWT       NCITPAVIRRNILENPSWYTSYTPYQPEISQGRLEMLINFQTMICDLTGLEIANASMLDE
                     *  : **::*** *** *****.*::***:* ::::*    :::.:  : .*:***

GCSP_MYCLE       GTAAAEAMTLMYRAARST-----ASRVVVDVDVFAQTVAVFATRAKPLGIDIVVADLREG
GCSP_MYCTU       GTAAAEAMTLMHRAARGP-----VKRVVVDADVFTQTAAVLATRAKPLGIEIVTADLRAG
GCSP_STRAW       GTAAAEAMALSRRMGKNK-----KGLFLVDADALPQTIAVIETRAEPTGVEVVVADLSEG
GCSP_STRCO       GTAAAEAMALSRRMGKNK-----KGLFLVDADALPQTVAVIRTRAEPTGVEVVVADLSEG
GCSP_BRUME       ATAVAEAIGVACRHHRDK-----RSRILLAGELHPQTVDVVNTRAEPLGWEIATGSDVDD
GCSP_BRUSU       ATAVAEAIGVACRHHRDK-----RSRILLAGELHPQTVDVVNTRAEPLGWEIATGSDVDD
GCSP_RHILO       ATAVAEAVGIALRHHRDK-----RTKVAFAGTPHPQTLDVVRTRAEPLGIEI-DGETIDD
GCSP_AGRFC       ATAAAEAMAMCQRVAKSK-----ATAFFVDANCHPQTIALIETRAAPLGWKVIIGNPFTD
GCSP_RHIME       ATAAAEAMAIAERVAKSK-----AKAFFIDENCHPQTIALLKTRAEPLGWQIVLGDPFED
GCSP_BRADU       ATAAAEAMALAERHSRVE-----AKAFFVDKDVHPQTLAVMRTRAEPLGWNLIVGDPLTD
GCSP1_PSEPK      ATAAAEAMTFCKRLSKNKS----SHAFFASVHCHPQTLDVLRTRAEPLGIEVVVGDEREL
GCSP_PSESM       ATAAAEAMTFCKRLSKNKG----SQQFFASSHCHPQTLDVLRTRAEPLGITVVVADETEL
GCSP1_PSEAE      ATAAAEAMTFCKRLSKNRT----SQAFFASRHCHPQTLDVLRTRAEPLGIEVVVGDESTI
GCSP_XANAC       ATAAAEAMTLAKRSAKSK-----SNTFFVHDAVHPQTLELLRTRAEPLDIVLRVGTPEEA
GCSP_XANCP       ATAAAEAMTLAKRSAKSK-----SDTFFVHDAVHPQTQELLRTRAEPLGIVLRVGTPDEA
GCSP_XYLFA       ATAAAEAMSLAKRSAKSR-----SDLFFVHDAVHPQTLELLRTRAEPLGIVLRVGTPEEA
GCSP_XYLFT       ATAAAEAMSLAKRSAKSR-----SDLFFVHDAVHPQTLELLRTRAEPLGIVLRVGTPEEA
GCSP_RALSO       ATAAAEAMTLLQRVGKHP-----SNVFFVADDVLPQTLDVVRTRAEPIGVQVVTGPAADA
GCSP_NOSS1       ATAAAEAMSMSYGVSKNK-----ANAYFVSHDCHPQIIDVLQTRAKPLGIEIIIGDHQTF
GCSP_SYNY3       GTAAAEAMALSYGVSKSK-----ANAFFVAQDCHPQTIEVIKTRANPLGIEVIVGDHHTF
GCSP_THEEB       ATAAAEAMTLSFNACRQRG----ANRFLVAQDCHPQTLAVLRTRALPLGIQIVPIDPIAG
GCSP_LEPIN       GTAAAEAMFLAYSVRKNET----AKKFFVSELCHPQTIDVVVTRANPLGIEVQIGNHESI
GCSP_BACTN       ATAAAEAVTMMYALRSRTQQKAGANVVFVDENIFPQTLAVMTTRAIPQGIELRVGKYKEF
GCSP_VIBPA       ATAAAEAMTLCKRAGKSK-----SNVFFVADDVHPQTIEVVKTRAKFIGFEVLVGSLESL
GCSP_VIBVU       ATAAAEAMTLCQRAGKSK-----SKVFFVADDVHPQTIEVIKTRAKYFGFDVVIGNVDSL
GCSP_DEIRA       ATAAAEAMTLAKRQSKNKG----SNVFFVADNVHPQTMDVVKTRAEYFGFEVQTGSADAI
GCSP_ECOLI       ATAAAEAMAMAKRVSKLKN----ANRFFVASDVHPQTLDVVRTRAETFGFEVIVDDAQKV
GCSP_ECOL6       ATAAAEAMAMAKRVSKLKN----ANRFFVASDVHPQTLDVVRTRAETFGFEVIVDDAQKV
GCSP_ECO57       ATAAAEAMAMAKRVSKLKN----ANRFFVASDVHPQTLDVVRTRAETFGFEVIVDDAQKV
GCSP_SALTI       ATAAAEAMAMAKRVSKLKN----ANRFFVAADVHPQTLDVVRTRAKTFGFDVIVDDADKV
GCSP_SALTY       ATAAAEAMAMAKRVSKLKN----ANRFFVASDVHPQTLDVVRTRAETFGFDVIVDDAAKA
GCSP_YERPE       ATAAAESMALAKRASKLKD----ANRFFVADDVHPQTLDVVLTRAETFGFDVIVDRAEKV
GCSP_SHEON       ATAAAEAMALAKRVSKAKK----ANIFFVADDVFPQTLDVVKTRAECFGFEVVVGPASEA
GCSP2_PSEAE      ATAAAEAMALARRVAKAR-----SNRFFVDAHCHPQTVSVLRTRAEAFGFELVVDEPDNL
GCSP2_PSEPK      ATAAAEAMALAKRVARNK-----SNAFFADEHCHPQTLSVLKTRAEGFGFELIVDSVDNL
GCSP_NEIMA       ATAAAEAMAMAHRVGKVK-----SERFFVDERVYPQTLDVMKTRAKYFGFELVVGDFAQA
GCSP_TROW8       ASCAAEAMLLAKRVSRSS-----SNKYLVHNGVFPHIRRVLETRADAVGVEIVDLPEGQS
GCSP_TROWT       ASCAAEAMLLAKRVSRSS-----SNKYLVHNGVFPHIRRVLETRADAVGVEIVDLPEGQS
                 .:..**:: .                        .:   :. ***   .  :        

GCSP_MYCLE       LPDG----EFFGVITQLPGA----SGRITDWTALIAQAHSRGALVAVGADLLALTLITPP
GCSP_MYCTU       LPDG----EFFGVIAQLPGA----SGRITDWSALVQQAHDRGALVAVGADLLALTLIAPP
GCSP_STRAW       IPAGIAEREINGVLIQYPGA----SGAVRDIKPLVEQAHELGAVVTVAADLLALTLLTSP
GCSP_STRCO       IPAEVAEREINGVLLQYPGA----SGAVRDIKPVIDRAHELGALVTVAADLLALTLLTSP
GCSP_BRUME       NTA--------AIVVPWPDT----RGVYGDFAKVIADAKAKGALVIAVADPLALTIMEAP
GCSP_BRUSU       NTA--------AIVVPWPDT----RGVYGDFAKVIADAKAKGALVIAVADPLALTIMEAP
GCSP_RHILO       NTA--------ALLVSWPDT----LGVYGDHKAAIDKARAAGALVVFIADPLGLTLTDAP
GCSP_AGRFC       LDP----VDVFGAIFQYPGT----HGHVSDFTGLISRLHQTGAIAAVAADLLALTLLKSP
GCSP_RHIME       LDA----AGVFGAIFQYPGT----YGHVRDFSGLIAKLHGQGAIAAVAADPLALALLKSP
GCSP_BRADU       LDK----ADVLGALLQYPGS----SGALRDLRPAIAALKAKGALAIVAADLLALTLLASP
GCSP1_PSEPK      GDV----SAFFGALLQYPAS----NGEVFDYREVVQRFHAANALVAVAADLLALTLLTPP
GCSP_PSESM       GDV----SDYFGALLQYPAS----NGDVFDYRELAERFHGANALVAVAADLLALTLLTPP
GCSP1_PSEAE      EDF----SAYFGALLQYPTC----DGEIVDYRELVSRFHAVDALVAVAADLLALTLLTPP
GCSP_XANAC       LQA----EC-FGVLLQYPDS----FGHIGDHAALADAVHAQGGLVAVATDLLALTLIAAP
GCSP_XANCP       MQA----EC-FGVLLQYPDS----FGHIGDHAALADAVHAQGGLVAVATDLLALTLIAAP
GCSP_XYLFA       LQA----DV-FGILLQYPDT----FGRIGDHRVLADAVHARGGLVAVASDLLALTLITPP
GCSP_XYLFT       LQV----DV-FGILLQYPDT----FGRIGDHRVLADAVHARGGLVAVASDLLALTLITPP
GCSP_RALSO       AKH----NA-FGVLLQYPGTGGALLGGLSTYQALTDAVHAAGGLVVAAADLLALTLLAAP
GCSP_NOSS1       DFD----KPIFGAVLQYPAS----DGTIYDYRAFIETSHAQGALVTVAADPLSLTLLTPP
GCSP_SYNY3       SFS----TSIFGALLQYPAT----DGAVYDYRSFIDKAHQHQALVTLAADPLSLTLLTPP
GCSP_THEEB       ELPW---ENAFGLLLQYPAS----DGAVRSPQALIAAAHERGLLVTVATDLLALTLLRPP
GCSP_LEPIN       ELN----EDFFGVLLQYPAT----DGKVIDYTSFIQRSHNVGAISTVAADLLALTLLKSP
GCSP_BACTN       EPS----PEIFACILQYPNS----SGNVEDYADFTKKAHEADCKVAVAADILSLALLTPP
GCSP_VIBPA       PEQ----D-VFGALVQYPST----TGEVRDLTDIIAKAQANKTLVTVATDLLACTLLKPA
GCSP_VIBVU       PQT----E-AFGALLQYPST----TGEVRDLTDVITQAQANKTLVSVATDLLASALVKPA
GCSP_DEIRA       PE-----G-AFGALVQYPGT----HGEVLNLAPIAEKAHTQGAALIVATDLLACALLTPP
GCSP_ECOLI       LDH----QDVFGVLLQQVGT----TGEIHDYTALISELKSRKIVVSVAADIMALVLLTAP
GCSP_ECOL6       LDH----QDVFGVLLQQVGT----TGEIHDYTALISELKSRKIVVSVAADIMALVLLTAP
GCSP_ECO57       LDH----QDIFGVLLQQVGT----TGEIHDYTALISELKSRKIVVSVAADIMALVLLTAP
GCSP_SALTI       LDH----QDVFGVLLQQVGT----TGEIHDYGTLISELKARKVIVSVAADFMALVLLTAP
GCSP_SALTY       LDH----QDVFGVLLQQVGT----TGEIHDYSALITELKSRKVVVSVAADFMALVLLTAP
GCSP_YERPE       LEL----DGIFGVLLQQVGT----TGELHDYSALLAELKKRKIITSVAADIMALVLLTAP
GCSP_SHEON       VNH----E-LFGALFQYSNR----FGQITDFTDLFAELRAKNVIVTVAADIMSLVLLKSP
GCSP2_PSEAE      AAH----A-VFGALLQYPDS----RGEIRDLRPLIEALHGQQALACVASDLLALLLLTPP
GCSP2_PSEPK      AKH----S-VFGALLQYPDT----HGEVRDLRPLIDQLHSQQALACVAADLLSLVVLAPP
GCSP_NEIMA       DEG----E-YFGALFQYVGK----DGDVQDLQDVIGRLKAKGTIVAVAADIMSLVLLKSP
GCSP_TROW8       IDF-----DHFGVYAQYQSA----SGKLLDLRPLFSRSKRAGAICVIGCDLLMLTLFTSP
GCSP_TROWT       IDF-----DHFGVYAQYQSA----SGKLLDLRHLFSRSKRAGAICVIGCDLLMLTLFTSP
                            .             *            :          * :   :  ..

GCSP_MYCLE       GEIGADVAFGTTQRFGVPMGFGGPHAGYLALHTKHARQLPGRLVGVSVDSDGTPAYRLAL
GCSP_MYCTU       GEIGADVAFGTTQRFGVPMGFGGPHAGYLAVHAKHARQLPGRLVGVSVDSDGTPAYRLAL
GCSP_STRAW       GELGADIAVGTTQRFGVPMGFGGPHAGYMAVREKFARSLPGRLVGVSVDADGHKAYRLAL
GCSP_STRCO       GELGADIAVGTTQRFGVPMGFGGPHAGYMAVHEKFARSLPGRLVGVSVDADGNKAYRLAL
GCSP_BRUME       ARWGADMAVGSMQRYGVPMGFGGPHAAYLAVSEALTRIIPGRIVGQSVDAHGRAAYRLAL
GCSP_BRUSU       ARWGADMAVGSMQRYGVPMGFGGPHAAYLAVSEALTRIIPGRIVGQSVDAHGRAAYRLAL
GCSP_RHILO       AKLGADIAVGPMQRFGVPMGFGGPHAAYCAVSDRLTRLMPGRLVGQSTDSKGRPGYRLAL
GCSP_AGRFC       GEMGADIAIGTSQRFGVPVGYGGPHAAYMSVKDAHKRSMPGRLVGVSVDARGNRAYRLSL
GCSP_RHIME       GEMGADIAIGSTQRFGVPVGYGGPHAAYMAVKDAYKRSMPGRLVGVSVDARGNRAYRLSL
GCSP_BRADU       GELGADIAIGSAQRFGVPMGYGGPHAAYMAVRDALKRSLPGRIVGLSVDSRGMPAYRLAL
GCSP1_PSEPK      GEFDADVAIGSAQRFGVPLGFGGPHAAYFATRDAFKRDMPGRLVGVSIDRFGKTALRLAM
GCSP_PSESM       GEFGADVAIGSAQRFGVPLGFGGPHAAYFSTRDAFKRDMPGRLVGVSVDRHGKQALRLAM
GCSP1_PSEAE      GEFGADVAIGSAQRFGVPLGFGGPHAAYFATRDAFKRDMPGRLVGVSIDRHGKPAYRLAM
GCSP_XANAC       GEWGADIVVGNSQRFGVPFGFGGPHAAFMACRDAYKRSMPGRLIGVSIDAAGNPAYRLTL
GCSP_XANCP       GEWGADIVVGNSQRFGVPFGFGGPHAAFMACRDAYKRSMPGRLIGVSIDAAGNPAYRLTL
GCSP_XYLFA       GEWGADIVVGNSQRFGVPFGFGGPHAGFMACRDIYKRSIPGRLIGVSVDAAGHPAYRLAL
GCSP_XYLFT       GEWGADIVVGNSQRFGVPFGFGGPHAGFMACRDIYKRSIPGRLIGVSVDAAGHPAYRLAL
GCSP_RALSO       GEWGADVVIGNTQRFGVPFGFGGPHAGYMAVRDAFKRSMPGRLVGVTVDAQGNPAYRLAL
GCSP_NOSS1       GEFGADIAVGSTQRFGIPLGFGGPHAAYFATKEEYKRQVPGRIVGVSKDVHGKTALRLAL
GCSP_SYNY3       GELGADIAVGSTQRFGIPLGYGGPHAAYFATKAEYQRKMPGRIVGVSKDAHGNPALRLAL
GCSP_THEEB       GELGADIAVGSSQRFGVPLGYGGPHAAFFATREDFKRQLPGRLVGVSHDALGQRALRLAL
GCSP_LEPIN       GEMGADIAVGSSQRFGLPLGFGGPHAGYFATKDEFKRSMPGRLIGVSKDSQGNSGLRLSL
GCSP_BACTN       GEWGADIVFGTTQRLGTPMFYGGPSAGYFATRDEYKRNMPGRIIGWSKDKYGKLCYRMAL
GCSP_VIBPA       GEMGADVAIGSAQRFGVPMGYGGPHAAFMATRDKHKRTMPGRVIGVSIDAKGNQALRMAM
GCSP_VIBVU       GEMGADVVIGSAQRFGVPMGYGGPHAAFMATREQHKRTMPGRVIGVSIDAKGNQALRMAM
GCSP_DEIRA       GEQGADIVVGSAQRFGVPMGFGGPHAAFLACQKGFERSMPGRVIGVSKDVRGNTALRMAM
GCSP_ECOLI       GKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDEYKRSMPGRIIGVSKDAAGNTALRMAM
GCSP_ECOL6       GKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDEYKRSMPGRIIGVSKDAAGNTALRMAM
GCSP_ECO57       GKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDEYKRSMPGRIIGVSKDAAGNTALRMAM
GCSP_SALTI       GKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDEFKRSMPGRIIGVSKDAAGNTALRMAM
GCSP_SALTY       GKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDEFKRSMPGRIIGVSKDAAGNTALRMAM
GCSP_YERPE       GAQGADVVFGSAQRFGVPMGYGGPHAAFFACRDEFKRSMPGRIIGVSRDAAGNTALRMAM
GCSP_SHEON       GSMGADVVFGSAQRFGVPMGFGGPHAAFFVARDEHKRSMPGRIIGVSKDTRGNRALRMAM
GCSP2_PSEAE      GELGADVVLGSAQRFGVPMGYGGPHAAFFATREGYKRAMPGRIIGVSRDARGNPALRMAL
GCSP2_PSEPK      GELGADVVLGSTQRFGVPMGYGGPHAAYFACRDDYKRAMPGRIIGVSRDARGNTALRMAL
GCSP_NEIMA       AELGADIALGNTQRFGVPMGFGGPHAAYFAFKDEFKRSAPGRIIGVSKDASGKPALRMAL
GCSP_TROW8       GELGADIAFGSAQRFGIPMNFGGPLASFLAARKAMERSLPGRLVGVSVDADSNHAYRLTL
GCSP_TROWT       GELGADIAFGSAQRFGIPMNFGGPLASFLAARKAMERSLPGRLVGVSVDADSNHAYRLTL
                 .  .**:..*  ** * *. :*** *.:        *  ***::* : *  .    *:::

GCSP_MYCLE       QTREQHIRRDKATSNICTAQVLLAVMAAMYASYHGAEGLTGIARRVHAQARALAAGLSAA
GCSP_MYCTU       QTREQHIRRDKATSNICTAQVLLAVLAAMYASYHGAGGLTAIARRVHAHAEAIAGALGDA
GCSP_STRAW       QTREQHIRREKATSNICTAQVLLAVMAGMYAVYHGPDGLRTIARRTHRYATILAEGLKAG
GCSP_STRCO       QTREQHIRREKATSNICTAQVLLAVMAGMYAVYHGPEGLRAIARRTHRYATITAAGLAAG
GCSP_BRUME       QTREQHIRRDKATSNICTAQALLANMAAAFAIWHGPAGLQAIATRVAALAARFAAALKAA
GCSP_BRUSU       QTREQHIRRDKATSNICTAQALLANMAAAFAIWHGPAGLQAIATRVAALAARFAAALKAA
GCSP_RHILO       QTREQHIRRDKATSNICTAQALLANMATAYAIWHGPAGLQAIAGRIHALANRLASGLKAA
GCSP_AGRFC       QTREQHIRREKATSNICTAQVLLAVMASMYGVFHGPQGIKAIAQQTHQKAVLMAKGLEKL
GCSP_RHIME       QTREQHIRREKATSNICTAQVLLAVMASMYAVFHGPDGIKAIAQSVHQKTVRLAMGLEKL
GCSP_BRADU       QTREQHIRREKATSNICTAQVLLAVIAAMYAVYHGPEGLSQIARQVHRRAAVLAAGLRKL
GCSP1_PSEPK      QTREQHIRREKATSNICTAQVLLANIASMFAVYHGPAGLKRIAERTHALTAILAAGLKAL
GCSP_PSESM       QTREQHIRREKATSNICTAQVLLANIASMYAVYHGPRGLTQIANRVHHLTAILAEGLSQL
GCSP1_PSEAE      QTREQHIRREKATSNICTAQVLLANIASMFAVYHGPQGLLRIARRTHRLTAILAAGLERL
GCSP_XANAC       QTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPDGLVRIARRTHRLAAILAAALRSA
GCSP_XANCP       QTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPEGLTRIARRTHRLAAILAAALRSA
GCSP_XYLFA       QTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPQGLLRIAWRTHRMAAILAAALRGA
GCSP_XYLFT       QTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPQGLLRIAWRTHRMAAILAAALRGA
GCSP_RALSO       QTREQHIRREKATSNICTAQVLLGVMASMYAVYHGPQGLKRIAQRVHRLTATLAAGLRQI
GCSP_NOSS1       QTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPEGLKQIAERIHHLTLVLGVWLQRL
GCSP_SYNY3       QTREQHIRRDKATSNICTAQVLLAVMASMYGVYHGSTGLKNIALRIHQLTVLLAIGLKRL
GCSP_THEEB       QTREQHIRREKATSNICTAQVLLAVVASMYAVYHGPDGLRQIAERIHQRTVRLAAGLEAA
GCSP_LEPIN       QTREQHIRRDKATSNICTAQVLLAVISSMYAIYHGPEGLKNIATRIYKFTSIFANVLKNA
GCSP_BACTN       QTREQHIKREKATSNICTAQALLATMAGFYAVYHGQEGIKTIASRIHSITVFLDKQLKKF
GCSP_VIBPA       QTREQHIRREKATSNICTAQALLANMASFYAVYHGAEGLRTIARRTHHMTAILAAGLTKG
GCSP_VIBVU       QTREQHIRREKATSNICTAQALLANMASFFAVYHGEVGIRTIARRTHHMTAILAAGLTKS
GCSP_DEIRA       QTREQHIRREKATSNICTAQALLANMAAAYAVWHGPEGIKTIAERVHRLTGILAKALQDA
GCSP_ECOLI       QTREQHIRREKANSNICTSQVLLANIASLYAVYHGPVGLKRIANRIHRLTDILAAGLQQK
GCSP_ECOL6       QTREQHIRREKANSNICTSQVLLANIASLYAVYHGPVGLKRIANRIHRLTDILAAGLQQK
GCSP_ECO57       QTREQHIRREKANSNICTSQVLLANIASLYAVYHGPIGLKRIANRIHRLTDILAAGLQQK
GCSP_SALTI       QTREQHIRREKANSNICTSQVLLANIASLYAVYHGPVGLKRIANRIHRLTDILAAGLQQK
GCSP_SALTY       QTREQHIRREKANSNICTSQVLLANIASLYAVYHGPVGLKRIANRIHRLTDILAAGLQQK
GCSP_YERPE       QTREQHIRREKANSNICTSQVLLANIASLYAVYHGPQGLQRIAGRIHRMTDILAAGLQHA
GCSP_SHEON       QTREQHIRREKANSNICTAQILLANMASFYAVFHGPQGLKTIASRINRFADILAAGLQAK
GCSP2_PSEAE      QTREQHIRREKANSNICTAQVLLANIASLYAVYHGPQELKRIAQRVQRLTALLAAGLKSK
GCSP2_PSEPK      QTREQHIRREKANSNICTAQVLLANIAGFYAVYHGPEGLQRIAQRVHRLTFILAAGLEAK
GCSP_NEIMA       STREQHIRREKATSNICTAQALLANLAGMYAVYHGPKGVKRIADRIHALASAFADALVSD
GCSP_TROW8       QTREQHIRREKATSNICTATVLMAIAAVAFAQHHGPKGLRAIAHRINTVAVGFARLLKQT
GCSP_TROWT       QTREQHIRREKATSNICTATVLMAIAAVAFAQHHGPKGLRAIAHRINTVAVGFARLLKQT
                 .******:*:**.*****:  *:.  :  :.  **   :  **      :      *   

GCSP_MYCLE       GVEVVHQAFFDTVLARVPGR--TVQIQGAAKERGINVWLVDGDHVSVACDEATTDEHI--
GCSP_MYCTU       ---LVHDKYFDTVLARVPGR--ADEVLARAKANGINLWRVDADHVSVACDEATTDTHV--
GCSP_STRAW       GVEVVHGAYFDTLTARVPGR--AAEIVAAAREGGVNLHLVDADLVSISCDETTTRAQL--
GCSP_STRCO       GVEIVHGSYFDTVTARVPGR--AAGIVHAARENGINLRLVDADHVSFACDETTTRAQV--
GCSP_BRUME       GVEIAGESLFDTVTAKVPGK--AAAIAAEADKGGRLIRIIDADTVGVTFDETSTEEDL--
GCSP_BRUSU       GVEIAGESLFDTVTAKVPGK--AAAIAAEADKGGRLIRIIDADTVGVTFDETSTEEDL--
GCSP_RHILO       GVSVLGASRFDTVTVEAKGK--AAEIAEAAEKTGRLLRVLDADHVGIAFDETSTDADL--
GCSP_AGRFC       GYTIEPETFFDTITVEVGHM--QGVILRSAVAEGVNLRKVGATKIGMSLDERTRPATL--
GCSP_RHIME       GYTVEPDVFFDTITVEVGKL--QGIILKAAVAEEVNLRKIGTTRIGISLDERSRPVTL--
GCSP_BRADU       GFAPHSDSFFDTLSVDAGAK--RAEIVARAAAEKINLG-VGETALRIALDETTTPATV--
GCSP1_PSEPK      GVQVVGASAFDTLTLATGTA--TASLHDKARAQGINLRQIDAAHVGLSLDETSTQADV--
GCSP_PSESM       GLNAEQAYFFDSLTLHTGGR--TAALHAAARARHINLREIDDQRLGLSLDETTSQSAV--
GCSP1_PSEAE      GVAVEQKHFFDTLSLATGAR--TAAIHAKARAAGINLREIDAGRLGLSLDETVRQTDV--
GCSP_XANAC       GVSV-GDRFFDTLHV-KAID--ADAIHARARAAGINLRAIDSEAVGISLDETTTRADV--
GCSP_XANCP       GVTV-GEHFFDTLHV-KAID--ADAIHAKAHAAGINLRAIDSEAVGISLDETSTRADV--
GCSP_XYLFA       GLTV-GEYFFDTLHI-VGID--AVAIHCAAAAAGMNLRMIDNAQLGISLDETVTRSDV--
GCSP_XYLFT       GLTV-GEYFFDTLHI-VGID--ALAIHCAAAAAGMNLRMIDNAQIGISLDETVTRSDV--
GCSP_RALSO       GYTLEAGAFFDTLTVATGPR--TANLHIAAQAHGFNLRQIDDGRLGVSLDETVTRAEV--
GCSP_NOSS1       GYTITSQSFFDTLQIKLGEKP-LQEILEAAEAYRINLRIVDTSTVGISLDETTTLEDV--
GCSP_SYNY3       NYSLNNDYFFDTLRVGVGEQS-APAILKAAEGRGINLRPLVPGEVGISLDETVTVQDL--
GCSP_THEEB       GYQLYYSEFFDTLRIGLGNLP-VPVLKERAAAARINLRYFDDGSAGISLDETTTEKDV--
GCSP_LEPIN       GFSITNEFFFDTITIQAGAK--VQEILNRAYSKKINFREYKDGKIGITLDETVNLEDL--
GCSP_BACTN       GYTQVNAQYFDTLRFELPEHVSAQQIRTIALSKEVNLRYYENGDVGFSIDETTDIAAT--
GCSP_VIBPA       GFELAHNSFFDTITINTGEK--TQDLYTKALAADINLRVL-PGKLGISLDETTTVADV--
GCSP_VIBVU       GYELAHNAFFDTITINTGDN--TQALYAKAQAADINLRLL-DGQIGISFDETTTVADI--
GCSP_DEIRA       GIK-ANETFFDTLTFEGQD-----DLGARAEAKGINFRLD-GGKVGISLDETVTPQD---
GCSP_ECOLI       GLKLRHAHYFDTLCVEVAD---KAGVLTRAEAAEINLRSDILNAVGITLDETTTRENV--
GCSP_ECOL6       GLKLRHAHYFDTLCVEVAD---KAGVLARAEAAEINLRSDILNAVGITLDETTTRENV--
GCSP_ECO57       GLKLRHAHYFDTLCVEVAD---KAGVLARAEAAEINLRSDILNAVGITLDETTTRENV--
GCSP_SALTI       GLKLRHAHYFDTLCVEVAD---KAAVLARAEAAEINLRSDIHNAVGITLDETTTRENV--
GCSP_SALTY       GLKLRHAHYFDTLCVEVAD---KAAVLARAEAAEINLRSDIHNAVGITLDETTTRENV--
GCSP_YERPE       GLTLRFKHWFDTLTVEVKD---KAAVLARALSFGINLRTDIHGAVGITLNETTSREDI--
GCSP_SHEON       GVSLVNNTWFDTISIKGLD---VAAVNARALAAEMNLRFDADGIVGVSLDETTIRTDI--
GCSP2_PSEAE      GLRRLNRHFFDTLTYEVGER--QAAILERARAARVNLRVVDDRRLALSLDETCDAATL--
GCSP2_PSEPK      GIKRLNQHFFDTLTLNVGGA--QAAIIESAEAAHINLRILGRGHLGVSLDETCTEQTV--
GCSP_NEIMA       GLNVVHKVFFDTVTVDFGNKEKADQVFAAALESGYNLRRVNDTQVAAAFHETSACEDL--
GCSP_TROW8       AFRVSSLDIFDTIEINNPT----QVCVEAESKYDLLFWKVDDNKLRITFDEVTARLDGDL
GCSP_TROWT       AFRVSSLDIFDTIEINNPT----QLCVEAESKHDLLFWKVDDNKLRITFDEVTARLDGDL
                          **::                       .          : .*         

GCSP_MYCLE       -TAVLAAFAAT--------------------------------PARASFA----GPDIAT
GCSP_MYCTU       -AVVLDAFGV----------------------------------AAAAPA----HTDIAT
GCSP_STRAW       -GAVWTAFGVEG--------------------------DIEALDAAAEDT----LPAALL
GCSP_STRCO       -GGVWHAFGVEG--------------------------DIESLDAEAGET----LPEALL
GCSP_BRUME       -TALASLFGAKL----------------------------VGGDTVLVPG--------KE
GCSP_BRUSU       -TALASLFGAKP----------------------------VGGDTVLVPG--------KE
GCSP_RHILO       -DAIASLFGAKA----------------------------APSADSTVPG--------KP
GCSP_AGRFC       -EAVWRAFGGN--------------------------FSISDFEPDYR------LPKDLL
GCSP_RHIME       -EAVWRAFGGD--------------------------FKVEEFEPDYR------LPQELL
GCSP_BRADU       -EAVWRAFGGQ--------------------------LAYAELDATTREA----LPEALK
GCSP1_PSEPK      -ESLWQLLGGE-----------------------QAQPDFTALAASTGSL----LPAALL
GCSP_PSESM       -EVLWDIFASTG----------------------QTLPDFTALAASVKSR----LPAALL
GCSP1_PSEAE      -ETLWGLLAEEG----------------------QALPDFAALAASSGDR----LPVELL
GCSP_XANAC       -VALAQLFGATA--------------------------DVDALDAATADA----LPQGLL
GCSP_XANCP       -VALAQLFGAQA--------------------------DIDALDAATADA----LPQGMR
GCSP_XYLFA       -VALGQVFGVQV--------------------------DVEALDAITADA----LPAGLL
GCSP_XYLFT       -VALGQVFGVQV--------------------------DVEALDAITADA----LPAGLL
GCSP_RALSO       -VALWEIFAHAAH---------------------AGAPDFDQVEAGIADA----FPASLA
GCSP_NOSS1       -KDICRIFAGTDE---------------------L-PFVLNVQEFDWIIQQSSLKDEPFS
GCSP_SYNY3       -LDLWQVFAGKDN---------------------L-PFT---PEELWSEVKTSFPAD-LT
GCSP_THEEB       -ADLLALFGARPA---------------------E-VEG---------GDR--LPAA-LK
GCSP_LEPIN       -KDLLEIFEIKNT---------------------D-IEK-------LFVDVSNVPDS-FK
GCSP_BACTN       -NVLLSIFAIAAG---------------------K-DYQ----KVEDVPEKSNIDKA-LK
GCSP_VIBPA       -EALFAIFGVKED---------------------V-TALSTEVAGNEFAA----IPEALR
GCSP_VIBVU       -DALFAIFDVKES---------------------V-NALSTDIAGNEFAA----IPEACR
GCSP_DEIRA       ---LADIIEVVTG---------------------K-GVDVQKLDAEAVDG----IPAPLK
GCSP_ECOLI       -MQLFNVL-LGDN---------------------H-GLDIDTLDKDVAHD-SRSIQPAML
GCSP_ECOL6       -MQLFSVL-LGDN---------------------H-GLDIDTLDKDVAHD-SRSIQAAML
GCSP_ECO57       -MQLFSVL-LGDN---------------------H-GLDIDTLDKDVAHD-SRSIQPAML
GCSP_SALTI       -AQLFNVL-LGDS---------------------H-GLNIETLDKDVALD-SRSIQQGML
GCSP_SALTY       -AQLFNVL-LGDS---------------------H-GLNIETLDKDVALD-SRSIQQSML
GCSP_YERPE       -QTLFALF-VGDN---------------------H-GLDIDQLDAAVSQH-SQSIQDSML
GCSP_SHEON       -DALFEVI-LGAG---------------------H-GLDVAALDAQIVAQGSQSIPASLV
GCSP2_PSEAE      -ATLFEIF-LGAG---------------------H-GLDVAHLDGGAVAD---GIPAVLQ
GCSP2_PSEPK      -LRLLDIF-LGVD---------------------H-GLEITALDQLALPE---GIPASLV
GCSP_NEIMA       -VDLYRAF---T------------------------GKDTFAFADDVKGR----LNAELL
GCSP_TROW8       PERLSKVFGISPDKIRDLGCNYDSCDCSFYGDLQQAREGLSSVASRNISVHSDLARHPLR
GCSP_TROWT       PERLSKVFGISPDKIRDLGCNYDSCDCSFYSDSQQAREGLSSVASRNISVHSDLARHPLR
                    :   :                                                    

GCSP_MYCLE       RTSAFLTHPTFTKYRTETSMMRYLRALADKDIALDRSMIPLGSCTMKLNAAAEMESITWQ
GCSP_MYCTU       RTSEFLTHPAFTQYRTETSMMRYLRALADKDIALDRSMIPLGSCTMKLNAAAEMESITWP
GCSP_STRAW       RTDDYLTHPVFHQYRSETAMLRYLRRLSDRDYALDRGMIPLGSCTMKLNATTEMEPVTWP
GCSP_STRCO       RTDDFLTHPVFHQHRSETAMLRYLRRLADRDYALDRGMIPLGSCTMKLNATTEMEPVTWP
GCSP_BRUME       RGEGFLTQEVFHSHRSETEMMRFLRRLADKDLALDRAMIPLGSCTMKLNAAAEMMPVSWN
GCSP_BRUSU       RGEGFLTQEVFHSHRSETEMMRFLRRLADKDLALDRAMIPLGSCTMKLNAAAEMMPVSWN
GCSP_RHILO       RGKEFLTQPVFNENKSETDMMRLLRRLADKDLALDRSMIPLGSCTMKLNAAAEMMPVSWP
GCSP_AGRFC       RTSQYMTHPIFHMNRAESEMTRYIRRLSDRDLALDRSMIPLGSCTMKLNATAEMLPITWP
GCSP_RHIME       RTSAYLTHPIFHMNRAESEMTRYMRRLADRDLALDRAMIPLGSCTMKLNATAEMLPITWP
GCSP_BRADU       RTTAFLTHPVFHAHRSETEMLRYMRKLSDRDLALDRAMIPLGSCTMKLNATTEMMPLTWP
GCSP1_PSEPK      RQSAILEHPVFNRYHSETELMRYLRRLADKDLALDRSMIPLGSCTMKLNAASEMIPVTWA
GCSP_PSESM       RQSAILSHPVFNRYHSETELMRYLRKLADKDLALDRTMIPLGSCTMKLNAASEMIPVTWA
GCSP1_PSEAE      RQSAILSHPIFNRHHSETELMRYLRKLADKDLALDRTMIPLGSCTMKLNAASEMIPVTWA
GCSP_XANAC       RTTPFLTHPVFNTHHSEHELLRYMRSLADKDLAMDRTMIPLGSCTMKLNATAEMIPVTWP
GCSP_XANCP       RTSAFLQHPVFNTHHSEHELLRYMRSLADKDLAMDRTMIPLGSCTMKLNATAEMIPVTWP
GCSP_XYLFA       RSSAFLTHPVFNTHHSEHELLRYLRMLADKDLAMDRTMIPLGSCTMKLNATAEMIPVTWQ
GCSP_XYLFT       RSSAFLTHPVFNTHHSEHELLRYLRMLADKDLAMDRTMIPLGSCTMKLNATAEMIPVTWQ
GCSP_RALSO       RQSAYLTHPVFNAHHSEHEMLRYLRSLADKDLALDRTMIPLGSCTMKLNATAEMLPVTWP
GCSP_NOSS1       RQSSYLTHPVFNRYHSETELLRYLHRLETKDLSLTTSMIPLGSCTMKLNATSEMIPVTWE
GCSP_SYNY3       RQSLYLQDAVFNQYHSETELLRYLHQLESKDLALNTSMIPLGSCTMKLNATAEMMPVTWP
GCSP_THEEB       RQSPYLQHPVFQDYHSEHALLRYIHRLQAKDLSLTTSMIPLGSCTMKLNATAEMLPISWP
GCSP_LEPIN       RKTSYLTHPVFQSHHTETKMLRYIRKLESRDLSLTTSMIPLGSCTMKLNATTEMYPVTWP
GCSP_BACTN       RTTPFLTHEVFSNYHTETEMMRYIKRLDRKDISLAQSMISLGSCTMKLNAAAEMLPLSRP
GCSP_VIBPA       RTSEYLTHPVFNTYHSETQMMRYLKQLENKDFSLTHGMIPLGSCTMKLNAAAEMIPITWP
GCSP_VIBVU       RTSRFLTHPVFNTHHSETQMMRYLKQLENKDFSLTHGMIPLGSCTMKLNAAAEMIPVTWP
GCSP_DEIRA       RQSDFLTHPVFNTHHSEHGMLRYLKQLENKDYSLTHGMIPLGSCTMKLNATTEMIPVTWP
GCSP_ECOLI       RDDEILTHPVFNRYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWP
GCSP_ECOL6       RDDEILTHPVFNRYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWP
GCSP_ECO57       RDDEILTHPVFNRYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWP
GCSP_SALTI       RDDAILTHPVFNRYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWP
GCSP_SALTY       RDDAILTHPVFNRYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWP
GCSP_YERPE       RRDPILTHPVFNRYHSETEMMRYMHRLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWP
GCSP_SHEON       REDAILSHPTFNRYQSETEMMRYIKRLESKDLALNYSMISLGSCTMKLNAAVEMIPVSWP
GCSP2_PSEAE      RTSAYLQHPVFNAHHSETEMLRYLRQLEGKDLALNQAMIPLGSCTMKLNASSEMIPITWP
GCSP2_PSEPK      RRTPFLAHPVFNLHHSETEMLRYLKQLENKDLALNQSMIPLGSCTMKLNATSEMIPITWP
GCSP_NEIMA       RQDDILQHPVFNSYHTEHEMLRYLKKLEDRDLAMNRSMISLGSCTMKLNATAEMLPITWA
GCSP_TROW8       RFSGYLKHPVFNNYTGEVALMRYLKALSDKDFALDRGMIPLGSCTMKLNAAFQLEPVLWP
GCSP_TROWT       RFSGYLKHPVFNNYTGEVALMRYLKALSDKDFALDRGMIPLGSCTMKLNAAFQLEPVLWP
                 *    : .  *     *  : * :: *  :* ::   **.**********: :: .:   

GCSP_MYCLE       EFTRQHPFAPVSDTPGLRRLISDLESWLVQITGYDAVSLQPNAGSQGEYAGLLAIHDYHV
GCSP_MYCTU       EFGRQHPFAPASDTAGLRQLVADLQSWLVLITGYDAVSLQPNAGSQGEYAGLLAIHEYHA
GCSP_STRAW       EFGQLHPFAPAEQAQGYLTLIRELEERLAEVTGYDKVSLQPNAGSQGELAGLLAVRGYHR
GCSP_STRCO       EFGALHPFAPAEQAQGYLTLIRELEERLAEVTGYDKVSLQPNAGSQGEFAGLLAVRGYHR
GCSP_BRUME       TVANLHPFAPAEQVQGYAKMTSDLEAWLCEITGFAGVSLQPNAGSQGEYAGLMAIRHYHQ
GCSP_BRUSU       TVANLHPFAPAEQVQGYAKMTSDLEAWLCEITGFAGVSLQPNAGSQGEYAGLMAIRHYHQ
GCSP_RHILO       SIADLHPFAPASHSAGYRAMIGELEGWLSEITGFDAVSLQPNAGSQGEYAGLLAIRAYHR
GCSP_AGRFC       EFSDIHPFVPANQALGYKEMIDDLSEKLCSVTGYDAFSMQPNSGAQGEYAGLLTIRNYHL
GCSP_RHIME       EFSEIHPFVPADQALGYQHLIEDLSQKLCAITGYDAISMQPNSGAQGEYAGLLAIRAYHI
GCSP_BRADU       EFGSLHPFAPREQAKGYHALFARLEKWLCDITGYDAISLQPNSGAQGEYAGLLAIRGYHA
GCSP1_PSEPK      EFGNLHPFAPAEQSQGYLQMTTELEAMLCAATGYDAVSLQPNAGSQGEYAGLLAIRAYHR
GCSP_PSESM       EFGNLHPFAPAEQSAGYQQLTDELEAMLCAATGYDAISLQPNAGSQGEYAGLLAIRAYHQ
GCSP1_PSEAE      EFGNLHPFAPAEQSEGYRQLTDELEAMLCSATGYDAVSLQPNAGSQGEYAGLLAIRAYHQ
GCSP_XANAC       EFGAIHPLAPAEQSAGYAQLIDELEAMLVECTGYDAVSLQPNSGAQGEYAGLLAIRAYHR
GCSP_XANCP       EFGAIHPLAPPEQSAGYAQLIEELEAMLVECTGYDAVSLQPNSGAQGEYAGLLAIRAYHR
GCSP_XYLFA       EFACIHPLAPAVQWSGYRQLIDELEAMLAECTGYDAISLQPNSGAQGEYAGLLAIRAYHR
GCSP_XYLFT       EFACIHPLAPVVQWSGYRQLIDELEAMLVECTGYDAISLQPNSGAQGEYAGLLAIRAYHR
GCSP_RALSO       EFANIHPFAPADQTVGYREMIDQLEQMLCAATGYAAVSLQPNAGSQGEYAGLLIIHAYHA
GCSP_NOSS1       EFGRIHPFAPLTQTRGYQILFQQLEAWLGEITGFAGVSLQPNAGSQGEYTGLLVIRQYHQ
GCSP_SYNY3       EFGKIHPFAPAGQTEGYQILFAQLEAWLGEITGFDAISLQPNAGSQGEYAGLQVIRQYHL
GCSP_THEEB       EFNQLHPFAPQEQAQGYQALFRELAAMLAEITGFDAISLQPNAGSQGEYAGLLVIRQYHH
GCSP_LEPIN       EFGAIHPFAPADQTKGYKIIFEQLEKWLCEITGFAGVSLQPNAGSQGEYAGLLAIRRYHE
GCSP_BACTN       EFMSMHPLVPEDQAEGYRELISNLSEDLKVITGFAGVSLQPNSGAAGEYAGLRVIRAYLE
GCSP_VIBPA       EFGSIHPFAPAEQAAGYAALAKDLKEKLCEITGYDAFSLQPNSGASGEYAGLIAIQRYHE
GCSP_VIBVU       EFGALHPFAPIEQAAGYTALAEDLKAKLCEITGYDAFSLQPNSGASGEYAGLIAIQRYHE
GCSP_DEIRA       EFGGLHPFAPESQTQGYAEMLAELERWLADITGYDAVSMQPNSGAQGEYAGLLVIRKYHE
GCSP_ECOLI       EFAELHPFCPPEQAEGYQQMIAQLADWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHE
GCSP_ECOL6       EFAELHPFCPPEQAEGYQQMIAQLADWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHE
GCSP_ECO57       EFAELHPFCPPEQAEGYQQMIAQLADWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHE
GCSP_SALTI       EFAELHPFCPPEQAEGYHQMISQLSDWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHG
GCSP_SALTY       EFAELHPFCPPEQAEGYHQMISQLSDWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHE
GCSP_YERPE       EFAELHPFCPPEQAAGYQQMIGQLSQWLVQLTGYDAVCMQPNSGAQGEYAGLLAIRRYHE
GCSP_SHEON       EFANMHPFCPLDQAKGYTQLIEELSSWLVNVTGYDAVCIQPNSGAQGEYAGLLAIRKYHE
GCSP2_PSEAE      EFAELHPFVPREQAEGYRRMIDELEAWLRAITGFDAICMQPNSGAQGEYAGLLAIRRYHQ
GCSP2_PSEPK      GFAQLHPFAPAAQAAGYKAMIDELESWLCAITGFDAICMQPNSGAQGEYAGLMAITRYHC
GCSP_NEIMA       EFSDIHPYAPEAQTAGYRELLADMENSLKAITGFDAISLQPNSGAQGEYTGMLSIRRYQE
GCSP_TROW8       EFANLHPFAPLGDADGTLQIIDQIETWLANLSGYDAVSLQPTAGSQGELAGLLAIRGYYK
GCSP_TROWT       EFANLHPFAPRGDADGTLQIIDQIETWLANLSGYDAVSLQPTAGSQGELAGLLAIRGYYK
                  .   **  *  .  *   :   :   *   :*:  ..:**.:*: ** :*:  :  *  

GCSP_MYCLE       SRGEPHRNVCLIPSSAHGTNAASAALVGMRVVVVGCHDNGDVDLDDLRIKLSEHANRLSV
GCSP_MYCTU       SRGEPHRDICLIPSSAHGTNAASAALAGMRVVVVDCHDNGDVDLDDLRAKVGEHAERLSA
GCSP_STRAW       ANGDEQRTVCLIPSSAHGTNAASAVMAGMKVVVVKTADDGEIDVEDLRAKIEQYRDELSV
GCSP_STRCO       ANGDEQRTVCLIPSSAHGTNAASAVMAGMKVVVVKTAEDGEIDVEDLRAKIDKHRDELAV
GCSP_BRUME       ARGQGHRNICLIPSSAHGTNPASASMAGMSVVVVNCRPDGDIDIDDLKAKAEKHRDNLAA
GCSP_BRUSU       AWGQGHRNICLIPSSAHGTNPASASMAGMSVVVVNCRPDGDIDIDDLKAKAEKHRDNLAA
GCSP_RHILO       SRGEGHRTVCLIPSSAHGTNPASAAMAGMSVVVVRCLEDGNIDMDDMRAKANEHSKNLAA
GCSP_AGRFC       ANGGTHRDVCLIPTSAHGTNPASAQMVGMKVVPVKVRDNGDIDIDDFRLKAEQYAENLSC
GCSP_RHIME       ANGNEHRDVCLIPTSAHGTNPASAQMAGMKVVVVKVSDAGEIDMDDFRAKAEQYADTLSC
GCSP_BRADU       ARGEAHRKICLIPSSAHGTNPASAAMVGMDVVVVACEKNGDVDVNDLRAKADKHANDLAA
GCSP1_PSEPK      SRGEGHRDICLIPSSAHGTNPATAHMAGMRVVVTACDARGNVDVEDLRAKAIEHRERLAA
GCSP_PSESM       SRGDEHRDICLIPSSAHGTNPATANMAGMRVVVTACDARGNVDIEDLRAKALQHREQLAA
GCSP1_PSEAE      SRGDSQRDICLIPSSAHGTNPATASMVGMRVVVVACDARGNVDVEDLRNKASEHKERLAA
GCSP_XANAC       SRGQAHRDICLIPESAHGTNPASAQMCGMTVVVTKCDANGNVDVDDIRAKAEKYSDRLAA
GCSP_XANCP       SRNEAHRDICLIPESAHGTNPASAQMCGMTVVVTKCDANGNVDVDDIRAKAEKYSDRLAA
GCSP_XYLFA       SRGEERRNVCLIPESAHGTNPASAQLCGMQVVIIKCDRSGNVDVDDLRMKAEKYSDSLAA
GCSP_XYLFT       SRGEERRNVCLIPESAHGTNPASAQLCGMQVVIIKCDRSGNVDVDDLRMKAEKYSDTLAA
GCSP_RALSO       SRGESHRDVCLIPSSAHGTNPASAQMAGMKVVVVACDERGNVDLADLEKKAAEHSANLAA
GCSP_NOSS1       SRGETHRNVCLIPNSAHGTNPASAVMCGMKVVAVACDAGGNIDIDDLKAKAEKHSHELAA
GCSP_SYNY3       SRGEEQRNICLIPESAHGTNPASAVMCGMQVVPVKCDGEGNIDVEDLTSKAEKYGDRLAA
GCSP_THEEB       SRGESQRNVCLIPTSAHGTNPASAVMAGMQVVAVNCDAQGNIDVADLAAKAETYGDRLAA
GCSP_LEPIN       SRNESYRNVCLIPISAHGTNPASAAMAGFQVVVVSCDPNGNVDLEDLKAKAEEHKKDLAA
GCSP_BACTN       SIGQGHRNKILIPASAHGTNPASAIQAGFETVTCACDEQGNVDMGDLRAKAEENKEALAA
GCSP_VIBPA       SRGEGHRNVCLIPSSAHGTNPATASMVSMKVVVVKCDDEGNIDIDDLAAKIEKHKDNLSS
GCSP_VIBVU       SRGEGHRNVCLIPSSAHGTNPATAAMVSMKVVVVKCDENGNIDLVDLAAKIEKHQENLSS
GCSP_DEIRA       ARGEAHRNICLIPASAHGTNPASAAMMGMQVVVVKTDEQGNIDFDDLKAQAEAHSDHLAA
GCSP_ECOLI       SRNEGHRDICLIPASAHGTNPASAHMAGMQVVVVACDKNGNIDLTDLRAKAEQAGDNLSC
GCSP_ECOL6       SRNEGHRDICLIPASAHGTNPASAHMSGMQVVVVACDKNGNIDLTDLRAKAEQAGDNLSC
GCSP_ECO57       SRNEGHRDICLIPASAHGTNPASAHMAGMQVVVVACDKNGNIDLTDLRAKAEQAGDNLSC
GCSP_SALTI       SRNEGHRDICLIPASAHGTNPASAHMAGMQVVVVACDKNGNIDLDDLRAKAEQHAANLSC
GCSP_SALTY       SRNEGHRDICLIPASAHGTNPASAHMAGMQVVVVACDKNGNIDLDDLRAKAEQHAANLSC
GCSP_YERPE       SRNQANRHICLIPSSAHGTNPASAQMAGMSVVVVACDKQGNIDLHDLRQKAEHAGDELSC
GCSP_SHEON       SRGEAHRNICLIPQSAHGTNPASAQLAGMQVVVTACDKQGNVDLEDLKAKAAEVAENLSC
GCSP2_PSEAE      SRGDSQRDICLIPASAHGTNPASAIMASMRVVIVECDPRGNVDLDDLRLKAAEAGDRLSC
GCSP2_PSEPK      SRHQPMRTLCLIPSSAHGTNPASAQMAGMEVVIVDCDNDGNVDLADLKAKAHAAGERLSC
GCSP_NEIMA       AQGEAHRNICLIPKSAHGTNPATAAMLGLKVVVVDTDEHGNVNIDDLKAKAEQHRDALSA
GCSP_TROW8       SLNLD-RDVCLIPASAHGTNAASAVLAGMRVVVVACDQQGNIDLDDLRLKASKNAHALAA
GCSP_TROWT       SLNLD-RDVCLIPASAHGTNAASAVLAGMRVVVVACDQQGNIDLDDLRLKASKNAHALAA
                 :     *   *** ******.*:*   .: .*       *:::. *:  :       *: 

GCSP_MYCLE       LMITYPSTHGVYEHDIAEICAAVHDAGGQVYVDGANLNALVGLARPGKFGGDVSHLNLHK
GCSP_MYCTU       LMITYPSTHGVYEHDIAEICAAVHDAGGQVYVDGANLNALVGLARPGKFGGDVSHLNLHK
GCSP_STRAW       LMITYPSTHGVFEEHVADICAQVHEAGGQVYVDGANLNALVGLAKPGHFGGDVSHLNLHK
GCSP_STRCO       LMITYPSTHGVFEEHVADICAQVHDAGGQVYVDGANLNALVGLAKPGHFGGDVSHLNLHK
GCSP_BRUME       FMITYPSTYGVFEEGIKAFCEIVHDNGGQVYFDGANLNALVGLARPADIGADVCHMNLHK
GCSP_BRUSU       FMITYPSTYGVFEEGIKAFCEIVHDNGGQVYFDGANLNALVGLARPADIGADVCHMNLHK
GCSP_RHILO       LMFTYPSTHGVYEEGARHLCALIHEHGGQVYFDGANLNALVALARPADIGADVCHMNLHK
GCSP_AGRFC       CMITYPSTHGVFEETVREICEITHKHGGQVYLDGANMNAMVGLARPGDIGSDVSHLNLHK
GCSP_RHIME       CMITYPSTHGVFEENVREVCEVVHKHGGQVYLDGANMNAMVGLSRPGDIGSDVSHLNLHK
GCSP_BRADU       IMITYPSTHGVFEEHIREICDIVHGHGGQVYLDGANLNAQVGLSRPGDYGADVSHLNLHK
GCSP1_PSEPK      IMITYPSTHGVFEEAIGEICAIIHDNGGQVYIDGANMNAMVGLCAPGKFGGDVSHLNLHK
GCSP_PSESM       IMITYPSTHGVFEEGIREICGIVHDNGGQVYIDGANMNAMVGLCAPGKFGGDVSHLNLHK
GCSP1_PSEAE      LMITYPSTHGVFEEAIREICAIVHDCGGQVYIDGANMNAMVGLCAPGKFGGDVSHLNLHK
GCSP_XANAC       LMITYPSTHGVFEEDVVAICEAVHAHGGQVYTDGANMNALVGVAKPGKWGSDVSHLNLHK
GCSP_XANCP       LMITYPSTHGVFEEDVVAICEAVHAHGGQVYTDGANMNALVGVAKPGKWGSDVSHLNLHK
GCSP_XYLFA       LMVTYPSTHGVFEEAITEICEIVHAHGGQVYTDGANMNALVGVAKPGRWGSDVSHLNLHK
GCSP_XYLFT       LMVTYPSTHGVFEEAITEICEIVHAHGGQVYTDGANMNALVGVAKPGRWGSDVSHLNLHK
GCSP_RALSO       IMITYPSTHGVFEEGVKRVCEIVHSHGGQVYVDGANMNAMVGTAAPGHFGGDVSHLNLHK
GCSP_NOSS1       LMVTYPSTHGVFEAGIQEICAVIHSHGGQVYMDGANMNAQVGICRPGDIGADVCHLNLHK
GCSP_SYNY3       LMVTYPSTHGVFEATIGTICDIVHRFGGEVYMDGANMNAQVGLCRPADFGADVCHLNLHK
GCSP_THEEB       LMITYPSTHGVFETGICQICDIIHRYGGQVYMDGANMNAQVGLCRPGDFGADVCHLNLHK
GCSP_LEPIN       LMITYPSTHGVFEESVKEICQIVHSCGGQVYMDGANMNAQVGLTSPGEIGADVCHLNLHK
GCSP_BACTN       LMITYPSTHGIFETEIKEICEIIHACGAQVYMDGANMNAQVGLTNPGFIGADVCHLNLHK
GCSP_VIBPA       IMITYPSTHGVYEEKVKEVCEMVHAAGGQVYLDGANMNAQVGLTSPGFIGSDVSHLNLHK
GCSP_VIBVU       IMITYPSTHGVYEEQVKEVCEMVHAAGGQVYLDGANMNAQVGLTSPGFIGSDVSHLNLHK
GCSP_DEIRA       LMITYPSTHGVYEENVRDVCDLIHQHGGQVYLDGANMNAMVGVAKPGLIGGDVSHLNLHK
GCSP_ECOLI       IMVTYPSTHGVYEETIREVCEVVHQFGGQVYLDGANMNAQVGITSPGFIGADVSHLNLHK
GCSP_ECOL6       IMVTYPSTHGVYEETIREVCEVVHQFGGQVYLDGANMNAQVGITSPGFIGADVSHLNLHK
GCSP_ECO57       IMVTYPSTHGVYEETIREVCEVVHQFGGQVYLDGANMNAQVGITSPGFIGADVSHLNLHK
GCSP_SALTI       IMVTYPSTHGVYEETIREVCEVVHQFGGQVYLDGANMNAQVGITSPGFIGADVSHLNLHK
GCSP_SALTY       IMVTYPSTHGVYEETIREVCEVVHQFGGQVYLDGANMNAQVGITSPGFIGADVSHLNLHK
GCSP_YERPE       IMVTYPSTHGVYEETIREVCQIVHQFGGQVYLDGANMNAQVGITTPGYIGADVSHLNLHK
GCSP_SHEON       IMITYPSTHGVYEETVREICNIVHQHGGQVYLDGANMNAQVGLTSPGFIGADVSHLNLHK
GCSP2_PSEAE      LMITYPSTHGVYEEGIGEICEVVHRHGGQVYMDGANLNAQVGLARPADIGADVSHMNLHK
GCSP2_PSEPK      LMITYPSTHGVYEEGIREICDVVHQYGGQVYMDGANLNAQVGLARPADIGADVSHMNLHK
GCSP_NEIMA       IMITYPSTHGVYEEGIRDICRIIHENGGQVYMDGANLNAQIGIMQPAEVGADVLHMNLHK
GCSP_TROW8       LMVTYPSTHGVYEDNISEVCSVVHKYGGQVYVDGANSNALIGYLRTGDFGGDVSHLNLHK
GCSP_TROWT       LMVTYPSTHGVYEDNISEVCSVVHKYGGQVYVDGANSNALIGYLRTGDFGGDVSHLNLHK
                  *.*****:*::*     .*   *  *.:** **** ** :.   ..  *.** *:****

GCSP_MYCLE       TFCIPHGGGGPGVGPVAVRSHLVSFLPGHP-----FAPELP-------QGQ---------
GCSP_MYCTU       TFCIPHGGGGPGVGPVAVRAHLAPFLPGHP-----FAPELP-------KGY---------
GCSP_STRAW       TFCIPHGGGGPGVGPVGVRAHLAPYLPNHP-----LQPEAG-------PATG--------
GCSP_STRCO       TFCIPHGGGGPGVGPVGVRSHLAPYLPNHP-----LQPAAG-------PQTG--------
GCSP_BRUME       TFCIPHGGGGPGVGPIGVAKHLVPYLPGH-----VEAGSEH-------------------
GCSP_BRUSU       TFCIPHGGGGPGVGPIGVAKHLVPYLPGH-----VEAGSEH-------------------
GCSP_RHILO       TFCIPHGGGGPGVGPIGVKAHLKPYLPGH-----VTEGSAH-------------------
GCSP_AGRFC       TFCIPHGGGGPGMGPIGVKAHLAPFLPGHP----TTDGRE--------------------
GCSP_RHIME       TFCIPHGGGGPGMGPIGVKSHLAPFLPGHP----QTDGHE--------------------
GCSP_BRADU       TFCIPHGGGGPGMGPIGVKAHLAPFLPGHP----ATRGDAP-------V-----------
GCSP1_PSEPK      TFCIPHGGGGPGVGPIGVKSHLAPFLPG--------HAQLE-------NTQ---------
GCSP_PSESM       TFCIPHGGGGPGVGPIGVKSHLAPFMPG--------HARMQ-------RKE---------
GCSP1_PSEAE      TFCIPHGGGGPGVGPIGVRAHLAPFLPG--------HARGE-------RKE---------
GCSP_XANAC       TFCIPHGGGGPGVGPCAVKSHLAPYLPR----AGIHAGEGQTAAIHGGGFNSESGNGHSS
GCSP_XANCP       TFCIPHGGGGPGVGPCAVKSHLAPFLPKTLPNAGIRAGENQKAAIHGSGSNFGEGE----
GCSP_XYLFA       TFCIPHGGGGPGVGPCAVKAHLAPFLPK------TLPLPGDAAGLPVQGTQEAK------
GCSP_XYLFT       TFCIPHGGGGPGVGPCAVKAHLAPFLPK------TLPLPGDAAGLPVQGTQEAK------
GCSP_RALSO       TFCIPHGGGGPGVGPVAVGAHLAPFLPG-------RAASGE------DASQ--N------
GCSP_NOSS1       TFCIPHGGGGPGMGPIGVASHLVPFLPGHP-----VLESGK-----NPQNI---------
GCSP_SYNY3       TFCIPHGGGGPGMGPIGVKSHLQAFLPRTS-----LNSTAELQA--EDQSI---------
GCSP_THEEB       TFCIPHGGGGPGVGPIGVKAHLAPFLPTTQ-----VIPQGS-------E-T---------
GCSP_LEPIN       TFCIPHGGGGPGVGPIGVAKHLVPFLPGHV-----LVNNAT------GNEH---------
GCSP_BACTN       TFASPHGGGGPGVGPICVAEHLVPFLPGHS-----IFGSTQ-------N-----------
GCSP_VIBPA       TFCIPHGGGGPGMGPIGVKSHLAPFLPGH------IENGVE-------GED---------
GCSP_VIBVU       TFCIPHGGGGPGMGPIGVKSHLAPFLPGH------IENGVE-------GKE---------
GCSP_DEIRA       TFAIPHGGGGPGMGPIGVKAHLAPFLPNHA-----VAPTSD-------SHT---------
GCSP_ECOLI       TFCIPHGGGGPGMGPIGVKAHLAPFVPGHS-----VVQIEGM-----LTRQ---------
GCSP_ECOL6       TFCIPHGGGGPGMGPIGVKAHLAPFVPGHS-----VVQIEGM-----LTRQ---------
GCSP_ECO57       TFCIPHGGGGPGMGPIGVKAHLAPFVPGHS-----VVQIEGM-----LTRQ---------
GCSP_SALTI       TFCIPHGGGGPGMGPIGVKAHLAPFVPGHS-----VVQIEGM-----LTRQ---------
GCSP_SALTY       TFCIPHGGGGPGMGPIGVKAHLAPFVPGHS-----VVQIEGM-----LTRQ---------
GCSP_YERPE       TFCIPHGGGGPGMGPIGVKAHLAPFVPGHS-----VVQIDGM-----TTQQ---------
GCSP_SHEON       TFAIPHGGGGPGMGPIGVKAHLAPFVAGHV-----VVKPGRE-----SDNN---------
GCSP2_PSEAE      TFCIPHGGGGPGMGPIGVKRHLAPFVANHP-----VIRVEGP-----NPLN---------
GCSP2_PSEPK      TFCIPHGGGGPGMGPIGIRAHLKPFVASHP-----VVPVPGL-----DPNN---------
GCSP_NEIMA       TFCIPHGGGGPGMGPIGLKAHLAPFAPGHT-----LTDTHSA-----SAGQ---------
GCSP_TROW8       TFGIPHGGGGPGIGPVVAKAHLAPFLPFRN--RVHKPSTDLP-----AVKHM--------
GCSP_TROWT       TFGIPHGGGGPGIGPVVAKAHLAPFLPFRN--RVHKPSTDLP-----AVKHM--------
                 **  ********:**     ** .: .                                 

GCSP_MYCLE       ----PVSSAPYGSASLLPITWAYIRMMGADGLRTASLTAIASANYIARRLDKYFPVLYTG
GCSP_MYCTU       ----PVSSAPYGSASILPITWAYIRMMGAEGLRAASLTAITSANYIARRLDEYYPVLYTG
GCSP_STRAW       --VGPISAAPWGSAGILPISWSYVRLMGGEGLKRATQVAVLSANYIAKRLEPHYPVLYTG
GCSP_STRCO       --VGPISAAPWGSAGILPISWSYVRLMGGEGLKRATQVAVLSANYIAKRLEPHFPVLYNG
GCSP_BRUME       ----AVAAAQFGSASILVITWMYIRMMGGAGLKKATEAAILNANYIAHRLKGVYPILYTG
GCSP_BRUSU       ----AVAAAQFGSASILVITWMYIRMMGGAGLKKATEAAILNANYIAHRLKGVYPILYTG
GCSP_RHILO       ----AVSAAPFGSASILPITWMYIRMMGAAGLKQATETAIISANYVATRLAPHFPLLYKG
GCSP_AGRFC       ---GAVSAAPFGSPSILPISWSYCLMMGGEGLTQATKVAILNANYIAERLKGAYDVLYKS
GCSP_RHIME       ---GAVSAAPFGSASILPISWSYCLMMGGEGLTQATKVAILNANYVAARLKGAYDVLYKS
GCSP_BRADU       ---GPVSAAPFGSASILTISYIYILMMGGEGLKRATEIAILNANYIAARLDAHFPVLYKN
GCSP1_PSEPK      ---GAVCAAPFGSASILPITWMYIRMMGGAGLKRASQMAILNANYIARRLEEHYPVLYTG
GCSP_PSESM       ---GAVCAAPFGSASILPITWMYIRMMGGEGLKRASQLAILNANYISRRLEEHYPVLYTG
GCSP1_PSEAE      ---GAVSAAPYGSASILPITWMYIRMMGGEGLKRASEMAILNANYIAHRLEEHYPVLYAG
GCSP_XANAC       RIGGMVSAAAYGSASILPISWMYVTMMGSAGLRKATQVALLNANYIAKRLAPHYKTLYTG
GCSP_XANCP       --VGMVSAASYGSASILPISWMYVTMMGSAGLRKATQVALLNANYIAKRLSAHYKTLYTG
GCSP_XYLFA       --VGMVSAANFGSASILPVSWMYITMMGAAGLRKATQVALLNANYIAKRLAPHYKTLYTG
GCSP_XYLFT       --VGMVSAANFGSASILPVSWMYITMMGAAGLRKATQVALLNANYIAKRLAPHYKTLYTG
GCSP_RALSO       --IGAVSAAPFGSASILPISWMYIAMMGAAGLTAATEAAILSANYVARRLSPYYPVLYTG
GCSP_NOSS1       ---GAVAAAPWGSASILVISWMYIVMMGADGLTQATKVAILNANYIAKKLAAYYPVLYKG
GCSP_SYNY3       ---GMISAAPYGSASILVISWMYIAMMGPQGLTKATEVAILSANYMAKRLENYYPILFRG
GCSP_THEEB       ---GPVTAAPWGSASILPISWMYITLMGGVGLTRATAIAILNANYIAKRLEPYYPVLYKG
GCSP_LEPIN       ---GAVSAAPWGSASIVLISWVYIALMGSEGLTNATRNSILNANYIAKRLEKVYPVLYKG
GCSP_BACTN       ----QVSAAPFGSAGILPITYGYIRMMGTEGLTQATKIAILNANYLAACLKDTYGIVYRG
GCSP_VIBPA       ---FAVSAADFGSASILPISWAYIAMMGEAGLSNATKVAILNANYVMERLRPHYPVLYRG
GCSP_VIBVU       ---FAVSAADLGSASILPISWAYIAMMGADGLTEATKVAILNANYVMERLRPHYPVLYRG
GCSP_DEIRA       ---GAVSAAPYGSASILPISYLYIKLLGAAGLRQSTQVALLNANYIAKRLSGAFPVLYSG
GCSP_ECOLI       ---GAVSAAPFGSASILPISWMYIRMMGAEGLKKASQVAILNANYIASRLQDAFPVLYTG
GCSP_ECOL6       ---GAVSAAPFGSASILPISWMYIRMMGAEGLKKASQVAILNANYIASRLQDAFPVLYTG
GCSP_ECO57       ---GAVSAAPFGSASILPISWMYIRMMGAEGLKKASQVAILNANYIASRLQDAFPVLYTG
GCSP_SALTI       ---GAVSAAPFGSASILPISWMYIRMMGAEGLKQASQVAILNANYIASRLKDAYPVLYTG
GCSP_SALTY       ---GAVSAAPFGSASILPISWMYIRMMGAEGLKQASQVAILNANYIASRLKDAYPVLYTG
GCSP_YERPE       ---GAVSAAPFGSASILPISWMYIRMMGADGLKQASQVAILNANYIATRLKNAYPVLYTG
GCSP_SHEON       ---GAVSAAPYGSAGILPISWMYIKLLGSKGLKKSTQTALLNANYVMKKLSEHYPVLFRG
GCSP2_PSEAE      ---DAVSATPWGSASILPISWMYIAMMGPQ-LADASEVAILSANYLANRLDGAFPVLYRG
GCSP2_PSEPK      ---SAVSAAPWGSASILPISWMYIAMMGPQ-LADASEVAILSANYLASQLGAAFPVLYRG
GCSP_NEIMA       ---TAVAAAAYGSASILPITWMYLTMMGKQGMEQATRWALLNANYVAKRLSEDYPILYTG
GCSP_TROW8       --GGPIASSDYGFAGALYISWAYIFCLGSQGMKRCTAVAVLVANYIAKQLSDTFPVLYTG
GCSP_TROWT       --GGPIASSDYGFAGALYISWAYIFCLGSQGMKRCTAVAVLVANYIAKQLSDTFPVLYTG
                      : ::  * .. : ::: *   :*   :  .:  ::  ***:   *   :  :: .

GCSP_MYCLE       ENGMVAHECILDLRPITKSVGVTVDDVAKRLADYGFHAPTMSFPVPGTLMVEPTESESLA
GCSP_MYCTU       ENGMVAHECILDLRGITKLTGITVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESESLA
GCSP_STRAW       PGGLVAHECIIDLRPLTKATGVSVDDIAKRLIDYGFHAPTMSFPVAGTLMIEPTESEDLG
GCSP_STRCO       PGGLVAHECIIDLRPLTKATGVSVDDVAKRLIDYGFHAPTMSFPVAGTLMIEPTESEDLA
GCSP_BRUME       AHDRVAHECIVDTRVLKDSAGITVEDVAKRLIDYGFHAPTMSWPVAGTLMIEPTESEPKL
GCSP_BRUSU       AHDRVAHECIVDTRVLKDSAGITVEDVAKRLIDYGFHAPTMSWPVAGTLMIEPTESEPKL
GCSP_RHILO       RHDRIAHECILDTRVLKESAGISVDDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESEPKR
GCSP_AGRFC       ETGRVAHECIIDTRPLADSCGVTVDDVAKRLIDCGFHAPTMSWPVAGTLMIEPTESETKA
GCSP_RHIME       AKGRVAHECIIDTRPLAESAGVTVDDVAKRLIDCGFHAPTMSWPVAGTLMIEPTESETKA
GCSP_BRADU       ARGRVAHECIVDPRALKTTSGVTVDDIAKRLIDYGFHAPTMSFPVPGTLMIEPTESESKA
GCSP1_PSEPK      GNGLVAHECILDLRPLKDTSGISVDDVAKRLIDFGFHAPTMSFPVAGTLMIEPTESESKE
GCSP_PSESM       TNGLVAHECILDLRPIKDSSGISVDDVAKRLIDFGFHAPTMSFPVAGTLMIEPTESESRE
GCSP1_PSEAE      GNGLVAHECILDLRPLKDSSGISVDDVAKRLMDFGFHAPTMSFPVAGTLMIEPTESESKA
GCSP_XANAC       RNGLVAHECILDVRPLEKTSGIGAEDIAKRLIDFGFHAPTLSFPVAGTLMVEPTESESQH
GCSP_XANCP       RNGLVAHECILDVRPLEKTSGIGAEDIAKRLIDFGFHAPTLSFPVAGTLMVEPTESESQH
GCSP_XYLFA       RHGLVAHECILDVRPLEKVSGVSAEDIAKRLIDFGFHAPTLSFPVAGTLMVEPTESESQQ
GCSP_XYLFT       RHGLVAHECILDVRSLEKVSGVSAEDIAKRLIDFGFHAPTLSFPVAGTLMVEPTESESQQ
GCSP_RALSO       AHGLVAHECILDIRPLQKESGISNEDIAKRLMDFGFHAPTMSFPVPGTLMIEPTESEPKV
GCSP_NOSS1       QNGLVAHECILDLRALKKSANIEIDDIAKRLIDYGFHAPTVSWPVAGTIMVEPTESESQA
GCSP_SYNY3       NNELVAHECILDLRPLKKQAAIEVEDVAKRLMDFGFHAPTVSWPVLGTMMVEPTESESLG
GCSP_THEEB       AHGLVAHECILDLRPLKKSAGIEVEDIAKRLMDYGFHAPTVSWPVPGTLMIEPTESETKA
GCSP_LEPIN       KNGFVAHECILDLRPFKKSAGIEVEDVAKRLIDYGFHAPTMSFPVPGTLMIEPTESESLE
GCSP_BACTN       ATGFVGHEMILECRKVHEETGISENDIAKRLMDYGYHAPTLSFPVHGTLMIEPTESESLA
GCSP_VIBPA       KNGRVAHECIIDIRPLKEETGISEEDIAKRLMDYGFHAPTMSFPVAGTLMVEPTESEDLA
GCSP_VIBVU       TNGRVAHECIIDIRPLKEETGISEEDIAKRLMDYGFHAPTMSFPVAGTLMVEPTESEDLE
GCSP_DEIRA       KGGRVAHECILDIRPLKQESGVSEEDIAKRLMDYGFHAPTMSFPVPGTLMIEPTESEPKA
GCSP_ECOLI       RDGRVAHECILDIRPLKEETGISELDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESESKV
GCSP_ECOL6       RDGRVAHECILDIRPLKEETGISELDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESESKV
GCSP_ECO57       RDGRVAHECILDIRPLKEETGISELDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESESKV
GCSP_SALTI       RDGRVAHECILDIRPLKEETGISELDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESEGKA
GCSP_SALTY       RDGRVAHECILDIRPLKEETGISELDIAKRLIDYGFHAPTMSFPVAGTLMVEPTESEGKA
GCSP_YERPE       HDGRVAHECILDIRPLKEATGISEMDIAKRLIDFGFHAPTMSFPVAGTLMVEPTESESKV
GCSP_SHEON       RNDRVAHECIIDLRPIKEASGVTEMDIAKRLNDYGFHAPTMSFPVAGTLMIEPTESESKV
GCSP2_PSEAE      RNERVAHECILDLRPLKAQTGITEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKA
GCSP2_PSEPK      RNQRVAHECILDLRPLKALTGISEEDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESKA
GCSP_NEIMA       KNGRVAHECIVDLRPLKAESGITETDIAKRLMDYGFHAPTVSFPVAGTLMIEPTESESKA
GCSP_TROW8       KNNLVAHEFIMDFREVTRVSGITVDDVCKRLIDYGFHAPTMSFPVPGTLMVEPTESEPFS
GCSP_TROWT       KNNLVAHEFIMDFREVTRVSGITVDDVCKRLIDYGFHAPTMSFPVPGTLMVEPTESEPFS
                     :.** *:: * .     :   *:.*** * *:****:*:** **:*:******   

GCSP_MYCLE       EIDAFCEAMIAIRGEIARVGAGEWSVEDNPLRGAPHTAECLLASDWD-HPYTREEAAYPL
GCSP_MYCTU       EVDAFCEAMIGIRAEIDKVGAGEWPVDDNPLRGAPHTAQCLLASDWD-HPYTREQAAYPL
GCSP_STRAW       ELDRFCEAMIAIRAEVEKVGSGEWPAEDNPLRNAPHTAAAL-GGEWE-HAYSREEAVFPA
GCSP_STRCO       ELDRFCEAMIAIRAEIEKVGSGAWPADDNPLRGAPHTADAL-GGEWD-HAYTREEAVFPA
GCSP_BRUME       EIDRLCDAMIAIAGEAKKVADGVWPADDNPLANAPHTASDTLATEWK-HPYTREEAVFPG
GCSP_BRUSU       EIDRLCDAMIAIAGEAKKVADGVWPADDNPLANAPHTASDTLATEWK-HPYTREEAVFPG
GCSP_RHILO       ELDRFCEAMIAIAGEAAKVARGDWPLADNPLVNAPHTAAETLAGQWT-HPYSRLEAAYPA
GCSP_AGRFC       EIDRFCDAMLAIREEARDIEEGRADKNNNPLKNAPHTVEDLVGE-WD-RPYSREKGCFPP
GCSP_RHIME       ELDRFCDAMLAIREEARAIEDGRMDKVNNPLKNAPHTVEDLVGD-WD-RPYSREQACFPP
GCSP_BRADU       ELDRFCDAMIAIRKEIGEVEAGRFKIEASPLRHAPHTVHDIADDAWA-RAYSRAEGCFPD
GCSP1_PSEPK      ELDRFCNAMIQIREEIRAVEDGSLDKDDNPLKNAPHTAAELVG-EWT-HGYSREQAVYPL
GCSP_PSESM       ELDRFCDAMIKIREEIRAVEDGTLDKDDNPLKNAPHTAAEIVG-QWS-HPYSREQAVYPV
GCSP1_PSEAE      ELDRFCDAMIRIREEIRAVERGELDKEDNPLKNAPHTAAELLG-EWN-HAYSREQAAYPL
GCSP_XANAC       ELDRFIDAMIQIREEIRAIEDGRLDREDNPLKHAPHTATQVSASEWT-HAYPRELAAFPL
GCSP_XANCP       ELDRFIDAMIQIREEIRAIEDGRLDREDNPLKHAPHTATQVSASEWT-HAYPRELAAFPL
GCSP_XYLFA       ELDRFVDAMIQIRGEIAAIEKGHLDPEDNPLKQAPHTAVQVMASQWG-HAYSRELAAFPL
GCSP_XYLFT       ELDRFVDAMIQIRGEIAAIEKGHLDPEDNPLKQAPHTAVQVMASQWG-HAYSRELAAFPL
GCSP_RALSO       ELDRFIDAMIAIRGEVDQVISGAFDREDNPLKHAPHTAQVVMADDWS-HRYTREQAAYPV
GCSP_NOSS1       ELDRFCEALIAIRQEIADIEAGKVDIQDNSLKNAPHTVESLIVGEWP-HPYSREQAAYPA
GCSP_SYNY3       ELDRFCDAMIAIYQEAQAITHGEIDPADNPLKNAPHTAQSLICGEWN-HPYSQEEAAYPA
GCSP_THEEB       ELDRFCEAMIAIRSEIAEIEAGVSDRQQNPLKNAPHPALMLATEPWP-YPYSREVAAYPA
GCSP_LEPIN       ELDRFCEAMLLIYQEILDVQNGTLDKTDNPLKNSPHTAAMVTSDRWD-HLYPRERAAYPA
GCSP_BACTN       ELDNFVDVMLNIWKEIQEVKNEEADKNDNVLINAPHPEYEIVNDNWE-HSYTREKAAYPI
GCSP_VIBPA       ELNRFCDAMISIREEMTKVKNGEWPLENNPLVNAPHTQVDLSAEEWD-RPYSRELGCFPS
GCSP_VIBVU       ELDRFCDAMIAIREEMTKVKNGEWPLENNPLVNAPHTQVDLMEEQWD-RPYPREIACFPS
GCSP_DEIRA       ELDRFVDAMLNIRREIQDVQDGTISAADSPLKHAPHTLKDLMDSEWT-RAYSRETGAFPS
GCSP_ECOLI       ELDRFIDAMLAIRAEIDQVKAGVWPLEDNPLVNAPHIQSELVAEWA--HPYSREVAVFPA
GCSP_ECOL6       ELDRFIDAMLAIRAEIDQVKAGVWPLEDNPLVNAPHIQSELVAEWA--HPYSREVAVFPA
GCSP_ECO57       ELDRFIDAMLAIRAEIDQVKAGVWPLEDNPLVNAPHIQSELVAEWA--HPYSREVAVFPA
GCSP_SALTI       ELDRFIDAMLAIRAEIDQVKAGVWPLEDNPLVNAPHIQSELVAEWA--HPYSREVAVFPA
GCSP_SALTY       ELDRFIDAMLAIRAEIDQVKAGVWPLEDNPLVNAPHIQSELVAEWA--HPYSREVAVFPA
GCSP_YERPE       ELDRFIDAMLAIRAEIEKVAQGEWPLEDNPLVNAPHTQAELVGEWT--HPYSRELAVFPV
GCSP_SHEON       ELDRFIDAMVSIRAEIAKVEAGEWPADNNPLHNAPHTMADIMDSAFDSRPYSREVAVFPS
GCSP2_PSEAE      ELDRFVEAMLSIRAEIGKVESGAWPAEDNPLKRAPHTLADVTGIWQ--RPYEIAEAVTPS
GCSP2_PSEPK      ELDRFVEAMLAIRAEIDEVQQGNWPAENNPLKHAPHTLADVLGVWD--RPYSLEQAVAPS
GCSP_NEIMA       ELDRFIATLKSIRREVQKVIDGEWPKDDNPLVNAPHTAADITGNWA--HPYSREEAVFPL
GCSP_TROW8       EIQRFIKTIRSIRAEIDRVIDKTYDPDNNPLKRAPHTLEQIASDKWD-RPYSRRTGIVYT
GCSP_TROWT       EIQRFIKTIRSIRAEIDRVIDKTYDPDNNPLKRAPHTLEQIASDKWD-RPYSRRTGIVYT
                 *:: :  .:  *  *   :         . *  :**              *    .    

GCSP_MYCLE       GKA-FRPKVWPPVRRIDGVYGDRNLVCSCLPVEAFV------------------
GCSP_MYCTU       GTA-FRPKVWPAVRRIDGAYGDRNLVCSCPPVEAFA------------------
GCSP_STRAW       GVS-AADKYWPPVRRIDQAFGDRNLVCSCPPLDAYDD-----------------
GCSP_STRCO       GVS-AADKYWPPVRRIDQAYGDRNLVCSCPPLDAYED-----------------
GCSP_BRUME       GAFDPTAKYWPPVSRVDNVGGDRNLICSCPPVAAYG------------------
GCSP_BRUSU       GAFDPTAKYWPPVSRVDNVGGDRNLICSCPPVAAYG------------------
GCSP_RHILO       GDADTAAKYWPPVSRIDNVAGDRNLVCSCPPLSDYLGAAE--------------
GCSP_AGRFC       GAF-RIDKYWSPVNRIDNVYGDRNLICTCPPMEAYAEAAE--------------
GCSP_RHIME       GAF-RVDKYWSPVNRVDNVYGDRNLVCTCPPIESYAEAAE--------------
GCSP_BRADU       GVS-RTDKYWSPVGRVDNVYGDRNLVCSCPPVSDYAEAAE--------------
GCSP1_PSEPK      ASL-VEGKYWPPVGRVDNVFGDRNLVCACPSIESYQDA----------------
GCSP_PSESM       DSL-IENKYWPPVGRVDNVFGDRNLVCACPSIESYQEA----------------
GCSP1_PSEAE      ASL-VEAKYWPPVGRVDNVYGDRNLTCSCPPIEAYSEE----------------
GCSP_XANAC       PSL-KQQKYWPPVARVDNVYGDKNVMCACIPVDAYKEDAEA-------------
GCSP_XANCP       PSL-KQQKYWPPVGRVDNVYGDKNVMCACIPVDAYKDDVVA-------------
GCSP_XYLFA       GVL-HHAKYWPPVARVDNVYGDKHVMCACIPVEAYKEKEDSEIQHLIEEDASRC
GCSP_XYLFT       GVL-HHAKYWPPVARVDNVYGDKHVMCACIPVEAYKEKGDSEIQDLIEEDASRC
GCSP_RALSO       ASL-RTRKYWPPVGRADNVYGDRNLFCACVPMSEYAQD----------------
GCSP_NOSS1       PWT-REHKFWPSVGRIDAAFGDRNFVCSCLPMDAYN------------------
GCSP_SYNY3       PWT-KQFKFWPAVGRINNTYGDRHLVCSCEGMEAYKEG----------------
GCSP_THEEB       PWL-REYKFWPAVARIDNAYGDRHLVCTCSMPLTN-------------------
GCSP_LEPIN       SWL-KDHKFWPYVGRVDNVYGDRNLVCSCLPIESYQ------------------
GCSP_BACTN       ESV-RENKFWVNVARVDNTLGDRKLLPTRYGTFE--------------------
GCSP_VIBPA       KAT-KSWKYWPTVNRVDNVYGDRNLICSCPSIDNYED-----------------
GCSP_VIBVU       AAT-KRSKYWPTVNRVDNVYGDRNLVCSCPGIENYEE-----------------
GCSP_DEIRA       AAQ-KAWKYWPAVNRVDNVYGDRNFVCSCPPIEDYIGA----------------
GCSP_ECOLI       G---VADKYWPTVKRLDDVYGDRNLFCSCVPISEYQ------------------
GCSP_ECOL6       G---VADKYWPTVKRLDDVYGDRNLFCSCVPISEYQ------------------
GCSP_ECO57       G---VADKYWPTVKRLDDVYGDRNLFCSCVPISEYQ------------------
GCSP_SALTI       G---VADKYWPTVKRLDDVYGDRNLFCSCVPISDYQ------------------
GCSP_SALTY       G---VADKYWPTVKRLDDVYGDRNLFCSCVPISDYQ------------------
GCSP_YERPE       AGV-LENKYWPTVKRLDDVYGDRNLFCSCVPISDYE------------------
GCSP_SHEON       AAV-RTNKFWPTVNRIDDVYGDRNLFCACVPLSDYE------------------
GCSP2_PSEAE      EHA-RAFKYWPAVNRVDNVYGDRNLFCACVPLDDYRE-----------------
GCSP2_PSEPK      AHV-RQHKYWPAVNRVDNVYGDRNLFCACVPVEAYR------------------
GCSP_NEIMA       PFV-REHKFWPFVNRVDDVYGDRNLVCSCPPMENYED-----------------
GCSP_TROW8       S-----GKYWPASARIDNAYGDRNIFCTCPDLPD--------------------
GCSP_TROWT       S-----GKYWPASARIDNAYGDRNIFCTCPDLPD--------------------
                        * *    * : . **::.  :