CLUSTAL format seed alignment for MF_00713

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GCSPB_AQUAE      --------------------------------MELIFEKS--KKGRKGYKLPELDVEEVN
GCSPB_CHLTE      ------------------------------MKEQLIFDLS--RSGRKGYSLSPLDIPERP
GCSPB_BACAN      ---------------------------MKNQDQALIFEVS--KEGRIGYSLPKLDVEEVK
GCSPB_BACCR      ---------------------------MKNQDQALIFEVS--KEGRIGYSLPKLDVEEVK
GCSPB_BACSU      ---------------------------MSNQDQALIFELS--REGRIGYSLPELDVPEIE
GCSPB_BACHD      ---------------------------MMNKDQALIFELS--KPGRVGHSLPELDVLEQP
GCSPB_LISIN      --------------------------MNLEETMPLVFERS--IPGRIGFSLPESDVPETN
GCSPB_LISMO      --------------------------MNLEETMPLVFERS--IPGRIGFSLPESDVPETN
GCSPB_OCEIH      ---------------------------MSNKNFPLIFERS--KEGRTSYSLPELDVESFD
GCSPB_STAAM      ---------------------------MTSKSSPLIFERS--REGRYAYSLPKSDIKTNS
GCSPB_STAAW      ---------------------------MTSKSSPLIFERS--REGRYAYSLPKSDIKTNS
GCSPB_STAES      ---------------------------MISKSSPLIFERS--KKDRYAYSLPQNDIENIS
GCSPB_CALS4      ---------------------------MLKEYNSLIFELS--KEGKKAYTLPPLDVEEKP
GCSPB_THEMA      ---------------------------------MTIFERS--KKGRKAFRLPESDIPEY-
GCSPB_PYRAB      ------------------------MYRQAKWDEPLIFELS--RPGRVGYTLPKPIEDVDV
GCSPB_PYRHO      ------------------------MYRQARWDEPLIFELS--RPGRVGYTLPKPIEDVKV
GCSPB_PYRFU      ------------------------MFRQAKWDEPLIFELS--RPGRVGYTLPKPIEDIKV
GCSPB_THEAC      -----------------------MEFRQAYYDEPLIKDIK--SDT--SFKLSEDVDENL-
GCSPB_THEVO      -----------------------MNFKQAYYEEPIIKDIK--SSN--TFSLSEQVDESI-
GCSPB_COXBU      ---------------------------------MLIFEKS--RKNRR-----TLAHAIAD
GCSPB_NITEU      ---------------------------------MLIFEHS--RKNRR-----NYSQAPAT
GCSPB_SACS2      ------------------------MWRQAKWNEPLIFELNKSGAARQGFLINK-DEEIRS
GCSPB_SULTO      -----------------------MSWHQAVWNEPLIFEYK--GKGRIGFKIPE-EEELKK
GCSPB_AERPE      ------------------------MWRQSRWNEPLITEMS--RRGRRGALPPRPDEKVVK
GCSPB_HALSA      ----------------------------MEHYEQARYAPA---EGETNEPLLSENDQTTV
GCSPB_CAUVC      MNNVGRPTRPEAANDAANGHETLTGARGLLQDEALIFELD--GWNKTGVDLPPVTAAPSS
                                                                             

GCSPB_AQUAE      -IKEY-LPEEYLREE-LDFPEVSELDVVRHYTNLSHLNYAVDTTMVPLGSCTMKYNPRIN
GCSPB_CHLTE      -ADEL-LPSKFLRKEPAELPEMAESEVVRHFIRLSNLNYHVDKNMYPLGSCTMKYNPKIN
GCSPB_BACAN      -LEDV-FESDYIRVEDAELPEVSELDIMRHYTALSNRNHGVDSGFYPLGSCTMKYNPKIN
GCSPB_BACCR      -LEDV-FESDYIRVEDAELPEVSELDIMRHYTALSNRNHGVDSGFYPLGSCTMKYNPKIN
GCSPB_BACSU      -LGDL-LSDTYIRDEDAALPEVSELDIMRHYTALSKRNHGVDSGFYPLGSCTMKYNPKIN
GCSPB_BACHD      -VETL-IPAEFLREEAPELPEVSELQLMRHYTALSKRNHGVDSGFYPLGSCTMKYNPKIN
GCSPB_LISIN      -AGDY-FDEAYLRSTPADLPELSELEIMRHYTNLSNHNFGVDSGFYPLGSCTMKYNPKIN
GCSPB_LISMO      -AGDY-FDQAYIRSIPADLPELSELEIMRHYTNLSNHNFGVDSGFYPLGSCTMKYNPKIN
GCSPB_OCEIH      -LEAE-LGSEYVRQTPPELPEVSELDIIRHYTGLSNRNYGVDSGFYPLGSCTMKYNPKIN
GCSPB_STAAM      -VESL-LDDKFIRKNKAEFPEVAELDLVRHYTELSNKNFGVDNGFYPLGSCTMKYNPKIN
GCSPB_STAAW      -VESL-LDDKFIRKNKAEFPEVAELDLVRHYTELSNKNFGVDNGFYPLGSCTMKYNPKIN
GCSPB_STAES      -IASL-LDDKYIRKHKAEFPEVSELDLVRHYTELSNKNFGVDTGFYPLGSCTMKYNPKIN
GCSPB_CALS4      -LEDM-LPKEMLREKEVDLPEVSEVDVIRHYTLLSQKNYGVDIGFYPLGSCTMKYNPKIN
GCSPB_THEMA      ---S--LPDRFLRRTPPELPEVSEPDLVRHYTNLARKNYSVDLGIYPLGSCTMKYNPKLN
GCSPB_PYRAB      E-----IPEKLKRKSPLNLPEVSEPEVVKHYTRLSEMNYGVDSGIYPLGSCTMKYNPKIN
GCSPB_PYRHO      E-----IPEKLKRKTPLELPEVSEPEVVKHYTRLSEMNYGVDSGIYPLGSCTMKYNPKIN
GCSPB_PYRFU      D-----IPEKLRRKSKLELPELSEPEIVKHYTRLSEMNYGVDSGIYPLGSCTMKYNPKIN
GCSPB_THEAC      ------LPQDMRRTD-LKLPQVSEVDVVRHYTRLSQMNYTVDVGIYPLGSCTMKYNPKYA
GCSPB_THEVO      ------LPENLKRKD-LELPEVSEYDVVRHYTRLSQMNYTVDVGIYPLGSCTMKYNPKFA
GCSPB_COXBU      KMDANDIPANLLRHDAPRLPELSELEVVRHFTRLSTQNFSIDTHFYPLGSCTMKYNPRAA
GCSPB_NITEU      RPAKNNIPDHLKRKSTPLLPEVSEMDTVRHYTRLSQKNFSIDTEFYPLGSCTMKYNPRAC
GCSPB_SACS2      QIKEMKIPKNLLRENEPDLPSLSELEVVRHFVRLSQMNFGVDIGIMPLGSCTMKYNPKIE
GCSPB_SULTO      EI-SINIPEKLRRK-EIDLPELSELEVIRHFIRLSQMSFGVDNGMVPLGSCTMKYNPKIE
GCSPB_AERPE      EVGPLKLPQSLARGSPPSLPEVSEVEVVRHYTRLSQMAYGVDNGPVPLGSCTMKYNPRVA
GCSPB_HALSA      SVDPS-LPDDLTRDT-VELPSLEEPELARHYVRLSQQNYGVDSGPYPLGSCTMKYNPRFT
GCSPB_CAUVC      ------DLNGLLRDAPIGLPGLSEPETVRHYVRLSQKNHAIDLALYPLGSCTMKHNPRLN
                             *     :* : * :  :*:  *:   . :*    ********:**:  

GCSPB_AQUAE      EELVNKKEFLNVHPLTPEEYIQPLLKLVYELKELLKELGGFAEVSLQPAAGAHGELLGLL
GCSPB_CHLTE      DYTCDLPGFASMHPLQPESTSQGALQLMYELAEMLKEIAGMKAVTLQPAAGAHGELTGIL
GCSPB_BACAN      ESVARFAGFANIHPLQDEKTVQGAMELMYDLQEHLIEITGMDTVTLQPAAGAHGEWTGLM
GCSPB_BACCR      ESVARFAGFANIHPLQDEKTVQGAMELMYDLQEHLIEITGMDTVTLQPAAGAHGEWTGLM
GCSPB_BACSU      EKIARIPGFAAIHPLQDEDTVQGALELLYDLSKHLEEITGMDEVTLQPAAGAHGEWTGLM
GCSPB_BACHD      EDVARYPGFANIHPYQPEAQVQGALRLMYELQTALAEITGMDEVTLQPAAGAQGEWTGLM
GCSPB_LISIN      EKVARFPGFANIHPNQPESSVQGALELLYDLQTSLVEITGMDEVTLQPAAGAHGEWTGLM
GCSPB_LISMO      EKVARFPGFANIHPNQPESSVQGALELLYDLQTSLVEITGMDEVTLQPAAGAHGEWTGLM
GCSPB_OCEIH      EDIARLDGFSHIHPYQDVSTVQGAMAMMFDLQESLKEITGMHEVSLQSAAGAQGEWTALM
GCSPB_STAAM      EKVARIPGFSESHPLQDEDQVQGSLEIIYSLQEELKEITGMDEVTLQPAAGAHGEWTALM
GCSPB_STAAW      EKVARIPGFSESHPLQDEDQVQGSLEIIYSLQEELKEITGMDEVTLQPAAGAHGEWTALM
GCSPB_STAES      EKVARISGFSESHPLQEEEHVQGSLEIIYSLQEELKEITGMDEVTLQPAAGAHGEWTALM
GCSPB_CALS4      EDMASLPGFTELHPYQPEETVQGALKLMYELEKALCEITGMDRFSLHPAAGAHGELTGLM
GCSPB_THEMA      EKAANLEGFREIHPYQPVETVQGSLRLMYELKKMLCEITGMDDMTLQPAAGAHGELTGML
GCSPB_PYRAB      EELAGHPKVAYIHPYQDERTVQGALRIMWELEQWLKEITGMDRFTLQPAAGANGEFTGVM
GCSPB_PYRHO      EEIANHPKVAFIHPYQDERTVQGALKIMWELEQWLKEITGMDRFTLQPAAGANGEFTGVM
GCSPB_PYRFU      EEIATHPKVAYIHPYQDERTVQGALAIMWELEQWLKEITGMDRFTLQPAAGANGEFTGVM
GCSPB_THEAC      DRIASFAEFRNIHPFQPESTVQGTLQIMYELQEFLKKISDMDAVTLQPMAGADGEFTGIL
GCSPB_THEVO      DRVSAIDGFRNIHPFQPENTVQGALHVMYDLQEYLKKISDMDAVSLQPMAGADGEFTGIL
GCSPB_COXBU      NRLASLPGYLKRHPLSPAPQSQAFLQCLYELQTMLTEITGMEKISLTSMAGAQGEFAGVA
GCSPB_NITEU      NSLAMLPQFLSRHPLAPEDTGQGFLACMYELQEILKDITGMAAVSLTSMAGAQGELIGIT
GCSPB_SACS2      EKA--TAITEFHHPLEDEDYIQGILEMIYELQNWFSEITGMDECSLQVPAGSAGEFAGVL
GCSPB_SULTO      EEA--ELLTQNLHPLQDDSTVQGILEVLYYMQKWLAEITGMDLCSLQVPAGAAGELAGVL
GCSPB_AERPE      ARLAFDPRLETLHPLQDDETVQGVLEAIYMVQEWLRHITGMDACTVHPAAGSQGELAGVL
GCSPB_HALSA      EDAAALP-AAAVHPDRSETALQGTLAVMHDLQDYLGRIGGMDAVTLQPPAGAAGEFTGIL
GCSPB_CAUVC      EKMARLPGFSDIHPLQPQSTVQGALELMDRLAHWLKTLTGMPAVALTPKAGAHGELCGLL
                             **       *  :  :  :   :  : .:   ::   **: **  .: 

GCSPB_AQUAE      LIHAYHQDRGNKE-KKVVLIPDSAHGTNPASAAICGFDIKVVKSDKKGELDFEDFIKKLD
GCSPB_CHLTE      LIKKYHEKLGNK--RHKLLVVDSAHGTNPASAALGGYECVSVKCDESGCTDMGDLRAKLD
GCSPB_BACAN      LIRAYHEANGDFN-RTKVIVPDSAHGTNPASATVAGFETITVKSNEHGLVDLEDLKRVVN
GCSPB_BACCR      LIRAYHEANGDFN-RTKVIVPDSAHGTNPASATVAGFETITVKSNENGLVDLEDLKRVVN
GCSPB_BACSU      MIRAYHEARGDFK-RTKVIVPDSAHGTNPASATVAGFETVTVKSNEKGLVDLEDLKRAVN
GCSPB_BACHD      LIRAYHEANGDTN-RTKVIVPDSAHGTNPASATVAGFESVTVRTDEDGLVDLDHLREVVG
GCSPB_LISIN      LIRAFHEKNGDTK-RTKVIIPDSAHGTNPASAAVAGFDVVTVKSNEKGLVDVADLKKVVG
GCSPB_LISMO      LIRAFHEKNGDTK-RTKVIIPDSAHGTNPASAAVAGFDVVTVKSNEKGLVDVADLKKVVG
GCSPB_OCEIH      MIRAFHESRGDYG-RTKVIVPDSAHGTNPASAAVAGFEAVTVKSNQEGLVDLDDLRQVVG
GCSPB_STAAM      IFKAYHENNGEGH-RDEVIVPDSAHGTNPASASFAGFKSVTVKSNERGEVDIDDLKRVVN
GCSPB_STAAW      IFKAYHENNGEGH-RDEVIVPDSAHGTNPASASFAGFKSVTVKSNERGEVDIDDLKRVVN
GCSPB_STAES      IFKAYHEKNGQSH-RDEVIVPDSAHGTNPASASFAGFKSVTVKSNQRGEVDIEDLKRVVN
GCSPB_CALS4      IIKAYHEHRNDKK-RKKIIVPDSAHGTNPASAAVAGFDVIEIKSNKEGAIDLEALKAVLN
GCSPB_THEMA      IVREYFKNRGDTG-RKKVLVPDSAHGTNPASASMVGFEVVEIKS-KNGMVDVEDLKKLLD
GCSPB_PYRAB      IIKAYHLDRGETQ-RNEMLVPDSAHGTNPASAAMAGFKVIEIPSNENGTVDLEALENAVS
GCSPB_PYRHO      IIKAYHLDRGDTQ-RTEILVPDSAHGTNPASASMAGFKVVEIPSNENGTVDLEALENAVS
GCSPB_PYRFU      IIRAYHLDNGEPQ-RNEMLVPDSAHGTNPASAAMAGFKVIEIPSNENGTIDLEALENAVS
GCSPB_THEAC      IIKKYFEDLHE-D-RTEIIVPDSAHGTNPASATMGGFDVVEIPSNSEGMVDLNALKAAIS
GCSPB_THEVO      IVKKYFEDKGE-D-RTEIIIPDSAHGTNPASATMGGFDVVEVPSDDKGMVDLEALRAAVS
GCSPB_COXBU      MIKAYHESRGDYD-RTEMIVPDAAHGTNPASAAMCGFTVKEISTTKDGDIDLEKLRQMAG
GCSPB_NITEU      MIRAYHEAHGDTG-RTEIIIPDAAHGTNPATAVMCGYKVIEIPTNRDGDVDMDALKAAVG
GCSPB_SACS2      MIKKYHEEHNRNY-KDTILVADTAHGTNPASAAMAGYKVMYVKSNAEGLVDMDILREIVN
GCSPB_SULTO      MIKKYHETKGRGN-RDEMLVADTAHGTNPASASMENFKVIYIKSNSEGLVDVDILKEIVS
GCSPB_AERPE      MIKRFHEMRGDLDKRRVIIVPDSAHGTNPASAAMGGFQVVEVPTGDDGNVDMEALKAAVG
GCSPB_HALSA      IAEAYHEATDGGH-RNEVIVPDAAHGTNFASAALGGYDVIELPSGDDGRVDLDALEAALG
GCSPB_CAUVC      AIRAAHEAAGNGH-RKTVLAPTSAHGTNPATAAFVGYTVVEIAQTEDGRVDLADLESKLG
                   .  .        :  ::   :***** *:* . .:    :     *  *.  :    .

GCSPB_AQUAE      ERVAALMITNPNTLGIFERKIKEIAEELHKRDALLYMDGANFNALVGRFKPGEWGVDVMH
GCSPB_CHLTE      GEVAALMLTNPNTVGIFEKQIPEIEKLVHGNGSLLYMDGANMNALLGITRPGDMGFDVMH
GCSPB_BACAN      EETAALMLTNPNTLGLFEENILEMAEIVHNAGGKLYYDGANLNAVLSQARPGDMGFDVVH
GCSPB_BACCR      EETAALMLTNPNTLGLFEENILEMAEIVHNAGGKLYYDGANLNAVLSQARPGDMGFDVVH
GCSPB_BACSU      EETAALMLTNPNTLGLFEEQITEMAEIVHQAGGKLYYDGANLNAVLSKARPGDMGFDVVH
GCSPB_BACHD      EDTAALMLTNPNTLGLFEAHIVEMAAIIHEAGGKLYYDGANSNAILGIARPGDMGFDVVH
GCSPB_LISIN      EDTAALMLTNPNTLGLFEKDIVEMAEIVHAAGGKLYYDGANLNAIMAKVRPGDMGFDVVH
GCSPB_LISMO      EDTAALMLTNPNTLGLFEKDIVEMAEIVHEAGGKLYYDGANLNAIMAKVRPGDMGFDVVH
GCSPB_OCEIH      EDTAALMLTNPNTLGLFEKDILTMAEIVHEAGGKLYYDGANLNAIMGYVRPGDMGFDAVH
GCSPB_STAAM      ENTAAIMLTNPNTLGIFEKNIMEIREIVHNAGGLLYYDGANLNAIMDKVRPGDMGFDAVH
GCSPB_STAAW      ENTAAIMLTNPNTLGIFEKNIMEIREIVHNAGGLLYYDGANLNAIMDKVRPGDMGFDAVH
GCSPB_STAES      DNTAAIMLTNPNTLGIFEQNIIEIGKIVHEAGGLLYYDGANLNAILDKVRPGDMGFDAVH
GCSPB_CALS4      DEVAGLMLTNPSTLGLFEENIVEIARLVHEAGGLLYYDGANLNAIMGISRPGDMGFDVVH
GCSPB_THEMA      EEVAAVMLTNPNTLGLFEKDILKIAEMTHECGALLYYDGANLNAIMGKVRPGDMGFDIVH
GCSPB_PYRAB      ERTAGLMLTNPNTLGIFEDEIEEIAKIVHKAGGLLYYDGANLNGILGKVRPGDMGFDIVH
GCSPB_PYRHO      ERTAGLMLTNPNTLGIFEDEIEEIAKIVHKVGGLLYYDGANLNGILGKVRPGDMGFDIVH
GCSPB_PYRFU      ERTAGLMLTNPNTLGIFEDEIVEIAKIIHKAGGLLYYDGANLNGILGKIRPGDMGFDIVH
GCSPB_THEAC      KKTAALMITNPNTLGIFEQNITEIAKILHDAGALLYYDGANLNAIFGITSPGLMGFDIVH
GCSPB_THEVO      KKTAAFMITNPNTLGIFEQNIEEIAKIIHNAGALLYYDGANLNAIFGITSPGLMGFDIVH
GCSPB_COXBU      AKTAGIMLTNPSTLGVFERQISEVAKIIHNAGGLLYYDGANLNAILGKYRPGDMGFDVMH
GCSPB_NITEU      PKTAGLMLTNPSTLGVFEKKVAEMSRIVHAAGGLLYYDGANLNAVLGKVKPGDMGFDVIH
GCSPB_SACS2      DKTAGFMLTNPNTLGLFEENILEISKIIHSTNAVLYYDGANLNGVLGIARPGDMGFDIVH
GCSPB_SULTO      ERTAGFMLTNPNTLGLFEENILDIAKYIHSVDAKLYYDGANLNGILGVVRPGDMGFDIVH
GCSPB_AERPE      GDTAGLMITNPSTLGLFEENILEISRLVHEAGGLLYYDGANLNGIIGRARPGDMEFDIAH
GCSPB_HALSA      ENTAALMLTNPNTLGLFERDIEPIAEMVHDAGGLLYYDGANLNALLGRARPGDMGFDIMH
GCSPB_CAUVC      DHVAAIMVTNPNTCGLFERDVVEIARLTHAAGAYFYCDGANFNAIVGRVRPGDLGVDAMH
                   .*..*:***.* *:** .:  :    *  .. :* **** *.:.    **   .*  *

GCSPB_AQUAE      FNLHKTFSTPHGGGGPGAGPVGVSE-------RLKPYLPVPQIEYDGK----KYYLNWNI
GCSPB_CHLTE      YNLHKTFSAPHGGGGPGSGPVGVSE-------RLVEFLPVPVIEKFEKDGQTRYRLNSSK
GCSPB_BACAN      LNLHKTFTGPHGGGGPGSGPVGVKA-------DLIPYLPKPILEKTEN----GYHFNYDR
GCSPB_BACCR      LNLHKTFTGPHGGGGPGSGPVGVKA-------DLIPYLPKPILEKTES----GYHFNYDR
GCSPB_BACSU      LNLHKTFTGPHGGGGPGSGPVGVKQ-------DLIPYLPKPVLVKKEG----RFTFDYDR
GCSPB_BACHD      LNLHKTFTGPHGGGGPGSGPVGVKK-------ELIPYLPKPVVVKDGD----SYRLDYDR
GCSPB_LISIN      LNLHKTFTGPHGGGGPGSGPIGVKK-------ELIPFLPTPVLTKKDD----AYTFDYNY
GCSPB_LISMO      LNLHKTFTGPHGGGGPGSGPIGVKK-------ELIPFLPTPVLTKKED----IYTFDYNY
GCSPB_OCEIH      LNLHKTFTGPHGGGGPGSGPVGVSE-------ELAAFLPKPLIVKKND----GYDFDENR
GCSPB_STAAM      LNLHKTFTGPHGGGGPGSGPVGVVK-------ELASYLPKPMVIKDGD----KFKYDNDI
GCSPB_STAAW      LNLHKTFTGPHGGGGPGSGPVGVVK-------ELASYLPKPMVIKDGD----KFKYDNDI
GCSPB_STAES      LNLHKTFTGPHGGGGPGSGPVGVVE-------KLASYLPKPMVIKDND----RYKYDNDI
GCSPB_CALS4      LNLHKTFSTPHGGGGPGSGPVGVKK-------ELADFLPVPTVEEKDG----RYFLDYDR
GCSPB_THEMA      LNLHKTFSTPHGMGGPGSGPVGVKK-------HLVDFLPFPQVKKNGE----LYEL-FVP
GCSPB_PYRAB      LNLHKTFSTPHGGGGPGAGPVGVKE-------FLKDYLPVPLVSYDEE--NDRYYLDYDV
GCSPB_PYRHO      LNLHKTFSTPHGGGGPGAGPVGVKE-------FLKDYLPVPLVSYDEE--NDRYYLDYNV
GCSPB_PYRFU      LNLHKTFSTPHGGGGPGAGPVGVKE-------FLKDYLPVPLVSYDEK--SGRYYLDYNV
GCSPB_THEAC      FNLHKSFATPHGGGGPGAGPVAVKS-------FLSDFLPVPVVGYD----GKRYFLDYGK
GCSPB_THEVO      FNLHKSFATPHGGGGPGAGPVAVKS-------FLKDFLPVPIVDFD----GNSYRLNYEL
GCSPB_COXBU      LNLHKTFATPHGGGGPGAGPVAAGP-------RLSKFLPVPMVG--KN--KEGYDWLTEK
GCSPB_NITEU      MNLHKTFSTPHGGGGPGAAPVGVAE-------RLLPYLPVPIVA--HE--QGVYRWLTEE
GCSPB_SACS2      LNLHKTFAVPHGGGGPGAGAICAKG-------ELVNYLPYPMVE--KV--NGKYKLSKIP
GCSPB_SULTO      LNLHKTFAVPHGGGGPGAGAICAKG-------EMVNFLPYPLVE--KK--DGKYSLSYIP
GCSPB_AERPE      VNLHKTFSVPHGGGGPGSGPVCVKRVEVVDGVTLEDLLPGPRVVYSRE--EGLYRVRPPG
GCSPB_HALSA      FNVHKTFATPHGGGGPGAGPVGVTD-------ELAGFLPDPHVRQSAG---GDYELYTP-
GCSPB_CAUVC      INLHKTFSTPHGGGGPGAGPVVLSE-------ALAPFAPTPWLTHGDN----GFELAEHA
                  *:**:*: *** ****:..:            :    * * :          :      

GCSPB_AQUAE      ---EK--SVGKILAFHGHFLVWLKALAYILTYGKD-IKKVSEYAVLNARYLKHLLKGV--
GCSPB_CHLTE      ---PN--TIGRMMNFYGNFSVLVRAYTYIRMLGADGLRRVSENAIINANYLLQRLVEH--
GCSPB_BACAN      ---PE--AIGRVKPFYGNFGINVRAYTYIRSMGPDGLRAVTEYAVLNANYMMRRLAPF--
GCSPB_BACCR      ---PE--AIGRVKPFYGNFGINVRAYTYIRSMGPDGLRAVTEYAVLNANYMMRRLAPF--
GCSPB_BACSU      ---PH--AIGRVKPYYGNFGINVRAYTYIRSMGPDGLKAVTENAVLNANYMMRKLAPY--
GCSPB_BACHD      ---PH--SIGRVKPYYGNFGINVRAYTYIRTMGPEGLRTVSEYAVLNANYMMRRLAPY--
GCSPB_LISIN      ---PD--SIGRVKPYYGNFGINVRAYTYIRTMGPDGLKLVTEYAVLNANYMMRKLQDA--
GCSPB_LISMO      ---PD--SIGRVKPYYGNFGINVRAYTYIRTMGPDGLKLVTEYAVLNANYMMRKLQEA--
GCSPB_OCEIH      ---PQ--SIGRVKPFYGNFGINLRAYTYIRTMGAEGLKKVSEYAVLNANYMMRQLEDV--
GCSPB_STAAM      ---KN--SIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNANYIKARLSEH--
GCSPB_STAAW      ---KN--SIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNANYIKARLSKH--
GCSPB_STAES      ---PN--SIGRVKPFYGNFGIYLRAYTYIRSMGANGLKEVSEAAVLNANYIKSRLKNH--
GCSPB_CALS4      ---PL--SIGKVRSFYGNFNVMIKAYSYILTMGAEGLKRASELAVLNANYLKEKLKGY--
GCSPB_THEMA      ---EK--TIGRVRSFFGNFPVLVKAYTYILTMGRDGLERVSEMAVLNANYLKKKIEKF--
GCSPB_PYRAB      ---PK--SIGKVKELFGNFAVLVRALTYLKVMGKDGLREVSEVAVLNANYLARKLKGTRG
GCSPB_PYRHO      ---PK--SIGKVKELFGNFAVLVKALTYLKIMGKEGLREVSEVAVLNANYLARKLKGTRG
GCSPB_PYRFU      ---PK--SIGKVKELYGNFAVLVRALTYLKIMGRDGLREVSEIAVLNANYLTQKLKGTRG
GCSPB_THEAC      ---KK--SIGRVSSFYGSFSILLRAWSYVIRNGDDGLKNATIRAVLNSNYLKKKVEGY--
GCSPB_THEVO      ---KK--TIGKVSSFYGSFSILLRAWSYIIRNGDDGLKNVSARAVLNSNYLKKKLEKY--
GCSPB_COXBU      ---ECPKSIGRLSAFMGNSGVLLRAYIYLRLLGKEGLSRVAEFSTLNANYLMKRLEQL-G
GCSPB_NITEU      ---DRPQTIGRLSAHMGNAGVLLRAYIYVRLLGAEGMHRISEYATLNANYLMAELRKL-G
GCSPB_SACS2      ---KN--SIGKIATFYGNVGNLARSFAYILGLGPQGIQMIGKMSTLATNYLIAKLRDVKE
GCSPB_SULTO      ---KY--SIGKIATFYGNVGNVVRAYTYILGLGAEGISMIGKMSTLATNYLISQLKNVRG
GCSPB_AERPE      ---RW--SVGRLRAWIANTLAVLWAYAYILAMGPQGLRLAGEVSVVNTNYFIRLMEGHWG
GCSPB_HALSA      ---PR--SIGKVHGFQGNWPVLVKAFAYIDRLGDSGLADASAKAVLNANYLADQL-D---
GCSPB_CAUVC      GDDDAKTAFGRMSAFHGQMGMYVRAYAYMLSHGADGLRQVAEDAVLNANYIKAQLKDVMS
                        :.*::    .       :  *:   *   :      : : :.*:   :     

GCSPB_AQUAE      FKDPYPES-PCMHEFVLSATNLTK-YGVRASDVAKRILDYGFYAPTMYFPLIVREALMIE
GCSPB_CHLTE      YALPYPR--PVMHEFCLSGDRQKKEHGVRTLDIAKRLLDYGYHAPTVYFPLIVSEALMIE
GCSPB_BACAN      YDLPFDR--HCKHEFVLSGRRQ-KKLGVRTLDIAKRLLDFGYHPPTIYFPLNVEECIMIE
GCSPB_BACCR      YDLPFDR--HCKHEFVLSGRRQ-KKLGVRTLDIAKRLLDFGYHPPTIYFPLNVEECIMIE
GCSPB_BACSU      YDLPFDR--HCKHEFVLSGKRQ-KKLGVRTLDIAKRLLDFGYHPPTIYFPLNVEECIMIE
GCSPB_BACHD      FDLPYDQ--HCKHEFVLSGRQQ-KKLGVRTLDIAKRLLDFGYHPPTIYFPLNVEECLMIE
GCSPB_LISIN      YDLPFDQ--VCKHEFVLSGNRQ-KKLGVRTVDIAKRLLDHNFHPPTVYFPLIVGEAIMIE
GCSPB_LISMO      YDLPFDQ--VCKHEFVLSGNRQ-KKLGVRTVDIAKRLLDHNFHPPTVYFPLIVGEAIMIE
GCSPB_OCEIH      FELPYPQ--HCKHEFVLSGSKQ-KKLGVRTLDMAKRLLDFGYHPPTIYFPLNVEEGLMVE
GCSPB_STAAM      FEIPYKQ--YCKHEFVLSGVRQ-KEFGVRTLDMAKRLLDFGVHPPTIYFPLNVEEGMMIE
GCSPB_STAAW      FEIPYKQ--YCKHEFVLSGVRQ-KEFGVRTLDMAKRLLDFGVHPPTIYFPLNVEEGMMIE
GCSPB_STAES      FEIPFNQ--YCKHEFVLSGTLQ-KQYGVRTLDMAKRLLDFGVHPPTIYFPLNVEEGMMIE
GCSPB_CALS4      YKVAVDK--TCMHEFVLAGLAE-KSGDVRTLDVAKRLIDYGFHPPTIYFPLIVEEALMIE
GCSPB_THEMA      LEIPYNG--FCMHEFVASAEKVFRETGVRTLDIAKRILDFGVHPPTVYFPLIVPEALMIE
GCSPB_PYRAB      YELPHKE--LRKHEVVFSAEPMKRETGVRTLDVAKRLLDFGMHAPTIYFPLIVHEALMIE
GCSPB_PYRHO      YELPHKE--LRKHEVVFSAEPMKKETGVRTLDVAKRLLDFGLHAPTIYFPLIVHEALMIE
GCSPB_PYRFU      YSLPGKE--LRKHEVVFSAEPMKKETGVKALDVAKRLLDFGMHAPTIYFPLIVHEALMIE
GCSPB_THEAC      YEVPYYP--LKKHEFVLSTE----KTGRRALDIGKYLLDFGIHSPTVYFPLIVKEAMMIE
GCSPB_THEVO      YDIPYYP--LKKHEFVLSTE----NTGKRALDIGKYILDNGIHSPTVYFPLIVKEAMMIE
GCSPB_COXBU      FTL-AFPNRRASHEFIITLKPLTRAYGVTALDIAKRLLDYGFHAPTIYFPLLVPECLLIE
GCSPB_NITEU      FEI-AYPNRRASHEFIVTMKEIKDRTGVTAMNLAKRLLDKGFHAPTTYFPLLVPECLLIE
GCSPB_SACS2      LEL-IAPNRHRKHEVVFSVKQLMENYGVSANDVAKALLDNGFYAPTIYFPPIVEEALMIE
GCSPB_SULTO      LEL-IAPYRPRKHEVVFSAKTLAKETGVTANDVAKALLDRGFYAPTIYFPPNVEEALMIE
GCSPB_AERPE      YSLPYAPSRPRKHEVVLSAKPLKRETGATAEDVAKGLLDAGLYAPTIYFPLIVEEALMIE
GCSPB_HALSA      YEIPLGP---FHHEFVASAG---DQ---DAADVAKRMLDYGVHPPTTKWPELVAEALMTE
GCSPB_CAUVC      PAFPEGP---CMHEALFDDSWL-EGTGVTTLDFAKAMIDEGFHPMTMYFPLVVHGAMLIE
                             **               : :..* ::* . :. *  :*  *   :: *

GCSPB_AQUAE      PTETENPDTLKKFALILRKIVKEAKE-KPEILKKAPHRTPVRRIKEAEANRNLILKFKDI
GCSPB_CHLTE      PTETEAKETLNAFADAMIAIAEEAKS-NPDLIKSAPTTTPVKRLDEAQASRQLNICCQH-
GCSPB_BACAN      PTETESKETLDGFIDKMIQIAKEVEE-NPEVVQEAPHTTVIKRLDETMAARKPVLRYAKP
GCSPB_BACCR      PTETESKETLDGFIDKMIQIAKEVEE-NPEVVQEAPHTTVIKRLDETMAARKTSFTLCKA
GCSPB_BACSU      PTETESKETLDAFIDAMIQIAKEAEE-NPELVQEAPHTTIVKRMDETKAARHPVLRYEAE
GCSPB_BACHD      PTETESKETLDEFIEAMIQIAKEAEE-TPEVVQEAPHHTVIGRLDETTAARKPILRYEKI
GCSPB_LISIN      PTETESKETLDSFIDTMLKIAKEAEE-NPEIVQEAPHSTYVKRLDETRAARKPVLRYQKE
GCSPB_LISMO      PTETESKETLDSFIDTMLKIAKEAEE-NPEIVQEAPHSTYVKRLDETRAARKPILRYQKE
GCSPB_OCEIH      PTETESKETLDGFIDTMRTIAKEVEE-NPEIVQEAPHQTIVKRMDETRAARKPVLRYHP-
GCSPB_STAAM      PTETESKETLDYFIDTLISIAEEAKN-DPDKVLEAPHTTVIDRLDEATAARKPILKFENL
GCSPB_STAAW      PTETESKETLDYFIDTLISIAEEAKN-DPDKVLEAPHTTVIDRLDEATAARKPILKFENL
GCSPB_STAES      PTETESKETLDYFIDAMIQIADETKN-DPDKVLEAPHTTIIDRLDETTAARKPILKFEEL
GCSPB_CALS4      PTETETKETLDAFAETLIKIAKEAKE-NPELLKEAPHNTPVRRLDEVLAARNPVIRWTK-
GCSPB_THEMA      PTETENKETLDKYAEILERVVKEAYE-NPDALKNAPHNTPVRRVNEVLASKKPVFRWRG-
GCSPB_PYRAB      PTETVSKEELDAYVEAMKKISEEAYT-NPEVVKSAPHNTAVRRVDDVLASKKPIITWKMY
GCSPB_PYRHO      PTESVSKEELDAYVEALKKISEEAYT-NPEIVKSAPHNTAVRRVDDVLAAKKPVITWKMY
GCSPB_PYRFU      PTETVSKEELDAYVEALKRISEEAYT-NPEIVKSAPHNTAVKRVDDVLAAKKPIVTWRMY
GCSPB_THEAC      PTETVSKDDLDRYADVLISALKVP----EDDLKSRPRNTAVSRIDEVKAARDLKVRW---
GCSPB_THEVO      PTETVSKADLDNYADVLIEALKLS----DEELKSRPKNTAVRRIDEVKAARDLKLKW---
GCSPB_COXBU      PTETESKQTLDHFIEAMEKILTEIKT-TPDLLRNAPHQQLINRLDEVKAARELDLRWYPI
GCSPB_NITEU      PAETESKETLDRFVAAMKEILDEIAT-QPDMVKAAPHDMPLRKIDDVKAARELDLVWDPA
GCSPB_SACS2      PTETETKETLDMFAETLKKIVNDAKI-NPEQVMKSPNNTSIARLDQAYANHPSTITPTYR
GCSPB_SULTO      PTETEPKEVLDSFAIAIKEIINTAYS-NPKEILDTPKNTSVKRLDQVIANHPSSVTPTYR
GCSPB_AERPE      FTESETKENIEAYAARLKEIAEEARR-DPSTPRKWPRNTTSARVDNVRANHPRTVTPTWR
GCSPB_HALSA      PTETESKRTLDDLADAFNAVAGDD----DAALADAPSRTTARRIDQTAAARNPRLSWHDL
GCSPB_CAUVC      PTETESKHELDRFIAALRALAGAAKAGDTERFKGAPFHAPLRRLDETQAARKPRLRWKPV
                  :*:     :.     :                  *      ::.:. * :   .     

GCSPB_AQUAE      KE----------------------------------------------
GCSPB_CHLTE      ------------------------------------------------
GCSPB_BACAN      APVQV-------------------------------------------
GCSPB_BACCR      SSCTSLIRITKEELAEVGSFFVWRICPALTDSKLPTQNLAGAKKPGGR
GCSPB_BACSU      ER----------------------------------------------
GCSPB_BACHD      TQ----------------------------------------------
GCSPB_LISIN      V-----------------------------------------------
GCSPB_LISMO      V-----------------------------------------------
GCSPB_OCEIH      ------------------------------------------------
GCSPB_STAAM      KQEK--------------------------------------------
GCSPB_STAAW      KQEK--------------------------------------------
GCSPB_STAES      KDEKYKEHTNIDSEDN--------------------------------
GCSPB_CALS4      ------------------------------------------------
GCSPB_THEMA      ------------------------------------------------
GCSPB_PYRAB      KELKEKGEVDY-------------------------------------
GCSPB_PYRHO      KELKEKGEIDY-------------------------------------
GCSPB_PYRFU      KELKEKGEVDY-------------------------------------
GCSPB_THEAC      ------------------------------------------------
GCSPB_THEVO      ------------------------------------------------
GCSPB_COXBU      AKETEIFIQ---------------------------------------
GCSPB_NITEU      G-----------------------------------------------
GCSPB_SACS2      VLRLRRLGKIDYLK----------------------------------
GCSPB_SULTO      VKRLREEGKIGSLK----------------------------------
GCSPB_AERPE      VEVLRRQGKLGPLR----------------------------------
GCSPB_HALSA      D-----------------------------------------------
GCSPB_CAUVC      AAAPLAAE----------------------------------------