CLUSTAL format seed alignment for MF_00716

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NOSZ_PARDE      --ME---------SKQEKGLSRRALLGATAGGAAVAGAFGGRLALGPAALGLGTAGVATV
NOSZ_ACHCY      --ME---------SKEHKGLSRRALFSATAGSAILAGT------VGPAALSLGAAGLATP
NOSZ_BRUME      -MTE---------ETRKSQLSRRQLLGTSAFVAAAGAS-------GLGGALLAGSSETAL
NOSZ_BRUSU      -MTE---------ETRKSQLSRRQLLGTSAFVAAAGAS-------GLGGALLAGSSETAL
NOSZ_RHIME      -MSN---------EETKMRLNRRQMLGTTAFMAAAGAV-------GAGGALTLSGGTATP
NOSZ_BRADU      -MSD---------SDNIKGVSRRTLLGTTAAAAGVGLA-------GGAVVTKDGAGFVST
NOSZ_PSEAI      -MSDKQTD-----KDEKTGLSRRGFLGASALTRSAVA-----------ASGLVGGVMTRD
NOSZ_PSEST      -MSDKDSKNTP-QVPEKLGLSRRGFLGASAVTGAAVA-----------ATALGGAVMTRE
NOSZ_PSEFL      -MSDKKDQVPG-AVEAPRGVSRRSFLGTGAVTGAVLAG----------ATALGAGTFTRE
NOSZ_PSEAE      -MSDDTKS----PHEETHGLNRRGFLGASALTGAAALVG---------ASALGSAVVGRE
NOSZ_CUPNH      -MSKEKASIGN----GPGGIGRRQFLGTAALAGLAGVV---------ACTDKGAAPAAAA
NOSZ_RALSO      MMSKHPHSPSTPQDETPSVPGRRRFMNSAALAGLATVV---------ACTDKGAPAGSAA
                   .                .** ::.: *                              

NOSZ_PARDE      AGSGAALAASGD---------GSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPV
NOSZ_ACHCY      ARA----ATGAD---------GSVAPGKLDDYYGFWSSGQTGEMRILGIPSMRELMRVPV
NOSZ_BRUME      AAGAAKGGMS-----------PEVKPGELDEYYVFFSSGQCGEVRIVGLPSMRELMRIPV
NOSZ_BRUSU      AAGAAKGGMS-----------PEVKPGELDEYYVFFSSGQCGEVRIVGLPSMRELMRIPV
NOSZ_RHIME      ARAQETSGSS-----------YEVKPGELDEYYVFFSSGQSGEIRIVGAPSMREMMRIPV
NOSZ_BRADU      ADAQTKSAAPKAPPARPAVQKTEVAPGELDEYYVFFSSGQSGEMRIIGLPSMRELMRVPV
NOSZ_PSEAI      SWAAAAKEAQQK---------IHVAPGELDEYYGFWSGGHQGEVRVLGVPSMRELMRIPV
NOSZ_PSEST      SWAQAVKESKQK---------IHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPV
NOSZ_PSEFL      SWAAAAKEAKSK---------IHVGPGELDEYYGFWSGGHQGEVRVLGVPSMRELMRIPV
NOSZ_PSEAE      ARAAGKGE-RSK---------AEVAPGELDEYYGFWSGGHSGEVRVLGVPSMRELMRIPV
NOSZ_CUPNH      VGAPASGAHGAAHGAG---ASVHLKPGELDTYYGLWSGGHTGDMRVLGLPSGREILRIPC
NOSZ_RALSO      ATGVAATAEEHTV------AGLHPKPGQLDTYYGLWSGGHTGDMRVMGMPSGREIHRIPM
                  .                      **:** ** ::*.*: *::*::* ** **: *:* 

NOSZ_PARDE      FNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRF
NOSZ_ACHCY      FNRCSATGWGQTNESIRIHQRTMTEKTKKQLAANGKKIHDNGDLHHVHMSFTDGKYDGRY
NOSZ_BRUME      FNRDSATGWGLTNESRKVLTEGLLPQDREFLKDRGD-IFLNGDLHHPHPSFTDGTYDGRY
NOSZ_BRUSU      FNRDSATGWGLTNESRKVLTEGLLPQDREFLKDRGD-IFLNGDLHHPHPSFTDGTYDGRY
NOSZ_RHIME      FNRCSATGWGQTNESRKVMTEGLLPETVEFLKDQGG-LYLNGDLHHPHPSFTDGTYDGRY
NOSZ_BRADU      FNRCSATGWGQTNESLKVLTEGMQPATREFLKNRGG-TFMNGDLHHPHVSFTDGTYDGRY
NOSZ_PSEAI      FNVDSATGWGLTNESRHILGDTAK--------------FLNGDCHHPHISMTDGKYDGKY
NOSZ_PSEST      FNVDSATGWGLTNESRHIMGDSAK--------------FLNGDCHHPHISMTDGKYDGKY
NOSZ_PSEFL      FNVDSATGWGLTNESKRILGDSAK--------------YQNGDCHHPHISMTDGKYDGKY
NOSZ_PSEAE      FNVDSATGWGLTNESKRVLGDSAR--------------FLNGDCHHPHISMTDGKYDGKY
NOSZ_CUPNH      FVPDALVGWGITNESKKVMGARPD----------GTLRYTVADTHHTHASYKDGNYDGRY
NOSZ_RALSO      FVPDALVGWGITNESKKVMGTRPD----------GRLKYTVGDTHHVHASYKDGNYDGRY
                *   : .*** **** ::                    .  .* ** * * .:*.***::

NOSZ_PARDE      LFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQK-------WPRSNYVFCNGED
NOSZ_ACHCY      LFMNDKANTRVARVRCDVMKTDAILEIPNAKGIHGMRPQK-------WPRSNYVFCNGED
NOSZ_BRUME      LYANDKANTRVCRIRLDVMKCDKIIQLPNQHTVHGLRVQK-------YPKTGYVFCNGED
NOSZ_BRUSU      LYANDKANTRVCRIRLDVMKCDKIIQLPNQHTVHGLRVQK-------YPKTGYVFCNGED
NOSZ_RHIME      LYANDKSNSRVCRIRLDVMKCDKIIQLPNQHTVHGLRVQK-------YPKTGYVFCNGED
NOSZ_BRADU      AFMNDKANSRVARVRLDVMKCDKIIELPNQHTVHGLRLQK-------YPRTGYVFCNGED
NOSZ_PSEAI      LFINDKANSRVARIRLDIMKCDKITTIPNVQAIHGLRLQK-------VPHTKYVFCNAEF
NOSZ_PSEST      LFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQK-------VPHTKYVFANAEF
NOSZ_PSEFL      LFINDKANSRVARIRLDIMKCDKILTVPNVQAIHGLRLQK-------VPYTKYVFANAEF
NOSZ_PSEAE      LFINDKANSRVARIRLDVMKCDRIVTIPNVQAIHGLRLQK-------VPHTRYVFCNAEF
NOSZ_CUPNH      AWVNDKINSRIARIRLDYFICDKITELPNVQGFHGIFPDKRDPVDTKINYTTRVFCGGEF
NOSZ_RALSO      AWINDKINSRLGRVRLDYFICDKITELPNVQGFHGIFPDKRDPVDPQINYTTRVFCGGEF
                 : *** *:*: *:* * :  * :  :** : .**:  :*          :  **...* 

NOSZ_PARDE      ETPLVNDGTNMEDV-ANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYN
NOSZ_ACHCY      EAPLVNDGSTMTDV-ATYVNIFTAVDADKWEVAWQVKVSGNLDNCDADYEGKWAFSTSYN
NOSZ_BRUME      RVPIPNDGSHLNDV-KQYHAIFTAVDGETMKVAWQVMVDGNLDNVDCDYQGKYAFSTCYN
NOSZ_BRUSU      RVPIPNDGSHLNDV-KQYHAIFTAVDGETMKVAWQVMVDGNLDNVDCDYQGKYAFSTCYN
NOSZ_RHIME      AVPVPNDGKTMGDK-NSYQAIFTAVDGETMEVAWQVMVDGNLDNVDADYQGKYCFATCYN
NOSZ_BRADU      GVPLPNDGKVLDNP-KEYHSIFTALDGDTMKVAWQVMVSGNLDNVDSDYQGKYCFSTCYN
NOSZ_PSEAI      IIPHPNDGKVFDLEDENSFTMYNAVDAETMEVAFQVIVDGNLDNTDADYTGRFTAATCYN
NOSZ_PSEST      IIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYN
NOSZ_PSEFL      VIPHPNDGHTFDLQDKNSFTMFNAIDAEKMEMAFQVIVDGNLDNSDADYTGKYAASTCYN
NOSZ_PSEAE      IIPHPNDGSTFDLSGDNAFTLYNAIDAETMEVAWQVIVDGNLDNTDMDYSGRFAASTCYN
NOSZ_CUPNH      GIPLP-SAPTEDAG--KYRSLFTCVDAETMAVRWQVLIDGNCDLVATSYDGKLAATNQYN
NOSZ_RALSO      AIPLPNTAGIDDPA--KYRSLFTCVDAESMEVRWQVLIDGNCDLVATSYDGKLAATNQYN
                  *    .            ::..:*.:.  : :** :.** *    .* *:   :. **

NOSZ_PARDE      SEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNG--VKVVDGRKE----ASSLF
NOSZ_ACHCY      SEMGMTLEEMTKSEMDHVVVFNIAEIEKAIKAGQYEEING--VKVVDGRKE----AKSLF
NOSZ_BRUME      SEEGTTLAEMMSSEQDWIVVFNLKRIEEAVANGDFKEMNG--VPVIDGRH------GSKY
NOSZ_BRUSU      SEEGTTLAEMMSSEQDWIVVFNLKRIEEAVANGDFKEMNG--VPVIDGRH------GSKY
NOSZ_RHIME      SEEGFTLADMMASEQDWVVIFNLKRIEEAVAKGDYKEIGG--VPVLDGRK------GSPY
NOSZ_BRADU      AEEGVTLAEMTANEQDWVVIFNLKRIEEAVKKGDFKEMNG--VPVIDGRK------GSPY
NOSZ_PSEAI      SEKAFDLGGMMRNERDWVVVFDISAVEKEIKAGRFITLGDSKVPVVDGRKKDG--KDSVV
NOSZ_PSEST      SEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDG--KDSKF
NOSZ_PSEFL      SEKAYDLGGMMRNERDWVVVFNILRIEAAIKAGKFITLDGSKVPVVDGRKTDG--KDSEF
NOSZ_PSEAE      SEKAVDLGGMMRNERDWVVVFDIPRIEAEIKAKRFVTLGDSKVPVVDGRRKDG--KDSPV
NOSZ_CUPNH      TENGAHFEDMMSAERDACVFFNIARIEAAVQAGKFKTYGDSKVPVVDGTQAANKDPKTAL
NOSZ_RALSO      TEMGAHYEDMMSAERDACLFFNVARIEAAVKAGRFKTIGDSKVPVVDGTHAANQDPKTAL
                :* .     *   * *  :.*::  :*  :    :   ..  . *:** :       :  

NOSZ_PARDE      TRYIPIANNPHGCNMAPDKKHLCVAGKLSPTATVLDVTRFDAVFYENAD-PRSAVVAEPE
NOSZ_ACHCY      TRYIPIANNPHGCNMAPDRKHLCVAGKLSPTVTVLDVTKFDALFYDNAE-PRSAVVAEPE
NOSZ_BRUME      TRYIPVPNSPHGINTALDGIHVVANGKLSPTVTVFDVRKFDDLFDDKIK-PRDAVVAEPE
NOSZ_BRUSU      TRYIPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDDLFDDKIK-PRDAVVAEPE
NOSZ_RHIME      TRYVPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDDLFDDKIQ-ARDTVVAEPE
NOSZ_BRADU      TRYVPVSNNPHGMNTAPDGIHIVAAGKLSPTVTVMDVRLFDQLFDDKIK-PRDVVVAEPE
NOSZ_PSEAI      TRYIPVPKNPHGLNTSTDGKYFIANGKLSPTCSMIAIDLLPDLFAGKLKDPRDVVVGEPE
NOSZ_PSEST      TRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPE
NOSZ_PSEFL      TRYIPVPKNPHGLNTSSDGKYFIANGKLSPTVSMIAIDRLDDLFNDRYKDPREVIVAEPE
NOSZ_PSEAE      TRYIPVPKNPHGLNTSPDGKYFIANGKLSPTCTMIAIERLGDLFAGKLADPRDVVVGEPE
NOSZ_CUPNH      TAYVSVPKNPHGVNASPDQKYFICAGKLSPTATVIELSRVLGWFDGKQEKLDDAIVAEVE
NOSZ_RALSO      TAYVSVPKNPHGVNASPDQKYFICAGKLSPTATVIELARVLDWFDGKLAKIDDAIVAEVE
                * *:.:.:.*** * : *  :.   ****** ::: :  .   *  .     ..:*.* *

NOSZ_PARDE      LGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEK-VDPIKDKLDVHYQPGHL
NOSZ_ACHCY      LGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIDEAIRAYAGEK-INPIKDKLDVQYQPGHL
NOSZ_BRUME      LGLGPLHTAYDDKGNAYTTLFIDSQICKWNIEDAKRAFKGEK-VDPIRQKLDVHYQPGHN
NOSZ_BRUSU      LGLGPLHTAYDDKGNAYTTLFIDSQICKWNIEDAKRAFKGEK-VDPIRQKLDVHYQPGHN
NOSZ_RHIME      LGLGPLHTAYDGKGNAYTTLFIDSQVCKWNIEDAKRAYAGEK-VDPIRHKLDVHYQPGHN
NOSZ_BRADU      LGLGPLHTAYDGKGNAYTTLFLDSQVVKWNIDLAKRAFKGEK-VDPIIQKLDVHYQPGHN
NOSZ_PSEAI      LGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEARRAYKGEK-VNYIKQKLDVHYQPGHL
NOSZ_PSEST      LGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEK-VNYIKQKLDVHYQPGHL
NOSZ_PSEFL      LGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMDEAIRAYKGEK-VNYIKQKLDVQYQPGHN
NOSZ_PSEAE      LGLGPLHTTFDGRGNAYTTLFIDSQLVKWNLADAVRAYKGEK-VDYIRQKLDVQYQPGHN
NOSZ_CUPNH      LGLGPLHTAFDGRGNAYTTLFLDSQLVKWNLDAAIKFHKGDKNAKYVVDRLDLQYQPGHV
NOSZ_RALSO      LGLGPLHTAFDGRGNAYTTLFLDSQIVKWNIDAAIRFHKGDKNAKYVVDRLDVHYQPGHL
                ********::*.:*****:**:***: ***:  * : . *:*  . : .:**::***** 

NOSZ_PARDE      KTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPH
NOSZ_ACHCY      KTVMGETLDAANDWLVCLCKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPH
NOSZ_BRUME      HSSMGQTKEVDGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPH
NOSZ_BRUSU      HSSMGQTKEVDGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPH
NOSZ_RHIME      HTSMGQTKEADGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDEMVLVHDNPTFAEPH
NOSZ_BRADU      HSSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQLIDISGDQMKLVHDGPSFAEPH
NOSZ_PSEAI      HASLCETSEADGKWLVALSKFSKDRFLPTGPLHPENDQLIDISGDVMKLVHDGPTFAEPH
NOSZ_PSEST      HASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPH
NOSZ_PSEFL      HASLTETSEADGKWLVVLCKFSKDRFLPTGPLHPENDQLIDISGEEMKLVHDGPAFAEPH
NOSZ_PSEAE      HATLCETSEADGKWIVVLSKFSKDRFLPTGPLHPENDQLIDISGEEMKLVHDGPTFAEPH
NOSZ_CUPNH      NASQSETVAADGKYLAVGCKFSKDRFLPVGPLHPENEQLIDISGQKMVLMADHPVRGEPH
NOSZ_RALSO      NASQSETVAADGKFLAVGCKFSKDRFLPVGPLHPENEQFIDISGDKMVLLQDHPIRSEPH
                ::   :*  . ..::    ******:* .***:***:*:*****: * :: * *  .***

NOSZ_PARDE      DAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDGNKVRVYMSSVA
NOSZ_ACHCY      DAIAVSPSILPNIRSVWDRKDPLWAETRKQAEADEVDIDEWTEAVIRDGNKVRVYMTSVA
NOSZ_BRUME      DATIVHRSKINPV-SFWSREDPFFADAVAQAKADGLDLME-ANEVVRDGNKVRVYMTSSA
NOSZ_BRUSU      DATIVHRSKINPV-SFWSREDPFFADAVAQAKADGLDLME-ANEVVRDGNKVRVYMTSSA
NOSZ_RHIME      DATIVHASKINPV-HVWNRDDPFFADAVAQAKADNIDLMV-DSEVIRDGNKVRVYMTSAA
NOSZ_BRADU      DATIVHRSKINPI-SIWDRADPMFADAVKQAKADGINLEA-DSKIIRDGNKVRVYMTSTA
NOSZ_PSEAI      DCIMARRDQIKTR-KIWDRNDPFFAPTVAMAKKDGINLEE-DNKVIRDGNKVRVYMTSMA
NOSZ_PSEST      DCIMARRDQIKTK-KIWDRNDPFFAPTVEMAKKDGINLDT-DNKVIRDGNKVRVYMTSMA
NOSZ_PSEFL      DCILARRDQIKTQ-KIWNRNDPFFADTVALAKKDGINLET-DNKVIRDGNKVRVYMTSMA
NOSZ_PSEAE      DCILARRDQIKTR-KIWDRKDPFFAETVKRAEKDGIDLMK-DNKVIREGNKVRVYMVSMA
NOSZ_CUPNH      DFIIFKRELVRPK-QVYALDD--FPLAIKDPK---------ESGVFRNGRKVTVKITSQA
NOSZ_RALSO      DFIIFKRELLHPK-QIYSLDD--FPLATKDPK---------QSGVVRNGKKVTVRLTSQA
                *      . :     .:   *  :. :   .:          . :.*:*.** * : * *

NOSZ_PARDE      PSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNYGVAMEIGPQMTSSVTFVAANPG
NOSZ_ACHCY      PSFSQPSFTVKEGDEVTVIVTNLDEIDDLTHGFTMGNHGVAMEVGPQQTSSVTFVAANPG
NOSZ_BRUME      PAFGLTEFTVQQDDEVTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPG
NOSZ_BRUSU      PAFGLTEFTVQQDDEVTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPG
NOSZ_RHIME      PAFGLDDFTVKQGDEVTVYVTNIDEVEDLTHGFCIVNYGINMEVAPQATASVTFKASRPG
NOSZ_BRADU      PAFGLEQFQVKQGDQVTVYITNIDAVEDLTHGFCIVNYGIQMEVAPMATASVSFSADKAG
NOSZ_PSEAI      PAYGLTEFKVKQGNEVTVVITNMDQIEDVSHGFVMVNHGVSMEISPQQTSSITFIADKPG
NOSZ_PSEST      PAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPG
NOSZ_PSEFL      PAYGLTEFTVKQGNEVTVTITNIDQIEDVSHGFVMTNHGASMEISPQQTSSITFTADKAG
NOSZ_PSEAE      PSFGLTEFKVKQGDEVTVTITNLDEIEDVTHGFVMVNHGVCMEISPQQTSSITFVADKPG
NOSZ_CUPNH      PAFSLREFKLKKGDEVTLILTNLDKIEDLTHGFAIPKYNVNFIVNPQETASVTFVADKPG
NOSZ_RALSO      PSYSLREFKLKKGDEVTLILTNLDKVEDLTHGFAIPKYDINFIVNPQETASVTFIADKPG
                *::.  .* :::.::**: :**:* ::*::*** : ::.  : : *  *:*::* * ..*

NOSZ_PARDE      VYWYYCQWFCHALHMEMRGRMLVEPKEA
NOSZ_ACHCY      VYWYYCQWFCHALHMEMRGRMFVEPKGA
NOSZ_BRUME      VWWYYCSWFCHAMHMEMQGRMLVEPKKA
NOSZ_BRUSU      VWWYYCSWFCHAMHMEMQGRMLVEPKKA
NOSZ_RHIME      VYWYYCTWFCHAMHMEMKGRMLVEAQGA
NOSZ_BRADU      VYWYYCSWFCHAMHMEMKGRMFVEPKSV
NOSZ_PSEAI      LHWYYCSWFCHALHMEMVGRMMVEPA--
NOSZ_PSEST      LHWYYCSWFCHALHMEMVGRMMVEPA--
NOSZ_PSEFL      LHWYYCSWFCHALHMEMVGRMLVEKA--
NOSZ_PSEAE      VHWYYCSWFCHALHMEMCGRMLVEKA--
NOSZ_CUPNH      VFWCYCTHFCHALHLEMRTRMIVEA---
NOSZ_RALSO      VFWCYCTHFCHALHLEMRSRMIVEA---
                : * **  ****:*:**  **:**