CLUSTAL format seed alignment for MF_00717

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBY_CYACA      ---MDIRLIIVLMPILMAASWAIYNIGKALVGQF-GKMLNE----
PSBY_CYAM1      ---MDTRLLIVLLPIIAAASWAIYNIGKILLLQL-TKRS------
PSBY_PORPU      ---MDSRLLIVLIPVLAAASWAVYNIGRVALQQF-RKMTS-----
PSBY_GUITH      ---MDMRLLIVLLPVLAAASWAGFNIARIALRQL-SRLGSR----
PSBY_PROMM      ------MILIVLLPILLAATWAFINIRGAALKQQGLGLVSKNKG-
PSBY_THEEB      ---MDWRVLVVLLPVLLAAGWAVRNILPYAVKQV-QKLLQKAKAA
PSBY_TRICV      ---MDSRLLVIAAPLLVAASWALFNIGRLAIQQI-QRLSA-----
PSBY_SYNPX      MLGIDARLFLVVAPILAAVSWAAFNIGRAAVGQL-QLLIKRSRA-
PSBY_NOSS1      -MDIDFRVAIVLAPIAVAAGWAAFNIGAAAIRQV-QNFLNREA--
PSBY_SYNY3      ---MDWRVIVVVSPLLIAATWAAINIGAAAIRQL-QDVLGREA--
PSBY_CYAPA      ---MSMRLVVVLLPLGIALGWAVYNIGKLAIEQW-RRTGSKV---
PSBY_PROMP      ----MLRAIVVFAPIIAALAWVVFNIQKPAREQFNRDFLGKD---
                         ::  *:  *  *.  **      *